Metachromatic leukodystrophy reference aminoacids

Sequence

>sp|P15289|ARSA_HUMAN Arylsulfatase A OS=Homo sapiens GN=ARSA PE=1 SV=3
MGAPRSLLLALAAGLAVARPPNIVLIFADDLGYGDLGCYGHPSSTTPNLDQLAAGGLRFT
DFYVPVSLCTPSRAALLTGRLPVRMGMYPGVLVPSSRGGLPLEEVTVAEVLAARGYLTGM
AGKWHLGVGPEGAFLPPHQGFHRFLGIPYSHDQGPCQNLTCFPPATPCDGGCDQGLVPIP
LLANLSVEAQPPWLPGLEARYMAFAHDLMADAQRQDRPFFLYYASHHTHYPQFSGQSFAE
RSGRGPFGDSLMELDAAVGTLMTAIGDLGLLEETLVIFTADNGPETMRMSRGGCSGLLRC
GKGTTYEGGVREPALAFWPGHIAPGVTHELASSLDLLPTLAALAGAPLPNVTLDGFDLSP
LLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFTQGSAHSDTTADPACHASSSL
TAHEPPLLYDLSKDPGENYNLLGGVAGATPEVLQALKQLQLLKAQLDAAVTFGPSQVARG
EDPALQICCHPGCTPRPACCHCPDPHA

Source

• Uniprot

Database Searches

FASTA, BLAST and PSI-BLAST were run against the non-redundant database (NR). HHsearch was run through the web interface<ref>http://toolkit.lmb.uni-muenchen.de/hhpred</ref> aigainst the PDB and Interpro database. The following parameter settings were used:

• BLAST: blastall -p blastp -i refSeq.fasta -d /data/blast/nr/nr > blastp with refSeq.fasta being the file containing the reference sequence and blastp the * PSI-BLAST: blastpgp -i refSeq.fasta -d /data/blast/nr/nr -e"e-value" -j "#iterations" > psiblast_"e-value"_"#iterations"
  
• PSI-BLAST was run with the following parameter settings:
  • e-value cutoff 0.005, 3 iterations (Psi-blast1)
  • e-value cutoff 0.005, 5 iterations (Psi-blast2)
  • e-value cutoff 10E-6, 3 iterations (Psi-blast3)
  • e-value cutoff 10E-6, 5 iterations (Psi-blast4)
• HHsearch: We used the online version of hhPred <ref>http://toolkit.lmb.uni-muenchen.de/hhpred</ref> with default parameters. One search was performed against PDB and one against Interpro.

Alignment results

We wrote a perl script to parse the output files of the individual programs and extracted identifier, alignment score and the percentage of identical residues within the alignment.

Mapping of identifier

The non-redundant database contains entries from various databases, including RefSeq, PDB, PIR, PRF, GenBank and Swiss-Prot. In order to compare results of NR database searches with the results of the HHpred searches, a mapping of the IDs is necessary. Furthermore, the entries in HSSP - which is used later to benchmark the alignment results - contains only references to the UniProtKB accession number (ACCNUM). To overcome this problem we downloaded a mapping table between the IDs from <ref>http://pir.georgetown.edu/pirwww/search/idmapping.shtml</ref>. This table was used - together with some short perl scripts - to map IDs between the databases and compare the results.

Summary of database searches

In this section, we give a short summary description of the search results of the individual programs and the compare them to each other.

Comparison of the methods

• FASTA yielded with 4733 alignments the highest number of hits.
• BLAST produced 252 alignments.
• PSI-BLAST
  • Using an E-value cutoff of 0.005, PSI-BLAST produced 756 alignments for 3 iterations and 1257 for 5 iterations.
  • Using an E-value cutoff of 10E-6, PSI-BLAST produced 756 alignments for 3 iterations and 1257 for 5 iterations.
• HHsearch produced 33 alignments for the search against PDB and 74 alignments for search against Interpro.

FASTA shows the highest number of alignments, probably due to the fact, that no e-value cutoff was chosen. Contrary, hhsearch has very few alignments. This could be ascribed to the fact, that completely different databases were used for the alignments and Interpro and pdb just did not have as much homolguous sequences as the nr database. This is also supported by the benchmark with HSSP (see next section). Aother interesting fact is that the results of PSI-BLAST depended for our parameter setting only on the number of iterations. Ragarding the results for the number of iterations, both e-value cutoffs yielded - except of some single exceptions the same aligned target sequences from the database - the same hits.

Overlap between methods

The number of shared target sequences between two methods is shown in the upper panel (self overlaps not shown). The lower panel depicts how many percent of the aligned target sequences of a given method (x-axis) are shared with the other methods.

The results of the four different PSI-BLAST runs show the highest overlap. The additional iterations find more related sequences and yield a higher number of alignments. Interestingly, almost all BLAST hits overlap with the PSI-BLAST and FASTA results. The overlaps of the searches, show that the number of hits highly depend on the database. hhpred1 does not have a good overlap with any of the other methods, but hhpred2 shares a significant part of its results with PSI-BLAST.

Scores and identity of aligned residues

In general, the identity of aligned residues is very low, i.e. only very few highly similar hits are detected by the methods. These high scoring matches mainly represent homologs of Arylsulfatase A. This can be seen in the table of sequences which were chosen for the multiple sequence alignment. The majority of hits from an identity range of 99-90% and 89-60% are annotated as Arylsulfatases or Arylsulfatase A. Lowering the identity cutoff yields an increasing number of Sulfatases, which might be more distantly related to our query sequence.
The alignment scores show a very similar distribution. Lowest scores are produced by FASTA, which reflects the low sensitivity of the method for the detection of true homologs. A lot of these matches might be classified as false positive, i.e. they are not evolutionary related to the query sequence. The BLAST scores are a bit elevated compared to FASTA. The highest scores are derived from the PSI-BLAST searches and an increase can be seen when the number of iterations is raised.

The density of alignment scores and percentage of identical residues within the alignments are plotted

HSSP

Method	Recall (GI)	Recall (pdb)	Precision (GI)
FASTA	0.92	0.67	0.23
BLAST	0.11	0.42	0.54
Psi-blast1	0.21	0.42	0.65
Psi-blast2	0.23	0.5	0.62
Psi-blast3	0.21	0.42	0.65
Psi-blast4	0.23	0.5	0.62
hhpred (pdb)	0.01	1	0.11
hhpred (interpro)	0.01	0.92	0.12

Multiple Alignments

For building the multiple Alignments the following sequences were chosen:

SeqIdentifier	Seq Identity	source	Protein function
99-90% Sequence Identity
gi109094666	96.6%	Macaca mulatta	Arylsulfatase A isoform 2
gi281339526	90.8%	Ailuropoda melanoleuca	unknown
gi47522624	91.5%	Sus scrofa	Arylsulfatase A
gi149759319	89.7%	Equus caballus	Arylsulfatase A
gi301763795	90.8%	Ailuropoda melanoleuca	Arylsulfatase A
89-60% Sequence Identity
115497982	87.3%	Bos taurus	Arylsulfatase A precursor
gi118081865	63.4%	Gallus gallus	Arylsulfatase A
gi126339031	74.3%	Monodelphis domestica	Arylsulfatase A
gi114326188	88.4%	Canis lupus familiaris	Arylsulfatase A
gi164519052	85.6%	Rattus norvegicus	Arylsulfatase A
59-40% Sequence Identity
gi223936859	43.9%	Bacterium Ellin514	Sulfatase
1P49	39.0%	Homo Sapiens	Steryl-Sulfatase
gi120537984	56.0%	Xenopus laevis	unknown
gi301625378	55.5%	Xenopus (Silurana) tropicalis	Arylsulfatase A
gi86142609	40.0%	Leeuwenhoekiella blandensis MED217	Arylsulfatase A
39-20% Sequence Identity
1FSU	28.0%	Homo Sapiens	N-Acetylgalactosamine-4-Sulfatase
2VQR	20.0%	Rhizobium leguminosarum	Sulfatase
3ED4	32.0%	Escherichia coli	Arylsulfatase
gi113971721	29.0%	Shewanella sp. MR-4	Sulfatase
gi310635680	36.0%	Planctomyces brasiliensis DSM 5305	Sulfatase

The sequences with <20% and >99% sequence identitiy were ignored and 5 samples were randomly picked from the other ranges. So 20 sequences were available for the multiple alignments. Unfortunately no sequences in the range between 99-90% with known 3D-structure were found, so only sequences without known structure were used here. For the range between 59-40% also no pdb-structure was found, so we used a sequence with 39% sequence identity to have at least one pdb-structure.

References

<references />