Difference between revisions of "Hemochromatosis"

From Bioinformatikpedia
 
(68 intermediate revisions by the same user not shown)
Line 1: Line 1:
  +
<figure id="hfe">
[[File:Hfe_mutation_small.jpg|frame|HFE-Protein(blue) in complex with beta-microglobulin(cyan). The cystein at position 282 is highlighted in red and its disulfide interaction partner in orange. Source: PDB ID 1A6Z, visualized with PyMOL]]
 
  +
[[File:1a6z_match_scheme.png|thumb|500px| '''Figure 1: '''The two domains of the HFE protein, the MHC I domain (green) and the immunoglobulin constant domain (blue) are shown in complex with beta-microglobulin (orange). The cystein at position 282 is highlighted in red and its disulfide interaction partner in white. PDB ID: 1A6Z.]]
 
  +
</figure>
   
 
'''Hemochromatosis''' is a hereditary disorder that leads to an increased intestinal iron uptake from food. The excess iron is stored in the parenchymal cells of organs and tissues and thus disrupts their normal function. There are various genotypes that can lead to hemochromatosis. The most common form of the disease is caused by a point mutation in the HFE gene. '''HFE''' stands for '''H'''igh '''FE'''rrum.
 
'''Hemochromatosis''' is a hereditary disorder that leads to an increased intestinal iron uptake from food. The excess iron is stored in the parenchymal cells of organs and tissues and thus disrupts their normal function. There are various genotypes that can lead to hemochromatosis. The most common form of the disease is caused by a point mutation in the HFE gene. '''HFE''' stands for '''H'''igh '''FE'''rrum.
Line 13: Line 14:
   
 
*liver fibrosis and cirrhosis, increased risk to develop hepatocellular carcinoma
 
*liver fibrosis and cirrhosis, increased risk to develop hepatocellular carcinoma
*Glucose intolerance and insulin resistance due to damages in the pancreas (diabetes mellitus).
+
*glucose intolerance and insulin resistance due to damages in the pancreas (diabetes mellitus)
   
*Gonadal dysfunction, hypogonadism and decreased libido.
+
*gonadal dysfunction, hypogonadism and decreased libido
   
*heart failure, arrhythmias or pericarditisheart failure
+
*heart failure, arrhythmias or pericarditis
   
 
*grey or dark cutaneous (skin) pigmentation
 
*grey or dark cutaneous (skin) pigmentation
 
   
 
The hemocromatosis phenotype and its harmfulness varies in patients with the same disease causing mutation. Symptoms are caused by a high, toxic iron accumulation in parenchymal cells of important organs, like the heart, the liver or the endocrine glands.
 
The hemocromatosis phenotype and its harmfulness varies in patients with the same disease causing mutation. Symptoms are caused by a high, toxic iron accumulation in parenchymal cells of important organs, like the heart, the liver or the endocrine glands.
The disease is usually diagnosed in middle aged patients, because the iron accumulates over time and severe symptoms are not immidiately apparent.
+
The disease is usually diagnosed in middle aged patients, because the iron accumulates over time and severe symptoms are not immediately apparent.
 
Depending on which organs are affected most by the increased iron uptake, the symptoms range from simple biochemical abnormalities to severe diseases such as heart failure and liver cirrhosis.
 
Depending on which organs are affected most by the increased iron uptake, the symptoms range from simple biochemical abnormalities to severe diseases such as heart failure and liver cirrhosis.
   
 
The individual phenotype varies that much, because the genetic background only gives a predisposition to hemochromatosis. Human and environmental factors play an important role as well.
 
The individual phenotype varies that much, because the genetic background only gives a predisposition to hemochromatosis. Human and environmental factors play an important role as well.
In general, male indiviuals that have the genetic predisposition, have a higher probability of developing hemochromatosis, supposedly because females have an overall higher iron loss due to menstruation.
+
In general, male individuals who have the genetic predisposition, have a higher probability of developing hemochromatosis, supposedly because females have an overall higher iron loss due to menstruation.
   
 
=== Cross references ===
 
=== Cross references ===
see also the description in
+
See also the description in:
   
 
[http://en.wikipedia.org/wiki/Hereditary_haemochromatosis, Wikipedia on hemochromatosis]<br>
 
[http://en.wikipedia.org/wiki/Hereditary_haemochromatosis, Wikipedia on hemochromatosis]<br>
Line 40: Line 40:
   
 
=== The role of iron in the body ===
 
=== The role of iron in the body ===
  +
<figure id="small intestine">
  +
[[File:Small_intestine_anatomy.jpg|thumb|400px|'''Figure 2: '''Detailed illustration of the anatomy of the small intestine where iron resorption takes place. Source: http://www.edoctoronline.com/media/19/photos_88EB3125-5618-45A8-BA5D-2834A502C2E1.jpg]]
  +
</figure>
   
Iron is the 4th most common element in the world. In nature, it normally occurs in its oxidized form Fe<sup>3+</sup>, that is unsoluble in water. That is, why iron in humans mostly occurs complexed. Free, water soluble iron ions that appear in the reduced form Fe<sup>2+</sup>, are toxic because they can react with H<sub>2</sub>O<sub>2</sub> to produce highly reactive hydroxy radicals that damage membranes, proteins and nucleic acids.
+
Iron is the 4th most common element in the world. In nature, it normally occurs in its oxidized form Fe<sup>3+</sup>, which is unsoluble in water. That is, why iron in humans mostly occurs complexed. Free, water soluble iron ions that appear in the reduced form Fe<sup>2+</sup>, are toxic because they can react with H<sub>2</sub>O<sub>2</sub> to produce highly reactive hydroxy radicals that damage membranes, proteins and nucleic acids.
 
Nevertheless, iron plays a crucial role in the human body. It binds to hemoglobin as a cofactor and enables oxygen transport. The total amount of iron in the body ranges from 3000mg-5000mg, whereby around 65% are bound to hemoglobin and the rest is either bound to other proteins as cofactor or stored in cells as reservoir.
 
Nevertheless, iron plays a crucial role in the human body. It binds to hemoglobin as a cofactor and enables oxygen transport. The total amount of iron in the body ranges from 3000mg-5000mg, whereby around 65% are bound to hemoglobin and the rest is either bound to other proteins as cofactor or stored in cells as reservoir.
Iron is only removed from the body through blood loss, sweating or shedding of mucosal or skin cells. This amounts to an average of 1 mg per day for men and 1.5-2 mg per day for women. Women lose more iron, because they regularly loose blood due to menstruation. The amount of iron in a healthy human is kept constant by the regulatory mechanisms of the body. This means that only as much, as the organism looses, is taken up.
+
Iron is only removed from the body through blood loss, sweating or shedding of mucosal or skin cells. This amounts to an average loss of 1 mg per day for men and 1.5-2 mg per day for women. Women lose more iron, because they regularly loose blood due to menstruation. The amount of iron in a healthy human is kept constant by the regulatory mechanisms of the body. This means that only as much, as the organism looses, is taken up.
   
  +
Iron is only able to enter the human body in the small intestine. For an schematic representation of the small intestines see <xr id="small intestine"/>. The main part of the iron is taken up in the duodenum and the resorbtion decreases linearly towards the ileum (end of the small intestine).
[[File:Small_intestine_anatomy.jpg|frame|Detailed illustration of the anatomy of the small intestine where iron resorption takes place. Source: http://www.edoctoronline.com/media/19/photos_88EB3125-5618-45A8-BA5D-2834A502C2E1.jpg]]
 
  +
The iron in the lumen of the small intestine is transported into the enterocytes through the divalent metal transporter (DMT-1).
 
Iron is only able to enter the human body in the small intestine. The main part is taken up in the duodenum and the resorbtion decreases linearly towards the ileum(end of the small intestine).
 
The iron in the lumen of the small intestine is transported into the enterocytes through the divalent metal transporter(DMT-1).
 
 
There, the iron is either stored inside the cell in complex with the ferritin protein or it is released into the bloodstream via ferroportin(FPN-1), where it immediately forms a complex with transportin. The amount of iron that enters the bloodstream highly depends on the expression level of FPN-1. The enterocytes are regularly depleted and thus the iron that they have stored is lost.
 
There, the iron is either stored inside the cell in complex with the ferritin protein or it is released into the bloodstream via ferroportin(FPN-1), where it immediately forms a complex with transportin. The amount of iron that enters the bloodstream highly depends on the expression level of FPN-1. The enterocytes are regularly depleted and thus the iron that they have stored is lost.
   
  +
<figure id="transferrin">
The iron-transferrin complex in the blood plasma binds to the Transferrin Receptors 1 and 2(TfR) that the parenchymal cells of the liver express. These receptors start a signalling pathway involving the HFE-protein that activates the production of hepcidin. Although there are some theories about this pathway, it is not resolved yet. Hepcidin is a protein that is responsible for the downregulation of iron entry into the bloodstream, because it initiates the degradation of FPN-1. Therefore, the release of iron into the blood plasma is decreased.
 
  +
[[File:1de4 complex.png|thumb|300px|'''Figure 3: '''Structure of the HFE protein with bound beta-microglobulin (orange) in complex with the transferrin receptor (purple). The the MHC I domain is colored in green and the immunoglobulin constant domain in blue. PDB ID: 1DE4.]]
 
  +
</figure>
  +
  +
The iron-transferrin complex in the blood plasma binds to the Transferrin Receptors 1 and 2 (TfR), which are expressed by the parenchymal cells of the liver. These receptors start a signalling pathway, involving the binding of the HFE-protein to the transferrin receptors, that activates the production of hepcidin. <xr id="transferrin"/> shows an HFE protein with bound beta-microglobulin in complex with a transferrin receptor.
   
  +
Although there are some theories about this pathway, it is not resolved yet. Hepcidin is a protein that is responsible for the downregulation of iron entry into the bloodstream, because it initiates the degradation of FPN-1. Therefore, the release of iron into the blood plasma is decreased. The iron uptake and the iron regulation in the human body is summarised in <xr id="iron metabolism"/>.
   
  +
<figure id="iron metabolism">
[[File:ironMetabolism.jpg|frame|Illustration of the iron uptake into the blood and its regulation. Source: http://ars.els-cdn.com/content/image/1-s2.0-S0021997512001570-gr1.jpg]]
 
  +
[[File:ironMetabolism.jpg|thumb|400px|'''Figure 4: '''Illustration of the iron uptake into the blood and its regulation. Source: http://ars.els-cdn.com/content/image/1-s2.0-S0021997512001570-gr1.jpg]]
  +
</figure>
   
 
===Disease Mechanism===
 
===Disease Mechanism===
Line 61: Line 68:
   
 
Thus, patients do not suffer from a perturbance of the iron metabolism, which works normal, but from an increased iron uptake into the blood.
 
Thus, patients do not suffer from a perturbance of the iron metabolism, which works normal, but from an increased iron uptake into the blood.
 
   
 
== Genetics and Inheritance==
 
== Genetics and Inheritance==
   
There are several different types of hemochromatosis. Each type is connected to defects in the iron uptake regulation through hepcidin. The most common and less severe type is caused by a mutation in the HFE gene on chromosome 6. The other types are rare and based on a mutations in the TfR2 gene or, in the case of juvenile hemochromatosis, mutations in the HJV or HAMP (hepcidin) gene. Mutations in the FPN(Ferroportin) gene can also result in hemachromatosis like symptoms, but this type is often termed ferroportin disease. The mutations leads to a hepcidin resistance and thus to an iron hyperabsorbtion from the diet, although the hepcidin production is not impaired in this patients.
+
There are several different types of hemochromatosis. Each disease type is connected to defects in the iron uptake regulation through hepcidin. The most common and less severe type is caused by a point mutation in the HFE gene on chromosome 6. The other types are rare and based on a mutations in the TfR2 gene or, in the case of juvenile hemochromatosis, mutations in the HJV or HAMP (hepcidin) gene. Mutations in the FPN (Ferroportin) gene can also result in hemachromatosis like symptoms, but this type is often termed ferroportin disease. The mutations leads to a hepcidin resistance and thus to an iron hyperabsorbtion from the diet, although the hepcidin production is not impaired in this patients.
   
 
Homozygosity for one of the above mentioned mutations only results in a certain predisposition to hemochromatosis, but not all persons with this genetic background develop the disease. It depends on other factors that influence the iron metabolism, such as abusive drinking.
 
Homozygosity for one of the above mentioned mutations only results in a certain predisposition to hemochromatosis, but not all persons with this genetic background develop the disease. It depends on other factors that influence the iron metabolism, such as abusive drinking.
   
  +
<css>
  +
#dis { border-collapse:collapse }
  +
#dis td { border: black 1px solid }
  +
#dis th { border: black 1px solid }
  +
</css>
   
  +
<figtable id="forms">
{| border="1"
 
  +
{| id="dis" cellpadding=5
|+ Characterisation of the various forms of hemochromatosis
 
  +
!style="background-color:#adceff; text-align:center"| form !! style="background-color:#adceff; text-align:center"|male/female !!style="background-color:#adceff; text-align:center"| age !! style="background-color:#adceff; text-align:center"|non-/caucasian
! form !! male/female !! age !! non-/caucasian
 
 
|-
 
|-
  +
! style="background-color:#efefef; text-align:center"| HFE
! HFE
 
 
| male || 40-50 years||caucasian
 
| male || 40-50 years||caucasian
 
|-
 
|-
  +
! style="background-color:#efefef; text-align:center"|TfR2
! TfR2
 
 
| male or female|| 30-40 years||caucasian or non-caucasian
 
| male or female|| 30-40 years||caucasian or non-caucasian
 
|-
 
|-
  +
!style="background-color:#efefef; text-align:center"| HJV, HAMP
!HJV, HAMP
 
 
| male or female|| 15-20 years||caucasian or non-caucasian
 
| male or female|| 15-20 years||caucasian or non-caucasian
 
|-
 
|-
! Ferroportin disease
+
! style="background-color:#efefef; text-align:center"| Ferroportin disease
 
| male or female || 10-80 years||caucasian or non-caucasian
 
| male or female || 10-80 years||caucasian or non-caucasian
  +
|+ style="caption-side: bottom; text-align: left" |<font size=1.5>'''Table 1:''' Characterisation of the various forms of hemochromatosis.
 
|}
 
|}
  +
</figtable>
   
  +
The above described different forms of hemochromatosis are summarised in <xr id="forms"/>.
Hemochromatosis is an autosomal recessive inherited disorder with reduced penetrance in females.
 
The HFE C282Y mutation is very common with a homozygozity prevalence of 1:200 to 1:300 in white persons, this is why it is a polymorphism rather than a disease mutation. But among Asians, Hispanics or black persons, it is much less common.
 
Roughly 80% of northern European hemachromatosis patients are homozygous for HFE C282Y. A Celtic or Vikin ancester was probably the first person having the mutation. Since hemochromatisis does not affect reproduction, the mutation spread through populations. The reported allel frequency of C282Y ranges from 12.5% in Ireland to 0% in southern Europe, but the mean frequency among white individuals is 6%.
 
   
  +
Hemochromatosis is an autosomal recessive inherited disorder with reduced penetrance in females.
[[File:chr6.gif|frame|Chromosome 6, source: http://www.ornl.gov/sci/techresources/Human_Genome/posters/chromosome/hfe.shtml]]
 
  +
The HFE C282Y mutation is very common in white persons with a homozygozity prevalence of 1:200 to 1:300. This is why it is a polymorphism rather than a disease mutation. But among Asians, Hispanics or black persons, it is much less common.
  +
Roughly 80% of northern European hemochromatosis patients are homozygous for HFE C282Y. A Celtic or Viking ancester was probably the first person having the mutation. Since hemochromatosis does not affect reproduction, the mutation spread through populations. The reported allele frequency of C282Y ranges from 12.5% in Ireland to 0% in southern Europe, but the mean frequency among white individuals is 6%.
   
H63D is anothe HFE polymorphism with less geographic distribution and a higher prevalence of 14%, but it has nearly no penetrance.
+
H63D is another HFE polymorphism with less geographic distribution and a higher prevalence of 14%, but it has nearly no penetrance.
 
The S65C polymorphism is associated with high iron levels when it is inherited together with C282Y on one allele.
 
The S65C polymorphism is associated with high iron levels when it is inherited together with C282Y on one allele.
   
 
All the other non-HFE hemochromatosis types are spread throughout the world, independent of any race, but they are much rarer.
 
All the other non-HFE hemochromatosis types are spread throughout the world, independent of any race, but they are much rarer.
  +
The G320V mutation in the HJV gene has been detected in 50% of families with a case of juvenile hemochromatosis.
In 50% of families with a case of juvenile hemachromatose has the G320V mutation in the HJV gene been detected.
 
   
This wiki entry focuses on the HFE C282Y mutation, because it is the most common cause for hemachromatosis in northern Europe.
+
This wiki entry focuses on the HFE C282Y mutation, because it is the most common cause for hemochromatosis in northern Europe.
   
 
=== HFE C282Y ===
 
=== HFE C282Y ===
   
  +
<figure id="chromosome">
The HFE gene is located on chromosome 6 on the short arm (p) in region 21.3 (6p21.3) and consists of 7 exons spanning 12 kb.
 
  +
[[File:chr6.gif|thumb|150px|'''Figure 5: '''Illustration of chromosome 6 with the location of the HFE gene, source: http://www.ornl.gov/sci/techresources/Human_Genome/posters/chromosome/hfe.shtml.]]
It encodes for the HFE protein, which is a membrane protein similar to the MHC class I proteins and therefore HFE associates with beta2-microglobulin. The HFE-beta2-microglobulin complex binds to the transferrin receptor 2 (TfR2).
 
  +
</figure>
   
  +
The HFE gene is located on chromosome 6 on the short arm (p) in region 21.3 (6p21.3) and consists of 7 exons spanning 12 kb. A graphical representation of choromosme 6 and the location of the HFE gene is shown in <xr id="chromosome"/>.
A guanin to adenine transition at position 845 in the HFE gene lead to the C282Y substitiution in the protein sequence.
 
  +
This missense mutation affects a highly conserved cystein in the alpha-3 loop of the HFE protein that normally forms a disulfide bond in the unmutated protein.(see picture above) The tyrosine in the mutated protein therefore disrupts the structure and prevents the binding of HFE to beta-2-microglobulin.
 
  +
<figure id="mhc">
  +
[[File:MHC_Class_1.png|thumb|200px|'''Figure 6: '''MHC class I molecule consisting of an α1 and α2 domain (green) and an α3 domain (blue). The bound beta-microglobulin is colored in orange.[http://en.wikipedia.org/wiki/MHC_I Source]]]
  +
</figure>
  +
  +
The HFE gene codes for the HFE protein, which is a membrane protein that is similar to the major histocompatibility complex (MHC) class I molecules. MHC class I molecules are membrane proteins that consist of three domains. <xr id="mhc"/> shows a schematic representation of a MHC class I molecule. The α1 and α2 domains are colored in green and and the membrane bound α3 domain in blue. The beta-microglobulin domain (orange) is bound to ensure structural stability.
  +
  +
The HFE protein associates with a beta2-microglobulin domain as well. The HFE-beta2-microglobulin complex then is able to binds to the transferrin receptor 2 (TfR2).
  +
A guanin to adenine transition at position 845 in the HFE gene lead to the C282Y substitution in the protein sequence.
  +
This missense mutation affects a highly conserved cystein in the alpha-3 loop of the HFE protein that normally forms a disulfide bond in the unmutated protein (see <xr id="hfe"/> for a graphical visualisation of the mutation). The tyrosine in the mutated protein therefore disrupts the structure and prevents the binding of HFE to beta-2-microglobulin.
   
 
=== Cross references ===
 
=== Cross references ===
Line 117: Line 140:
   
 
== Mutations ==
 
== Mutations ==
  +
Each of the above mentioned different types of hemochromatosis is caused by a different mutation, see <xr id="causing mutations"/>.
   
  +
<figtable id="causing mutations">
Each of the above mentioned different types of hemochromatosis is caused by a different mutation.
 
  +
{| id="dis" cellpadding=5
 
  +
! style="background-color:#adceff; text-align:center"| disease type || style="background-color:#adceff; text-align:center"| mutation
HFE: C282Y, H63D<br>
 
  +
|-
TfR2: Y250X (nonsense mutation, it truncates TfR2 at amoino acid 250)<br>
 
  +
| HFE || C282Y, H63D
HJV: G320V<br>
 
  +
|-
HAMP: several, no specific<br>
 
  +
| TfR2 || Y250X (nonsense mutation, it truncates TfR2 at amoino acid 250)
FPN: C326S and C326Y<br>
 
  +
|-
  +
| HJV || G320V
  +
|-
  +
| HAMP || several, no specific
  +
|-
  +
| FPN || C326S and C326Y
  +
|-
  +
|+ style="caption-side: bottom; text-align: left" |<font size=1.5>'''Table 2:''' Different disease types and the known disease causing mutations.
  +
|}
  +
</figtable>
   
 
=== Reference sequence ===
 
=== Reference sequence ===
Line 141: Line 175:
 
== Diagnosis and Treatment ==
 
== Diagnosis and Treatment ==
   
  +
<figure id="diagnosis">
[[File:diagnosis_algorithm.png|frame|Algorithm for the diagnosis of hemochromatosis. Source: http://www.gastrojournal.org/article/S0016-5085%2810%2900872-3/fulltext]]
 
  +
[[File:diagnosis_algorithm.png|thumb|650px|'''Figure 7: '''Algorithm for the diagnosis of hemochromatosis. Source: http://www.gastrojournal.org/article/S0016-5085%2810%2900872-3/fulltext]]
  +
</figure>
   
Hemochromatosis is diagnosed in patients with an unnormal high transferrin saturation (TS) and, in later stages, increased serum ferritin levels. The transferrin saturation denotes the concentration of free iron in proportion to the concentration of transferrin in the blood serum. However, the diagnosis should always be supported by a gene test for HFE C282Y homyozygocity. Inflammation, metabolic disorders, diabetes mellitus, alcohol abuse and liver cell necrosis can also lead to an increased serum ferritin level.
+
Hemochromatosis is diagnosed in patients with an abnormal high transferrin saturation (TS) and, in later stages, increased serum ferritin levels. The transferrin saturation denotes the concentration of free iron in proportion to the concentration of transferrin in the blood serum. However, the diagnosis should always be supported by a gene test for HFE C282Y homyozygocity. Inflammation, metabolic disorders, diabetes mellitus, alcohol abuse and liver cell necrosis can also lead to an increased serum ferritin level.
 
On the other hand, a finding of normal serum ferritin level always excludes hemochromatosis.
 
On the other hand, a finding of normal serum ferritin level always excludes hemochromatosis.
  +
The above described diagnosis process is shown as a workflow in <xr id="diagnosis"/>.
   
 
Since iron can only be removed from the system by blood loss, the only possible treatment is phlebotomy (bloodletting). It is aimed to reduce the iron content in the body.
 
Since iron can only be removed from the system by blood loss, the only possible treatment is phlebotomy (bloodletting). It is aimed to reduce the iron content in the body.
The first step of the iron-depletion treatment is to induce a slightly iron-deficient state in the body. Therfore, 400-500 ml blood are removed weekly. After 1 to 2 years a serum ferritin level of 20-50 μg/l is reached.
+
The first step of the iron-depletion treatment is to induce a slightly iron-deficient state in the body. Therefore, 400-500 ml blood are removed weekly. After 1 to 2 years of bloodletting a serum ferritin level of 20-50 μg/l is reached.
 
In the long term, a maintenance therapy with two to four phlebotomies a year is then enough to keep the serum ferritin level between 50-100 μg/l. A low iron diet can also help to keep the amount of resorbed iron low.
 
In the long term, a maintenance therapy with two to four phlebotomies a year is then enough to keep the serum ferritin level between 50-100 μg/l. A low iron diet can also help to keep the amount of resorbed iron low.
   
 
The life expectancy of diagnosed and treated hemochromatosis patients without complications is comparable to that of the normal population. But early diagnosis and initation of therapy is crucial for preventing organ damage and increasing the life expectancy.
 
The life expectancy of diagnosed and treated hemochromatosis patients without complications is comparable to that of the normal population. But early diagnosis and initation of therapy is crucial for preventing organ damage and increasing the life expectancy.
   
  +
== Glossary ==
   
  +
;liver fibrosis
  +
:formation of excessive connective tissue, that deranges the architecture and function of the liver
  +
;liver cirrhosis
  +
:irreversible end state of a liver disease, that is preceded by liver fibrosis; the liver is shrunk and mostly dysfunctional
  +
  +
;cell necrosis
  +
:cell death caused by factors external to the cell
  +
  +
;arthritis
  +
:inflammation of one or more joints, that causes joint stiffness and -pain
  +
  +
;gonad
  +
:the organ that produces the gametes (sperms and egg cells)
  +
:e.g. testes and ovaries in human
  +
  +
;hypogonadism
  +
:decreased gonadal function
  +
  +
;arrhythmias
  +
:abnormal heart rythm (too fast, too slow, irregular)
  +
  +
;pericarditis
  +
:heart failure
  +
  +
;parenchym
  +
:functional cells in an organ
  +
:parenchym + connective tissue = all cells of an organ
  +
  +
;endocrine glands
  +
:the glands that secrete hormones directly into the bloodstream
  +
:e.g. pancreas, ovaries and adrenal glands
   
 
== Resources ==
 
== Resources ==
Line 162: Line 231:
 
http://en.wikipedia.org/wiki/Hereditary_haemochromatosis<br>
 
http://en.wikipedia.org/wiki/Hereditary_haemochromatosis<br>
 
http://www.genecards.org/cgi-bin/carddisp.pl?gene=HFE&search=HFE&suff=txt
 
http://www.genecards.org/cgi-bin/carddisp.pl?gene=HFE&search=HFE&suff=txt
  +
  +
  +
== Tasks ==
  +
  +
[[Task 2: Alignments]]<br>
  +
[[Hemochromatosis:_Sequence_based_predictions|Task 3:Sequence based predictions]]<br>
  +
[[Task 4: Structural Alignments]] <br>
  +
[[Task 5: Homology Modeling]] <br>
  +
[[Task 6: Protein structure prediction from evolutionary sequence variation]] <br>
  +
[[Task 7: Research SNPs]] <br>
  +
[[Task 8: Sequence-based mutation analysis]] <br>
  +
[[Task 9: Structure-based mutation analysis]] <br>
  +
[[Hemochromatosis_Normal_modes|Task 10: Normal mode analysis]] <br>

Latest revision as of 21:26, 1 September 2013

<figure id="hfe">

Figure 1: The two domains of the HFE protein, the MHC I domain (green) and the immunoglobulin constant domain (blue) are shown in complex with beta-microglobulin (orange). The cystein at position 282 is highlighted in red and its disulfide interaction partner in white. PDB ID: 1A6Z.

</figure>

Hemochromatosis is a hereditary disorder that leads to an increased intestinal iron uptake from food. The excess iron is stored in the parenchymal cells of organs and tissues and thus disrupts their normal function. There are various genotypes that can lead to hemochromatosis. The most common form of the disease is caused by a point mutation in the HFE gene. HFE stands for High FErrum.

Phenotype

Clinical symptoms include:

  • tiredness
  • joint and bone pain
  • destructive arthritis
  • liver fibrosis and cirrhosis, increased risk to develop hepatocellular carcinoma
  • glucose intolerance and insulin resistance due to damages in the pancreas (diabetes mellitus)
  • gonadal dysfunction, hypogonadism and decreased libido
  • heart failure, arrhythmias or pericarditis
  • grey or dark cutaneous (skin) pigmentation

The hemocromatosis phenotype and its harmfulness varies in patients with the same disease causing mutation. Symptoms are caused by a high, toxic iron accumulation in parenchymal cells of important organs, like the heart, the liver or the endocrine glands. The disease is usually diagnosed in middle aged patients, because the iron accumulates over time and severe symptoms are not immediately apparent. Depending on which organs are affected most by the increased iron uptake, the symptoms range from simple biochemical abnormalities to severe diseases such as heart failure and liver cirrhosis.

The individual phenotype varies that much, because the genetic background only gives a predisposition to hemochromatosis. Human and environmental factors play an important role as well. In general, male individuals who have the genetic predisposition, have a higher probability of developing hemochromatosis, supposedly because females have an overall higher iron loss due to menstruation.

Cross references

See also the description in:

Wikipedia on hemochromatosis
OMIM entry 235200
A. Pietrangelo, Hereditary Hemochromatosis: Pathogenesis, Diagnosis, and Treatment; Gastroenterology 2010


Pathophysiology

The role of iron in the body

<figure id="small intestine">

Figure 2: Detailed illustration of the anatomy of the small intestine where iron resorption takes place. Source: http://www.edoctoronline.com/media/19/photos_88EB3125-5618-45A8-BA5D-2834A502C2E1.jpg

</figure>

Iron is the 4th most common element in the world. In nature, it normally occurs in its oxidized form Fe3+, which is unsoluble in water. That is, why iron in humans mostly occurs complexed. Free, water soluble iron ions that appear in the reduced form Fe2+, are toxic because they can react with H2O2 to produce highly reactive hydroxy radicals that damage membranes, proteins and nucleic acids. Nevertheless, iron plays a crucial role in the human body. It binds to hemoglobin as a cofactor and enables oxygen transport. The total amount of iron in the body ranges from 3000mg-5000mg, whereby around 65% are bound to hemoglobin and the rest is either bound to other proteins as cofactor or stored in cells as reservoir. Iron is only removed from the body through blood loss, sweating or shedding of mucosal or skin cells. This amounts to an average loss of 1 mg per day for men and 1.5-2 mg per day for women. Women lose more iron, because they regularly loose blood due to menstruation. The amount of iron in a healthy human is kept constant by the regulatory mechanisms of the body. This means that only as much, as the organism looses, is taken up.

Iron is only able to enter the human body in the small intestine. For an schematic representation of the small intestines see <xr id="small intestine"/>. The main part of the iron is taken up in the duodenum and the resorbtion decreases linearly towards the ileum (end of the small intestine). The iron in the lumen of the small intestine is transported into the enterocytes through the divalent metal transporter (DMT-1). There, the iron is either stored inside the cell in complex with the ferritin protein or it is released into the bloodstream via ferroportin(FPN-1), where it immediately forms a complex with transportin. The amount of iron that enters the bloodstream highly depends on the expression level of FPN-1. The enterocytes are regularly depleted and thus the iron that they have stored is lost.

<figure id="transferrin">

Figure 3: Structure of the HFE protein with bound beta-microglobulin (orange) in complex with the transferrin receptor (purple). The the MHC I domain is colored in green and the immunoglobulin constant domain in blue. PDB ID: 1DE4.

</figure>

The iron-transferrin complex in the blood plasma binds to the Transferrin Receptors 1 and 2 (TfR), which are expressed by the parenchymal cells of the liver. These receptors start a signalling pathway, involving the binding of the HFE-protein to the transferrin receptors, that activates the production of hepcidin. <xr id="transferrin"/> shows an HFE protein with bound beta-microglobulin in complex with a transferrin receptor.

Although there are some theories about this pathway, it is not resolved yet. Hepcidin is a protein that is responsible for the downregulation of iron entry into the bloodstream, because it initiates the degradation of FPN-1. Therefore, the release of iron into the blood plasma is decreased. The iron uptake and the iron regulation in the human body is summarised in <xr id="iron metabolism"/>.

<figure id="iron metabolism">

Figure 4: Illustration of the iron uptake into the blood and its regulation. Source: http://ars.els-cdn.com/content/image/1-s2.0-S0021997512001570-gr1.jpg

</figure>

Disease Mechanism

In the most common variant of hemochromatosis, a point mutation in the HFE gene disrupts the hepcidin production pathway. The iron resorption is increased and it accumulates in the body. At some point the body cannot store more iron in the cells and Fe2+ occurs unbound in the bloodstream which damages the body.

Thus, patients do not suffer from a perturbance of the iron metabolism, which works normal, but from an increased iron uptake into the blood.

Genetics and Inheritance

There are several different types of hemochromatosis. Each disease type is connected to defects in the iron uptake regulation through hepcidin. The most common and less severe type is caused by a point mutation in the HFE gene on chromosome 6. The other types are rare and based on a mutations in the TfR2 gene or, in the case of juvenile hemochromatosis, mutations in the HJV or HAMP (hepcidin) gene. Mutations in the FPN (Ferroportin) gene can also result in hemachromatosis like symptoms, but this type is often termed ferroportin disease. The mutations leads to a hepcidin resistance and thus to an iron hyperabsorbtion from the diet, although the hepcidin production is not impaired in this patients.

Homozygosity for one of the above mentioned mutations only results in a certain predisposition to hemochromatosis, but not all persons with this genetic background develop the disease. It depends on other factors that influence the iron metabolism, such as abusive drinking.

<css>

  1. dis { border-collapse:collapse }
  2. dis td { border: black 1px solid }
  3. dis th { border: black 1px solid }

</css>

<figtable id="forms">

form male/female age non-/caucasian
HFE male 40-50 years caucasian
TfR2 male or female 30-40 years caucasian or non-caucasian
HJV, HAMP male or female 15-20 years caucasian or non-caucasian
Ferroportin disease male or female 10-80 years caucasian or non-caucasian
Table 1: Characterisation of the various forms of hemochromatosis.

</figtable>

The above described different forms of hemochromatosis are summarised in <xr id="forms"/>.

Hemochromatosis is an autosomal recessive inherited disorder with reduced penetrance in females. The HFE C282Y mutation is very common in white persons with a homozygozity prevalence of 1:200 to 1:300. This is why it is a polymorphism rather than a disease mutation. But among Asians, Hispanics or black persons, it is much less common. Roughly 80% of northern European hemochromatosis patients are homozygous for HFE C282Y. A Celtic or Viking ancester was probably the first person having the mutation. Since hemochromatosis does not affect reproduction, the mutation spread through populations. The reported allele frequency of C282Y ranges from 12.5% in Ireland to 0% in southern Europe, but the mean frequency among white individuals is 6%.

H63D is another HFE polymorphism with less geographic distribution and a higher prevalence of 14%, but it has nearly no penetrance. The S65C polymorphism is associated with high iron levels when it is inherited together with C282Y on one allele.

All the other non-HFE hemochromatosis types are spread throughout the world, independent of any race, but they are much rarer. The G320V mutation in the HJV gene has been detected in 50% of families with a case of juvenile hemochromatosis.

This wiki entry focuses on the HFE C282Y mutation, because it is the most common cause for hemochromatosis in northern Europe.

HFE C282Y

<figure id="chromosome">

Figure 5: Illustration of chromosome 6 with the location of the HFE gene, source: http://www.ornl.gov/sci/techresources/Human_Genome/posters/chromosome/hfe.shtml.

</figure>

The HFE gene is located on chromosome 6 on the short arm (p) in region 21.3 (6p21.3) and consists of 7 exons spanning 12 kb. A graphical representation of choromosme 6 and the location of the HFE gene is shown in <xr id="chromosome"/>.

<figure id="mhc">

Figure 6: MHC class I molecule consisting of an α1 and α2 domain (green) and an α3 domain (blue). The bound beta-microglobulin is colored in orange.Source

</figure>

The HFE gene codes for the HFE protein, which is a membrane protein that is similar to the major histocompatibility complex (MHC) class I molecules. MHC class I molecules are membrane proteins that consist of three domains. <xr id="mhc"/> shows a schematic representation of a MHC class I molecule. The α1 and α2 domains are colored in green and and the membrane bound α3 domain in blue. The beta-microglobulin domain (orange) is bound to ensure structural stability.

The HFE protein associates with a beta2-microglobulin domain as well. The HFE-beta2-microglobulin complex then is able to binds to the transferrin receptor 2 (TfR2). A guanin to adenine transition at position 845 in the HFE gene lead to the C282Y substitution in the protein sequence. This missense mutation affects a highly conserved cystein in the alpha-3 loop of the HFE protein that normally forms a disulfide bond in the unmutated protein (see <xr id="hfe"/> for a graphical visualisation of the mutation). The tyrosine in the mutated protein therefore disrupts the structure and prevents the binding of HFE to beta-2-microglobulin.

Cross references

see also the description in

OMIM entry 613609
OMIM entry 235200
Gene cards

Mutations

Each of the above mentioned different types of hemochromatosis is caused by a different mutation, see <xr id="causing mutations"/>.

<figtable id="causing mutations">

disease type mutation
HFE C282Y, H63D
TfR2 Y250X (nonsense mutation, it truncates TfR2 at amoino acid 250)
HJV G320V
HAMP several, no specific
FPN C326S and C326Y
Table 2: Different disease types and the known disease causing mutations.

</figtable>

Reference sequence

Protein sequence:

>gi|1890180|emb|CAB07442.1| HFE [Homo sapiens]
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEP
RTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGY
DGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLV
KVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRY
TCQVEHPGLDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE

Source: NCBI id 1890180


Diagnosis and Treatment

<figure id="diagnosis">

Figure 7: Algorithm for the diagnosis of hemochromatosis. Source: http://www.gastrojournal.org/article/S0016-5085%2810%2900872-3/fulltext

</figure>

Hemochromatosis is diagnosed in patients with an abnormal high transferrin saturation (TS) and, in later stages, increased serum ferritin levels. The transferrin saturation denotes the concentration of free iron in proportion to the concentration of transferrin in the blood serum. However, the diagnosis should always be supported by a gene test for HFE C282Y homyozygocity. Inflammation, metabolic disorders, diabetes mellitus, alcohol abuse and liver cell necrosis can also lead to an increased serum ferritin level. On the other hand, a finding of normal serum ferritin level always excludes hemochromatosis. The above described diagnosis process is shown as a workflow in <xr id="diagnosis"/>.

Since iron can only be removed from the system by blood loss, the only possible treatment is phlebotomy (bloodletting). It is aimed to reduce the iron content in the body. The first step of the iron-depletion treatment is to induce a slightly iron-deficient state in the body. Therefore, 400-500 ml blood are removed weekly. After 1 to 2 years of bloodletting a serum ferritin level of 20-50 μg/l is reached. In the long term, a maintenance therapy with two to four phlebotomies a year is then enough to keep the serum ferritin level between 50-100 μg/l. A low iron diet can also help to keep the amount of resorbed iron low.

The life expectancy of diagnosed and treated hemochromatosis patients without complications is comparable to that of the normal population. But early diagnosis and initation of therapy is crucial for preventing organ damage and increasing the life expectancy.

Glossary

liver fibrosis
formation of excessive connective tissue, that deranges the architecture and function of the liver
liver cirrhosis
irreversible end state of a liver disease, that is preceded by liver fibrosis; the liver is shrunk and mostly dysfunctional
cell necrosis
cell death caused by factors external to the cell
arthritis
inflammation of one or more joints, that causes joint stiffness and -pain
gonad
the organ that produces the gametes (sperms and egg cells)
e.g. testes and ovaries in human
hypogonadism
decreased gonadal function
arrhythmias
abnormal heart rythm (too fast, too slow, irregular)
pericarditis
heart failure
parenchym
functional cells in an organ
parenchym + connective tissue = all cells of an organ
endocrine glands
the glands that secrete hormones directly into the bloodstream
e.g. pancreas, ovaries and adrenal glands

Resources

The entry is based on several resources:

A. Pietrangelo, Hereditary Hemochromatosis: Pathogenesis, Diagnosis, and Treatment; Gastroenterology 2010
http://omim.org/entry/613609
http://omim.org/entry/235200
http://en.wikipedia.org/wiki/Hereditary_haemochromatosis
http://www.genecards.org/cgi-bin/carddisp.pl?gene=HFE&search=HFE&suff=txt


Tasks

Task 2: Alignments
Task 3:Sequence based predictions
Task 4: Structural Alignments
Task 5: Homology Modeling
Task 6: Protein structure prediction from evolutionary sequence variation
Task 7: Research SNPs
Task 8: Sequence-based mutation analysis
Task 9: Structure-based mutation analysis
Task 10: Normal mode analysis