Difference between revisions of "Sequence Alignments Hemochromatosis"

From Bioinformatikpedia
(→‎Blast)
(→‎Sequence Searches)
Line 27: Line 27:
 
=== Blast ===
  
=== Blast ===
   
  +
<figtable id="blastdist">
−
[[File:hemo_eval_blast_80.png|thumb|600px|left|E-Value distribution of the Blast search within Big80.]]
  
  +
{| class="wikitable" style="float: right; border: 2px solid darkgray;" cellpadding="2"
−
[[File:hemo_ident_blast_80.png|thumb|600px|left|Identity distribution of the Blast search within Big80.]]
  
  +
! scope="row" align="left" |
  +
| align="right" | [[File:hemo_eval_blast_80.png|thumb|400px]]
  +
|-
  +
! scope="row" align="left" |
  +
| align="right" | [[File:hemo_ident_blast_80.png|thumb|400px]]
  +
|-
  +
! scope="row" align="left" |
  +
| align="right" | E-Value and identity distributions of the Blast search within Big80.
  +
|
  +
|-
  +
|}
  +
</figtable>
   
 
=== PSI-Blast ===
  
=== PSI-Blast ===
   
  +
<figtable id="psiblastdist">
−
[[File:hemo_eval_psi_80.png|thumb|600px|right|E-Value distribution of the PSI-Blast search within Big80. The different values for h (0.002, 1e-10) and j (2, 10) are color-coded.]]
  
  +
{| class="wikitable" style="float: right; border: 2px solid darkgray;" cellpadding="2"
−
[[File:hemo_ident_psi_80.png|thumb|600px|right|Identity distribution of the PSI-Blast search within Big80. The different values for h (0.002, 1e-10) and j (2, 10) are color-coded.]]
  
  +
! scope="row" align="left" |
  +
| align="right" | [[File:hemo_eval_psi_80.png|thumb|400px]]
  +
|-
  +
! scope="row" align="left" |
  +
| align="right" | [[File:hemo_ident_psi_80.png|thumb|400px]]
  +
|-
  +
! scope="row" align="left" |
  +
| align="right" | E-Value and identity distributions of the PSI-BLast search within Big80.
  +
|
  +
|-
  +
|}
  +
</figtable>
   
 
=== HHblits ===
  
=== HHblits ===
   
  +
<figtable id="hhblitsdist">
−
[[File:hemo_eval_hhblits_80.png|thumb|600px|right|E-Value distribution of the HHblits search within Uniprot20.]]
  
  +
{| class="wikitable" style="float: right; border: 2px solid darkgray;" cellpadding="2"
−
[[File:hemo_ident_hhblits_80.png|thumb|600px|right|Identity distribution of the HHblits search within Uniprot20.]]
  
  +
! scope="row" align="left" |
  +
| align="right" | [[File:hemo_eval_hhblits_80.png|thumb|400px]]
  +
|-
  +
! scope="row" align="left" |
  +
| align="right" | [[File:hemo_ident_hhblits_80.png|thumb|400px]]
  +
|-
  +
! scope="row" align="left" |
  +
| align="right" | E-Value and identity distributions of the HHblits search within Uniprot20.
  +
|
  +
|-
  +
|}
  +
</figtable>
   
 
=== Comparison ===
  
=== Comparison ===
   
  +
<figtable id="psiblastoverlap">
−
[[File:hemo_Overlap_PSI.png|thumb|300px|left|Nothing to see here...]]
  
  +
{| class="wikitable" style="float: right; border: 2px solid darkgray;" cellpadding="2"
−
[[File:hemo_Overlap_PSI_BIG.png|thumb|300px|left|Nothing to see here...]]
  
  +
! scope="row" align="left" |
−
[[File:hemo_Overlap_PSI_BLAST.png|thumb|300px|left|Nothing to see here...]]
  
−
[[File:hemo_Overlap_All_80.png|thumb|300px|right|Nothing to see here...]]
 +
| align="right" | [[File:hemo_Overlap_PSI.png|thumb|300px]]
−
[[File:hemo_Overlap_All_BIG.png|thumb|300px|right|Nothing to see here...]]
 +
| align="right" | [[File:hemo_Overlap_PSI_BIG.png|thumb|300px]]
−
[[File:hemo_Overlap_PSI_HHB_BIG.png|thumb|300px|right|Nothing to see here...]]
 +
| align="right" | [[File:hemo_Overlap_PSI_BLAST.png|thumb|300px]]
  +
|-
  +
! scope="row" align="left" |
  +
| align="right" | Nothing to see here....
  +
|
  +
|-
  +
|}
  +
</figtable>
  +
  +
<figtable id="alloverlap">
  +
{| class="wikitable" style="float: right; border: 2px solid darkgray;" cellpadding="2"
  +
! scope="row" align="left" |
  +
| align="right" | [[File:hemo_Overlap_All_80.png|thumb|300px]]
  +
| align="right" | [[File:hemo_Overlap_All_BIG.png|thumb|300px]]
  +
| align="right" | [[File:hemo_Overlap_PSI_HHB_BIG.png|thumb|300px]]
  +
|-
  +
! scope="row" align="left" |
  +
| align="right" | Nothing to see here....
  +
|
  +
|-
  +
|}
  +
</figtable>
   
 
== Multiple Sequence Alignments ==
  
== Multiple Sequence Alignments ==

Revision as of 16:34, 6 May 2012

Henry Frankenstein: Look! It's moving. It's alive. It's alive... It's alive, it's moving, it's alive, it's alive, it's alive, it's alive, IT'S ALIVE!

Victor Moritz: Henry - In the name of God!

Henry Frankenstein: Oh, in the name of God! Now I know what it feels like to be God!

Task Description

Protocol

Sorry for the inconvenience (not beeing able to read something), we're rerunning some data...

Protocol

Reference Sequence

Sequence from Uniprot: Q30201 

>sp|Q30201|HFE_HUMAN Hereditary hemochromatosis protein OS=Homo sapiens GN=HFE PE=1 SV=1
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVF
YDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQV
ILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNR
AYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWL
KDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPS
PSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE

Sequence Searches

Blast

<figtable id="blastdist">

Hemo eval blast 80.png
Hemo ident blast 80.png
E-Value and identity distributions of the Blast search within Big80.

</figtable>

PSI-Blast

<figtable id="psiblastdist">

Hemo eval psi 80.png
Hemo ident psi 80.png
E-Value and identity distributions of the PSI-BLast search within Big80.

</figtable>

HHblits

<figtable id="hhblitsdist">

Hemo eval hhblits 80.png
Hemo ident hhblits 80.png
E-Value and identity distributions of the HHblits search within Uniprot20.

</figtable>

Comparison

<figtable id="psiblastoverlap">

Hemo Overlap PSI.png
Hemo Overlap PSI BIG.png
Hemo Overlap PSI BLAST.png
Nothing to see here....

</figtable>

<figtable id="alloverlap">

Hemo Overlap All 80.png
Hemo Overlap All BIG.png
Hemo Overlap PSI HHB BIG.png
Nothing to see here....

</figtable>

Multiple Sequence Alignments

Dataset

CLustalW

Muscle

T-Coffee

Retrieved from "https://i12r-studfilesrv.informatik.tu-muenchen.de/wiki/index.php?title=Sequence_Alignments_Hemochromatosis&oldid=17678"