Difference between revisions of "Fabry Disease 2012"
From Bioinformatikpedia
Rackersederj (talk | contribs) |
Rackersederj (talk | contribs) m |
||
Line 4: | Line 4: | ||
== Phenotype == |
== Phenotype == |
||
[[File:heart_attack_stroke.jpg|200px|thumb|right|Built up Gb3 and glycosphingolipids may lead to heart attack and stroke]] |
[[File:heart_attack_stroke.jpg|200px|thumb|right|Built up Gb3 and glycosphingolipids may lead to heart attack and stroke]] |
||
− | As almost each family has its own [http://www.medterms.com/script/main/art.asp?articlekey=5048 private mutation], phenotypes of affected persons can be very variable. In general, with increasing age symptoms become more severe. This effect is due to more and more accumulated glycosphingolipids that cannot be converted by the dysfunctional enzyme. The built up globotriaoslyceramide (Gb3) and related glycosphingolipids in the lysosomes, tissues, blood vessels and organs lead to a malfunction of major organs in the body starting at an age of 30 - 35. Thus untreated patients die approximately 10 - 20 years early (females and males, respectively). |
+ | As almost each family has its own [http://www.medterms.com/script/main/art.asp?articlekey=5048 private mutation], phenotypes of affected persons can be very variable. In general, with increasing age symptoms become more severe. This effect is due to more and more accumulated glycosphingolipids that cannot be converted by the dysfunctional enzyme. The built up globotriaoslyceramide (Gb3) and related glycosphingolipids in the lysosomes, tissues, blood vessels and organs lead to a malfunction of major organs in the body starting at an age of 30 - 35 (see picture on the right). Thus untreated patients die approximately 10 - 20 years early (females and males, respectively). |
Revision as of 15:33, 18 April 2012
Contents
Summary
Intelligenter Inhalt hier
Phenotype
As almost each family has its own private mutation, phenotypes of affected persons can be very variable. In general, with increasing age symptoms become more severe. This effect is due to more and more accumulated glycosphingolipids that cannot be converted by the dysfunctional enzyme. The built up globotriaoslyceramide (Gb3) and related glycosphingolipids in the lysosomes, tissues, blood vessels and organs lead to a malfunction of major organs in the body starting at an age of 30 - 35 (see picture on the right). Thus untreated patients die approximately 10 - 20 years early (females and males, respectively).
Cross-references
Biochemical disease mechanism
Cross-references
Mutations
Reference sequence
Reference Sequence of α-galactosidase A from Uniprot entry P06280
>gi|4504009|ref|NP_000160.1| alpha-galactosidase A precursor [Homo sapiens] MQLRNPELHLGCALALRFLALVSWDIPGARALDNGLARTPTMGWLHWERFMCNLDCQEEPDSCISEKLFM EMAELMVSEGWKDAGYEYLCIDDCWMAPQRDSEGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVGNK TCAGFPGSFGYYDIDAQTFADWGVDLLKFDGCYCDSLENLADGYKHMSLALNRTGRSIVYSCEWPLYMWP FQKPNYTEIRQYCNHWRNFADIDDSWKSIKSILDWTSFNQERIVDVAGPGGWNDPDMLVIGNFGLSWNQQ VTQMALWAIMAAPLFMSNDLRHISPQAKALLQDKDVIAINQDPLGKQGYQLRQGDNFEVWERPLSGLAWA VAMINRQEIGGPRSYTIAVASLGKGVACNPACFITQLLPVKRKLGFYEWTSRLRSHINPTGTVLLQLENT MQMSLKDLL