Difference between revisions of "Task4 Hemochromatosis Protocol"
From Bioinformatikpedia
Bernhoferm (talk | contribs) |
|||
| Line 1: | Line 1: | ||
| + | == Template search == |
||
| − | HHPred: |
||
| − | search by using |
||
| + | Query sequence used: [http://www.uniprot.org/uniprot/Q30201.fasta Q30201] |
||
| − | >sp|Q30201|HFE_HUMAN Hereditary hemochromatosis protein OS=Homo sapiens GN=HFE PE=1 SV=1 |
||
| − | MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVF |
||
| − | YDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQV |
||
| − | ILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNR |
||
| − | AYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWL |
||
| − | KDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPS |
||
| − | PSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE |
||
| + | === HHPred === |
||
| − | search on pdb70may15 |
||
| + | We used HHPred ([http://toolkit.tuebingen.mpg.de/hhpred Webserver]) to search for homologs. Standard parameters were used (DB: pdb70_15May12). |
||
| + | |||
| + | Weblink to results (as long as they are online): [http://toolkit.tuebingen.mpg.de/hhpred/results/1980863 results] |
||
<!--- |
<!--- |
||
| Line 22: | Line 18: | ||
---> |
---> |
||
| + | === COMA === |
||
| + | Another search was performed using COMA ([http://bioinformatics.ibt.lt:8085/coma/ Webserver]). Again standard parameters were kept (DB: pdb40_2012-03-22). |
||
| + | Weblink to results (as long as they are online): [http://bioinformatics.ibt.lt:8085/coma/show/results/DABA40F9FD3019A1F8EEB5DAB88A784C59FBB794 results] |
||
| − | |||
| − | COMA: |
||
| − | standard parameters |
||
<!--- |
<!--- |
||
Job Id |
Job Id |
||
| Line 37: | Line 33: | ||
---> |
---> |
||
| + | == Model creation == |
||
| + | |||
| + | == Evaluation == |
||
| + | == Other == |
||
| − | P01921 21.10%ident -->1iao |
||
Revision as of 15:57, 29 May 2012
Template search
Query sequence used: Q30201
HHPred
We used HHPred (Webserver) to search for homologs. Standard parameters were used (DB: pdb70_15May12).
Weblink to results (as long as they are online): results
COMA
Another search was performed using COMA (Webserver). Again standard parameters were kept (DB: pdb40_2012-03-22).
Weblink to results (as long as they are online): results
