Sequence-based predictions (PKU)

From Bioinformatikpedia
Revision as of 16:10, 15 May 2012 by Boidolj (talk | contribs) (results)

In this task we will find out, how much information one can get from the plain sequence of our disease. We try to pretend we know nothing but the freshly sequenced primary-structure. We will perform predictions which are available as a web service as well as local programs to determine the functions and structure of out disease. Afterwards we will analyse the results with our prior knowledge about Phenylketonuria. In this manner we hope to get an idea how reliable the information derived from such tools is.

Short Task Description

Our task is to use the primary sequence of our protein (and some other example proteins) to predict comparatively simple features like secondary structure, signal peptides and transmembrane regions and more advanced like GO terms and similar functional annotations with different tools. The used commands and programms are listed at the appropriate places (if short and interesting enough) or linked at their own site. For more detailed instructions please read..

Secondary Structure Prediction

In this section we show a comparison of several secondary-structure-prediction-tools. In order to have the gold standard we will analyse the results with the information from DSSP.<ref name=DSSP> Kabsch W, Sander C (1983) Biopolymers. Dictionary of protein secondary structure: pattern recognition of hydrogen-bonded and geometrical features, 22, 2577-2637.</ref><ref name=DSSPDB> Joosten RP, Te Beek TAH, Krieger E, Hekkelman ML, Hooft RWW, Schneider R, Sander C, Vriend G (2010) NAR. A series of PDB related databases for everyday needs.</ref>

ReProfSeq

reprof -i <uniprotID>.fasta
egrep -v "^#|^No" <uniprotID>.reprof |awk '{print $3}'|tr -d '\n' > <uniprotID>_reprof.secstruc

PsiPred

Webserver here

grep Pred: <uniprotID>.psipred_out |cut -d " " -f2|tr -d '\n' > <uniprotID>_psipred.secstruc
Visual output of PsiPred for PheOH, including confidence for all positions (part 1)
Visual output of PsiPred for PheOH, including confidence for all positions (part 2)

DSSP

Download dssp here and get PDB files matching the Uniprot entries

dssp -i <PDBID>.pdb > <PDBID>.dssp
tail -n+29 <PDBID>.dssp |cut -c17|tr ' ' '-'|tr -d '\n' > <PDBID>_dssp.secstruc

PDB-Files contains only part of the structure or more than 1 chain! e.g. 117aa-424aa for PAH.

Aligned structure to sequence manually..

Script to calculate Q3 and SOV: ss_score.py

Results

The following tables show Q (percentage of true positives) and SOV (segment overlap) scores for the predictions of PsiPred and ReProfSeq compared to the structure given by dssp. The output has been mapped to a simple three state model of E,H and L since dssp uses a more complex eight state model. It seems clear, that PsiPred outperforms ReProfSeq in all categories, especially the Q_E of ReProfSeq is very low (in this very small dataset). To confirm that this is not an error in the calculation, we compared the structure predictions manually and ReProfSeq indeed misses many sheet structures, predicts helices as sheets and vice versa so there is not even a partial success to declare. PsiPred performs well in all types of structure but the worst results are also in the prediction of sheets. It is interesting that the protein with the best Q_E for PsiPred is the one with the worst Q_E for ReProfSeq and the protein with the best Q_3 for ReProfSeq is the one with the (very closely) second to worst Q_E for PsiPred.
PsiPred also provides a confidence for its predictions as shown in figures ?? and ??.

Mapping between the different models:

E = E (dssp), E (reprof), E (psipred)
H = HGI (dssp), H (reprof), H (psipred)
L = BSTL (dssp), L (reprof), C (psipred)
Protein ReprofSeq
UniprotID Q_E Q_H Q_L Q_3 SOV_E SOV_H SOV_L SOV
P00439 45.5 75.7 74.8 71.2 47.5 86.7 71.8 76.4
P10775 23.1 71.9 62.0 61.8 21.9 87.2 66.9 70.6
Q9X0E6 26.8 91.9 39.1 53.5 36.1 91.1 41.0 57.6
Q08209 69.1 34.0 73.1 57.9 62.4 45.6 76.7 63.0
Protein PsiPred
UniprotID Q_E Q_H Q_L Q_3 SOV_E SOV_H SOV_L SOV
P00439 57.6 85.1 89.0 83.8 57.6 88.5 54.4 71.1
P10775 92.3 90.3 94.7 92.5 92.7 95.5 95.7 95.2
Q9X0E6 75.6 86.5 78.3 80.2 93.44 100.0 94.5 96.1
Q08209 58.2 77.3 90.7 81.0 64.1 85.8 64.8 72.5

Different predictions and reference from Uniprot for the structure of PheOH:

  UniProt: ------------------------------------------------------------
     DSSP: ------------------------------------------------------------
  PSIPRED: CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEECCCCHHHHHHHHHHHHCCC
REPROFSEQ: LLLEEEELLLLLLEELLLLLLLHHHHLLLLLLLEEEEEELHHHHHHHHHHHHHHHLLLLL
       AA: MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDV
                   10        20        30        40        50        60

  UniProt: ------------------------------------------------------------
     DSSP: --------------------------------------------------------LLLL
  PSIPRED: CCCEEECCCCCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCC
REPROFSEQ: LEEEEELLLLLLLLLHHHHHLLLLLLLLHHHHHHHHHHHHHLLLLHHHHLLLLLLLLLLL
       AA: NLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPW
                   70        80        90       100       110       120

  UniProt: ----HHHHHHHHH------HHH----TTTT-HHHHHHHHHHHHHHHH-------------
     DSSP: LLSBGGGGGGGGGGSBSSLGGGSTTSTTTTLHHHHHHHHHHHHHHHTLLTTSLLLLLLLL
  PSIPRED: CCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCC
REPROFSEQ: LLHHHHHHHHHHHHHHHLLLLLLLLLLLLLLHHHHHHHHHHHHHHHHHLLLLLLLLEEEL
       AA: FPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYM
                  130       140       150       160       170       180

  UniProt: HHHHHHHHHHHHHHH--HHHH--HHHHHHHHHHHHHH---------HHHHHHHHHHHH--
     DSSP: HHHHHHHHHHHHHHHHHHHHHBLHHHHHHHHHHHHHHLLBTTBLLLHHHHHHHHHHHHSL
  PSIPRED: HHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHCCC
REPROFSEQ: LHLHLLHHHHHHHHHHHHHLLLLHHHHHHHHHHHHHLLLLLLLLLLHHHHHHHHHHLLLL
       AA: EEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGF
                  190       200       210       220       230       240

  UniProt: EEEE------HHHHHHHHTTTEEEE-----------------HHHHHHH-HHHH--HHHH
     DSSP: EEEELLSBLLHHHHHHHHTTTEEEELLLLLLTTSTTLLSSLLHHHHHHHTHHHHTSHHHH
  PSIPRED: EEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCHHHH
REPROFSEQ: LLLLLLLLLLLLLHHLLHHHEEEEEEEEELLLLLLLLLLLHHHHHHHHLLLLLLLLLLHH
       AA: RLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFA
                  250       260       270       280       290       300

  UniProt: HHHHHHHHHH----HHHHHHHHHHHHHTTTT-EEEE--EEEE--HHHH--HHHHHHH-HH
     DSSP: HHHHHHHHHHTTLLHHHHHHHHHHHHHTTTTLEEEETTEEEELLHHHHTLHHHHHHTTSS
  PSIPRED: HHHHHHHHHHCCCCHHHHHHHHHHHHEEEEEEEEECCCCEEEECCCCCCCCCCCCCCCCC
REPROFSEQ: HHHHHLLLLLLLLLHHHHHHHHHHEEEEEEELELLLLLLHHHHHHHHHLHHHHHHHHHLL
       AA: QFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSE
                  310       320       330       340       350       360

  UniProt: HHHHHH--HHHH------EEE--EEEEEEE-HHHHHHHHHHHHH----EEEEEEETTTTE
     DSSP: SSEEEELLHHHHTTLLLLSSSLLSEEEEESLHHHHHHHHHHHHHTSLLSSLEEEETTTTE
  PSIPRED: CCCCCCCCHHHHHCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHCCCCCCCCCCCCCCCE
REPROFSEQ: LLLLLLLLLLLELLLLLLELLLLLEEEHHHLHHHHHHHHHHHHHLLLLLLEEEELLLLEE
       AA: KPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQR
                  370       380       390       400       410       420

  UniProt: EEEEHHHHHHHHHHHHHHHHHHHHHHHHH---
     DSSP: EEEL----------------------------
  PSIPRED: EEECCCHHHHHHHHHHHHHHHHHHHHHHHHHC
REPROFSEQ: EEELLLLHHHHHHHHHLHHHHHHHHHHHHHLL
       AA: IEVLDNTQQLKILADSINSEIGILCSALQKIK
                  430       440       450       460

Note that there are even some minor differences between the Uniprot and the dssp prediction. Most can be explained by the usage of different terms or different definitions for terms like "Turn", "Bend" or "Sheet", but e.g. from position 181- 202 dssp calculates a continuous helix while Uniprot shows a break at 195-196. We tried, but could not identify the source of the Uniprot structure. <br\>Helical regions agree often very well in all the given models and predictions, but prediction of sheets poses a more difficult problem. The alignment above suggests that a reason might be that the sheets are shorter on average than the helix motives.

Disorderd Regions

This section emphasises the parts of the structure, which have no structure. What seems fairly easy to do, because its a byproduct of predicting the ordered parts, is a quite unmanageable topic. The tools provided to predict such regions are as many as those for any other structure prediction. <ref name=disorderpred> Monastyrskyy, B., Fidelis, K., Moult, J., Tramontano, A. and Kryshtafovych, A. (2011), Evaluation of disorder predictions in CASP9. Proteins, 79: 107–118. doi: 10.1002/prot.23161</ref>
In order to have a closer look into the topic we decided to not only use iupred like it was specified in the task, but also find other webserver which provide a similar possibilities. A nice summary of the paper cited above can be found here, without the performance analysis from the paper. But since we want to this by ourselves it is quite sufficient.

iupred

Spine-D

Spine-DM

Transmembreane Helices

Signalpeptides

P47863 from rat, rest human => type eukaryotes; command:

signalp -trunc 70 -t euk <ID>.fasta > <ID>.sigP_out
SignalP v3 SignalP v4 Signal Peptide Database
UniprotID SignalP-HMM SignalP_NN summary prediction summary prediction experimental
P00439 0% signal peptide or anchor 5 times No no signal peptide or anchor no signal peptide or anchor no evidence for peptide or anchor
P02768 100% signal peptide, 0% signal anchor 5 times Yes signal peptide signal peptide confirmed signal peptide
P11279 100% signal peptide, 0% signal anchor 5 times Yes signal peptide signal peptide confirmed signal peptide
P47863 52.6% signal peptide, 45.7 signal anchor 4 No, 1 Yes signal peptide no signal peptide or anchor no evidence for peptide or anchor

P47863 reaches a high maximal signal peptide score (S-score) in signalP-NN and probabilities above the cut-off in signalP-HMM in version 3. In version 4 (webserver) neither variant predicts a signal peptide for this protein and the probabilities/scores are well below the cut-off values. P47863 is a multipass membrane protein and signalPv3 most likely predicted a possible cleavage site for the N-terminal membrane region, classifying it wrongly as signal sequence.

Functional Annotations

We used the webserver version of GOPET provided here to predict GO annotations and the websever version of ProtFun provided here to predict cellular role, enzyme class and functional GO categories for PheOH. ProtFun incorporates other tools to predict signal peptides, cleavage site, glycosylation, phosphorylation and transmembrane segments to achieve its main predictions and gives a summary output of the subtools. Some of these other tools we already used and discussed above, the others are discussed in this section.

GOPet

For this task, we increased the maximum number of reported annotations to 50 and left the other settings on the default values. This includes a confidence threshold for predictions set to 60%. As can be seen in table ??, 11 annotations with a confidence of at least 71% were reported. The top three results are fairly general annotations and correctly reported with high confidence.
The next three results, phenylalanine 4-monooxygenase activity , tryptophan 5-monooxygenase activity and tyrosine 3-monooxygenase activity are quite similar and only the first is correct but has, of this three results, also the highest confidence. If we interpret this as "It's most likely that the protein has phenylalanine 4-monooxygenase activity, but could also have tryptophan 5- and tyrosine 3-monooxygenase activity" this statement appears quite accurate.
The results 7 to 10 concern ion binding and here the more general terms metal- and iron-binding are predicted correctly and with higher confidence than the other more specific ones. In other words, GOPET correctly predicted that PheOH binds an iron ion, but failed to predict the correct oxidation number. The last prediction, amino acid binding, is again correct but quite unspecific.
In conclusion, GOPET gives more general annotations with high accuracy and confidence, but fails to distinguish between very similar terms. Yet none of the reported terms are grossly misleading and if this were a truly unknown protein, the predictions would show clearly in the direction of the proteins true function.

GOPET predictions
GO ID Aspect Confidence GO Term True/False
GO:0003824 F 94% catalytic activity true
GO:0016491 F 88% oxidoreductase activity true
GO:0004497 F 87% monooxygenase activity true
GO:0004505 F 84% phenylalanine 4-monooxygenase activity true
GO:0004510 F 80% tryptophan 5-monooxygenase activity false
GO:0004511 F 79% tyrosine 3-monooxygenase activity false
GO:0046872 F 78% metal ion binding true
GO:0005506 F 78% iron ion binding true
GO:0008199 F 72% ferric iron binding false
GO:0008198 F 72% ferrous iron binding false
GO:0016597 F 71% amino acid binding true

GOPET only returns functional GO terms

ProtFun

ProtFun correctly reports, that PheOH is involved in the biosynthesis of amino acids. This is also (correctly) the only functional category with signifikant odds. ProtFun also correctly reports that PheOH is an enzyme, but fails to deduce the correct class. PheOH is an oxidoreductase with the EC number 1.14.16.1. The correct class has only the fourth highest odds of six possible classes.
In general, ProtFun refrains from marking GO categories if the score with the highest information content has odds lower than 1, as is the case here. Indeed none of the categories fit PheOH.

# Functional category                  Prob     Odds
 Amino_acid_biosynthesis           => 0.210    9.530
 Biosynthesis_of_cofactors            0.229    3.180
 Cell_envelope                        0.034    0.563
 Cellular_processes                   0.063    0.867
 Central_intermediary_metabolism      0.061    0.970
 Energy_metabolism                    0.343    3.815
 Fatty_acid_metabolism                0.025    1.889
 Purines_and_pyrimidines              0.392    1.615
 Regulatory_functions                 0.020    0.125
 Replication_and_transcription        0.118    0.438
 Translation                          0.204    4.630
 Transport_and_binding                0.024    0.060

# Enzyme/nonenzyme                     Prob     Odds
 Enzyme                            => 0.724    2.527
 Nonenzyme                            0.276    0.387

# Enzyme class                         Prob     Odds
 Oxidoreductase (EC 1.-.-.-)          0.154    0.738
 Transferase    (EC 2.-.-.-)          0.271    0.785
 Hydrolase      (EC 3.-.-.-)          0.083    0.261
 Lyase          (EC 4.-.-.-)          0.047    1.002
 Isomerase      (EC 5.-.-.-)       => 0.100    3.138
 Ligase         (EC 6.-.-.-)          0.019    0.370

# Gene Ontology category               Prob     Odds
 Signal_transducer                    0.075    0.350
 Receptor                             0.003    0.016
 Hormone                              0.001    0.206
 Structural_protein                   0.005    0.166
 Transporter                          0.025    0.229
 Ion_channel                          0.010    0.168
 Voltage-gated_ion_channel            0.005    0.232
 Cation_channel                       0.010    0.215
 Transcription                        0.043    0.334
 Transcription_regulation             0.032    0.255
 Stress_response                      0.010    0.118
 Immune_response                      0.012    0.140
 Growth_factor                        0.006    0.407
 Metal_ion_transport                  0.009    0.020

Additional Predictions of ProtFun are shown below. Of the posttranslational modifications se we could verify only one phosphorylation site at S16, that is thought to play a role in activity regulation. Three other phosphorylation sites reported at Phosphosite are not predicted. We could not find any positive information about glycosylation which seems to agree mostly with the predictions. PheOH contains no propeptide cleavage site as it is the mature protein and as discussed above contains no target or signal peptide and no TM helices.

Feature 	Output summary
   SignalP 3.0   No signal peptide cleavage site predicted 
   ProP 1.0      1 propeptide cleavage site predicted at position:   74 
   TargetP 1.1   No high confidence targeting predition 
   NetPhos 2.0   22 putative phosphorylation sites at positions 16 23 40 70 110 196 250 303 339 391 411 22 105 189 278 418 24 77 198 268 277 317
   NetOGlyc 3.1  No O-glycosylated sites predicted
   NetNGlyc 1.0  2 putative N-glycosylated sites at positions 61 376
   TMHMM 2.0     No TM helices predicted

Since ProtFun relies on these additional predictions to deduce functional annotations, but uses them as input in a multilayered neuronal network, it is hard to assess the importance of the individual results, especially if there is no confidence attached to them. Most of the predictions appear to be correct, but in the case of PheOH there is not much to predict. Accordingly, the main results of ProtFun exclude categories. The two most important results, PheOH might be an isomerase involved in amino acid biosynthesis, are only partially correct and somewhat misleading because a better result, oxidoreductase activity, is excluded.

References

<references/>