Difference between revisions of "Fabry Disease 2012"

From Bioinformatikpedia
(Tasks)
 
(3 intermediate revisions by one other user not shown)
Line 227: Line 227:
   
   
{| class="wikitable" border="1" style="margin:auto; text-align:right; border-spacing:0;"
+
{| class="sortable" border="1" style="margin:auto; text-align:right; border-spacing:0;"
 
|+ Mutation counts according to [http://www.hgmd.cf.ac.uk/ac/gene.php?gene=GLA HGMD], sorted in decreasing order
 
|+ Mutation counts according to [http://www.hgmd.cf.ac.uk/ac/gene.php?gene=GLA HGMD], sorted in decreasing order
 
! style="text-align:center;" | Mutation type || # of public mutations || # of commerical mutations
 
! style="text-align:center;" | Mutation type || # of public mutations || # of commerical mutations
Line 250: Line 250:
 
|-
 
|-
 
| style="text-align:left;" | Repeat variations || 0 || 0
 
| style="text-align:left;" | Repeat variations || 0 || 0
|-
 
| colspan="3"|
 
 
|- style="font-weight:bold;"
 
|- style="font-weight:bold;"
| style="text-align:left;" | Total || 514 || 653
+
| style="border-top: 2px solid #000; text-align:left;" | Total
  +
| style="border-top: 2px solid #000;" | 514
  +
| style="border-top: 2px solid #000;" | 653
 
|}
 
|}
   
Line 274: Line 274:
   
 
== Tasks ==
 
== Tasks ==
* Task2: [[Fabry:Sequence alignments (sequence searches and multiple alignments)]]
+
* [[Fabry:Sequence alignments (sequence searches and multiple alignments)|Task 2: Sequence alignments (sequence searches and multiple alignments)]]
  +
* [[Fabry:Sequence-based analyses|Task 3: Sequence-based analyses]]
  +
* [[Fabry:Homology based structure predictions|Task 4: Homology based structure predictions]]
  +
* [[Fabry:Mapping point mutations|Task 5: Mapping point mutations]]
  +
* [[Fabry:Sequence-based mutation analysis|Task 6: Sequence-based mutation analysis]]
  +
* [[Fabry:Structure-based mutation analysis|Task 7: Structure-based mutation analysis]]
  +
* [[Fabry:Molecular Dynamics Simulations|Task 8: Molecular Dynamics Simulations]]
  +
* [[Fabry:Normal mode analysis|Task 9: Normal mode analysis]]
  +
* [[Fabry:Molecular Dynamics Simulations Analysis|Task 10: Molecular Dynamics Simulations Analysis]]
  +
  +
[[Category: Fabry Disease 2012]]

Latest revision as of 13:21, 21 February 2013

Summary

The protein encoded by the Fabry-associated GLA gene: α-Galactosidase A

The Fabry disease is a rare X-linked lysomal storage disease. It, or more precisely its symptoms, was first described in 1898 by the german dermatologist Johannes Fabry and independently by William Anderson in the same year. The ICD-10 classifies it as E75.2, which represents 'Other sphingolipidosis' in the group of 'Disorders of sphingolipid metabolism and other lipid storage disorders'. This is, by the way, the same classification as for the Gaucher's disease.

The disease results from deficient α-Galactosidase A activity which leads to a progressive accumulation of globotriaosylceramide (Gb3) in the lysosomes in the different tissues.

Since it is an X-linked disease, it occurs mostly in males, with a prevalence that ranges from 1:1,500[1] to 1:476,000[2].

Alternative names include:

  • Anderson-Fabry disease
  • Alpha-galactosidase A deficiency
  • Angiokeratoma corporis diffusum
  • Ceramide trihexosidosis

Phenotype

Symptoms, early and late onset
Built up Gb3 and glycosphingolipids may lead to heart attack and stroke

As almost each family has its own private mutation, phenotypes of affected persons can be very variable. In general, with increasing age symptoms become more severe. This effect is due to more and more accumulated glycosphingolipids that cannot be converted by the dysfunctional enzyme. The built up globotriaoslyceramide (Gb3) and related glycosphingolipids in the lysosomes, tissues, blood vessels and organs lead to a malfunction of major organs in the body starting at an age of 30 - 35 (see picture on the right). Thus untreated patients die approximately 10 - 20 years early (females and males, respectively).


Symptoms (onset)

Childhood

  • Acroparesthesia (Numbness in extremities)
  • Hypohidrosis (decreased sweating)
  • Cornea opacity

Acroparesthesia is signaling the clinical onset of Fabry Disease. It is caused by deposited glycosphingolipids in the small blood supplying vessels of the peripheral nerves. Another very typical symptom for Fabry Disease is the whorled streaks and cloudiness of the eye (cornea opacity) resulting from deposits of granular material on the posterior lens capsule.

Adolesence

  • Gastro Intestinal Manifestation - GIM (nausea, vomitting)
  • Angiokeratoma
  • Depression
  • Heat/cold intolerance
  • Fatigue

The GIM results from accumulated Gb-3 in small intestinal vessels and autonomic ganglia of the intestinal. Eventually this often leads to a weight loss of the patient. From early stages on psychosocial manifestations like depression and fatigue lead to a degression of life quality. In a study [Whybra et al 2004] the occurrence of angiokeratomas correlated with the severity of Fabry disease and its systemic manifestation.

Adulthood

  • Renal Disease
    • Proteinuria (excess of serum proteins in the urine)
    • Progressive renal insufficiency
    • End-stage renal disease
  • Cardiac Disease
    • Hypertension (high blood pressure)
    • Cardiomyopathy
  • Central Nervous System Disease
    • Headache
    • Stroke
    • Ischaemic cerebrovascular events
    • Binswanger’s Disease (Vascular dementia)

According to FOS, the most common cause of death were renal failure (males) and cerebrovascular disease (females), whereas Waldek et al claim that the principal cause of death is cardiovascular disease. Most of these diseased patients had received a kidney transplant. Again, all these symptoms are in consequence of progressive glycosphingolipid deposition mostly in vessels and in the lysosomes.

Atypical variants

It is believed that late onset variants mostly with specific mutations are underdiagnosed, because of the missing typical early onset symptoms like acroparesthesia and cornea opacity. According to Rolfs et el. patients with these variants in the majority of cases have missense or splicing mutations leading to a residual α-galactosidase A enzyme activity.

Cardiac variant

This variant does not affect patients until their sixth to eighth decade. Usually a hypertrophic cardiomyopathy is diagnosed. Besides from a mild to moderate proteinuria, due to accumulated Gb-3 in the podocytes, no involvement of the kidney is observed.

Renal variant

Many patients with this variant are misdiagnosed, because about 80% of them do not show any signs of angiokeratoma, acroparesthesias, hypohidrosis, or corneal opacities. However they had moderate to severe left ventricular hypertrophy.

Major manifestations in Classic and atypical Fabry Disease

see source

Manifestation Classic Renal variant Cardiac variant
Age at onset 4-8 years > 25 years > 40 years
Average age of death 41 years > 60 years > 60 years
Angiokeratoma ++ - -
Acroparesthesia ++ -/+ -
Hypohidrosis ++ -/+ -
Corneal opacity ++ - -
Heart Left ventricular hypertrophy, Ischemia Left ventricular hypertrophy Left ventricular hypertrophy, myopathy
Brain Transient ischemic attack - -
Kidney End stage renal disease End stage renal disease Proteinuria
Residual α-Gal A activity < 1% > 1% > 1%

+ = Present, - = Absent

Cross-references

Diagnosis

As described in Symptoms, the diversity of symptoms and especially the lack of early onset ones in the atypical variants make Fabry desease hard to diagnose. Thus it is believed that the number of patients suffering from Fabry Disease is underestimated.

Presumptive Diagnosis

Most cases of Fabry Disease are revealed due to a family member being diagnosed. Also, in a lot of cases observation of early onset symptoms like angiokeratoma and acroparesthesia lead to further testing and eventually to the diagnosis Fabry Disease. Other symptoms that are associated with the disease may also be initiation of further examination.

  • Observation of symptoms
  • Family history
  • Lab findings
    • Kidney biopsy (Renal disease)
    • Oculist findings (Cornea Opacity)
    • MRI (Cardiac disease)
    • Echocardiography (Cardiac disease)

Definitive Diagnosis

After a presumptive diagnosis, there is a demand in substantiating this suspicion. The first step would be an enzyme assay. Usually a fluorometric assay is performed, where the difference in the fluorescence of substrate (4-methylumbelliferyl-α-D-galactopyranoside) and product is measured. Thereby, the enzymatic activity of α-Gal A may be measured. Less than 1% of normal enzyme activity is an indication of classic Fabry Disease, more than 1%, but still decreased activity, indicates atypical variants (see section Major manifestations in Classic and atypical Fabry Disease). This method is not sufficient for female carrier detection. Due to random X Chromosome inactivation some females have a normal or only little decreased enzyme activity.

Thus molecular genetic testing is necessary. This method is also useful for early detection and thus treatment at an early stage if family history is known. Most of the times full gene sequencing is needed, where the mutation in the GLA gene is detected. Almost 100 % of affected males, but less than 100% of affected females can be detected. Mutations in heterozygous females may not be detected, as well as deletion or duplications in the gene of both sexes (PCR fails in this case). Thus targeted mutation analysis can be performed, if the private mutation of the respective family is known. Otherwise, if a partial or whole gene deletion is suspected, several methods, including quantitative PCR and multiplex ligation-dependant probe amplification, can be applied.

  • Enzyme Assay (Plasma, leukocytes, tissue, urine)
  • Gene Mutation Analysis
    • Sequence analysis
    • Targeted mutation analysis
    • Deletion testing

All listed diagnosis methods may be performed prenatal.

Cross-references

Treatment

Currently there is no cure for Fabry Disease, but there are some ways to treat the symptoms.

Symptom management

Usually, Fabry Disease is diagnosed after the onset of symptoms. Thus, manifestations need to be treated individually. Some examples:

Acroparesthesia: The pain in the extremities is reduced by administering agents that interfere with the sodium channel, such as Diphenylhydantoin.

Renal Disease: ACE inhibitors (angiotensin-converting-enzyme inhibitor) are used to prevent proteinuria. If the kidney is already damaged, renal transplantation can correct the organ's function.

Prevention of early symptoms

Enzyme Replacement Therapy (ERT) should be initiated as soon as possible in each patient. By administering synthetic α-galactosidase A an almost normal metabolism may be ensured. Thus cerebrovascular, cardiac and neurological complications can be prevented. Drawbacks of this treatment are the high costs and the need for an infusion at the hospital every two weeks.

Prevention of late onset symptoms

It is important to undergo prophylaxis of heart, renovascular and cerebrovascular disease. These are essentially the same as for patients without Fabry Disease. Usually the blood pressure and cholesterol need to be normalized. Acetylsalicylic acid may be applied to prevent stroke. Also smoking should be avoided, because it has been shown that obstructive lung disease is more severe in smokers.

Future prospects

Substrate Reduction Therapy is already an approved therapy for other lysosomal storage diseases like Gaucher Disease and thus was also considered as therapy for Fabry Disease by inhibiting the addition of glucose to ceramide (e.g. with a glucosylceramide synthase inhibitor like Miglustat) and therefore blocking the formation of Gb3.

Gene Therapy currently is under research without major longterm benefit. Although the amount of built up glycosphingolipids is reduced up to 60 - 85 % in the major organs after one injection of a viral vector containing a modified α-actin promoter, the Gb3 level had not been significantly reduced after 6 months anymore. see Researcher hope that new self-inactivating lentival vectors may be of help in the future.

Chaperon Therapy: Chaperons assist the non-covalent folding or unfolding and the assembly or disassembly of macromolecular structures. In the body a certain type of these proteins can increase the catalytic activity of some misfolded forms of α-galactosidase A. A hindrance is the large amount of patients with nonsense mutations who are excluded from this therapy of Fabry Disease due to the lack of a detectable residual enzyme. Therefore it is necessary to determine the type of mutation before starting the treatment.

ERT with α-N-acetylgalactosiminidase essentially works equivalent to the usual ERT. It has the benefit of not being immunogen in Fabry Disease patients. In the active site modified α-N-acetylgalactosiminidase is able to convert Gb3.

Cross-references

Biochemical disease mechanism

The glycosphingolipid biosynthesis - globoseries. The α-Galactosidase A enzyme (EC 3.2.1.22) is marked in red.
The hydrolysis of globotriaosylceramide to lactosylceramide that is catalyzed by α-Galactosidase A (simplified visualization)

The cause of the Fabry disease lies in the globoseries of the glycosphingolipid biosynthesis. In the first step of this metabolism, lactosylceramide reacts to from globotriaosylceramide. However, these two substrates are in imbalance because of the deficient enzymatic activity of α-Galactosidase A, which catalyzes the hydrolysis from globotriaosylceramide (Gb3) to lactosylceramide, which again leads to an accumulation of Gb3 in this metabolism. This excess of Gb3 provokes the symptoms of the Fabry disease.

The affected hydrolysis can be described in detail by:

The hydrolysis of globotriaosylceramide to lactosylceramide that is catalyzed by α-galactosidase A

Globotriaosylceramide + H2O ⇌ D-Galactose + Lactosylceramide


Cross-references


Genetic Background

Inheritance

Mode of inheritance for a X linked disease like Fabry

Fabry Disease is inherited in an X-linked manner. Thus there is a 50% chance for an affected or a carrier female to pass on Fabry Disease to any of her offspring. Any of these male children who she passed the allele on to will be affected, her female children are obligate carriers and can be affected if they got the mutated allele.

Due to the fact that males only have one X chromosome, they do not pass on the disease to any of their male offspring, but all of their female children are obligate carriers and may even be affected.

(see picture on the right)


Genomic Characteristics

The human X-Chromosome. The location of the GLA gene is highlighted in orange.

The enzyme α-galactosidase is encoded by the gene GLA which is located on the long arm of X chromosome at the locus Xq22.1 (100,652,778 – 100,663,000) (see the figure on the right). It consists of seven exons without any alternate splicing sites and is transcribed on the reverse strand.

The human GLA gene. The green boxes represent the exons. Note the reverse transcription direction.


Mutations

There is no other disease associated with the GLA gene according to OMIM. The mutations in this gene are usually private in a family-wise scope which is the reason why there are so many of them known (more than 650 in HGMD). It can be distinguished between two types of the Fabry disease, the classic and the variant phenotype, which are severe and milder, respectively.

Classic phenotype

  • three of more atoms in the main chain of the protein affected by mutation
  • often active site involved

Variant phenotype

  • less than three atoms affected in protein main chain
  • active site is kept intact → enzymatic activity is only marginally decreased


The table below shows the numbers of the different mutation types.


Mutation counts according to HGMD, sorted in decreasing order
Mutation type # of public mutations # of commerical mutations
Missense/nonsense 354 441
Small deletions 74 97
Small insertions 29 32
Splicing 28 34
Gross deletions 16 27
Small indels 8 10
Complex rearrangements 3 6
Gross insertions/duplications 1 4
Regulatory 1 2
Repeat variations 0 0
Total 514 653


As the table clearly shows, most of the mutations (nearly 70%) are missense/nonsense mutations and about 90% are any kind of small mutations (missense, small deletions and small insertions). The fact that such small mutations are sufficient to cause the Fabry disease explains the high number of disease-associated mutations and why many mutations are private to a particular family.

Reference sequence

The reference sequence of α-Galactosidase A that will be used in the following tasks was obtained from Swissprot P06280.

>gi|4504009|ref|NP_000160.1| alpha-galactosidase A precursor [Homo sapiens]
MQLRNPELHLGCALALRFLALVSWDIPGARALDNGLARTPTMGWLHWERFMCNLDCQEEPDSCISEKLFM
EMAELMVSEGWKDAGYEYLCIDDCWMAPQRDSEGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVGNK
TCAGFPGSFGYYDIDAQTFADWGVDLLKFDGCYCDSLENLADGYKHMSLALNRTGRSIVYSCEWPLYMWP
FQKPNYTEIRQYCNHWRNFADIDDSWKSIKSILDWTSFNQERIVDVAGPGGWNDPDMLVIGNFGLSWNQQ
VTQMALWAIMAAPLFMSNDLRHISPQAKALLQDKDVIAINQDPLGKQGYQLRQGDNFEVWERPLSGLAWA
VAMINRQEIGGPRSYTIAVASLGKGVACNPACFITQLLPVKRKLGFYEWTSRLRSHINPTGTVLLQLENT
MQMSLKDLL


Tasks