Difference between revisions of "Metachromatic leukodystrophy reference aminoacids"
Line 17: | Line 17: | ||
== Database Searches == |
== Database Searches == |
||
− | FASTA, BLAST and PSI-BLAST were run against the non-redundant database (NR). HHsearch was run through the web interface |
+ | FASTA, BLAST and PSI-BLAST were run against the non-redundant database (NR). HHsearch was run through the web interface<ref>http://toolkit.lmb.uni-muenchen.de/hhpred</ref> aigainst the PDB and Interpro database. The following parameter settings were used: |
* BLAST: <code>blastall -p blastp -i refSeq.fasta -d /data/blast/nr/nr > blastp</code> with refSeq.fasta being the file containing the reference sequence and blastp the * PSI-BLAST: <code>blastpgp -i refSeq.fasta -d /data/blast/nr/nr -e''"e-value"'' -j ''"#iterations"'' > psiblast_"e-value"_"#iterations"</code> <br /> |
* BLAST: <code>blastall -p blastp -i refSeq.fasta -d /data/blast/nr/nr > blastp</code> with refSeq.fasta being the file containing the reference sequence and blastp the * PSI-BLAST: <code>blastpgp -i refSeq.fasta -d /data/blast/nr/nr -e''"e-value"'' -j ''"#iterations"'' > psiblast_"e-value"_"#iterations"</code> <br /> |
||
* PSI-BLAST was run with the following parameter settings: |
* PSI-BLAST was run with the following parameter settings: |
||
− | + | ** e-value cutoff 0.005, 3 iterations (Psi-blast1) |
|
− | + | ** e-value cutoff 0.005, 5 iterations (Psi-blast2) |
|
− | + | ** e-value cutoff 10E-6, 3 iterations (Psi-blast3) |
|
− | + | ** e-value cutoff 10E-6, 5 iterations (Psi-blast4) |
|
* HHsearch: We used the online version of hhPred <ref>http://toolkit.lmb.uni-muenchen.de/hhpred</ref> with default parameters. One search was performed against PDB and one against Interpro. |
* HHsearch: We used the online version of hhPred <ref>http://toolkit.lmb.uni-muenchen.de/hhpred</ref> with default parameters. One search was performed against PDB and one against Interpro. |
||
=== Alignment results === |
=== Alignment results === |
||
− | We wrote a perl script to parse the output files of the individual programs and extracted identifier, alignment score and the percentage of identical residues within the alignment |
+ | We wrote a perl script to parse the output files of the individual programs and extracted identifier, alignment score and the percentage of identical residues within the alignment. |
=== Mapping of identifier === |
=== Mapping of identifier === |
||
Line 36: | Line 36: | ||
In this section, we give a short summary description of the search results of the individual programs and the compare them to each other. |
In this section, we give a short summary description of the search results of the individual programs and the compare them to each other. |
||
− | ==== |
+ | ==== Comparison of the methods ==== |
− | FASTA yielded with 4733 alignments the highest number of hits. |
||
+ | * FASTA yielded with 4733 alignments the highest number of hits. |
||
− | ==== BLAST ==== |
||
− | BLAST produced 252 alignments. |
+ | * BLAST produced 252 alignments. |
+ | * PSI-BLAST |
||
+ | ** Using an E-value cutoff of 0.005, PSI-BLAST produced 756 alignments for 3 iterations and 1257 for 5 iterations. |
||
+ | ** Using an E-value cutoff of 10E-6, PSI-BLAST produced 756 alignments for 3 iterations and 1257 for 5 iterations. |
||
+ | * HHsearch produced 33 alignments for the search against PDB and 74 alignments for search against Interpro. |
||
+ | |||
+ | FASTA shows the highest number of alignments, probably due to the fact, that no e-value cutoff was chosen. Contrary, hhsearch has very few alignments. This could be ascribed to the fact, that completely different databases were used for the alignments and Interpro and pdb just did not have as much homolguous sequences as the nr database. This is also supported by the benchmark with HSSP (see next section). Aother interesting fact is that the results of PSI-BLAST depended for our parameter setting only on the number of iterations. Ragarding the results for the number of iterations, both e-value cutoffs yielded excepted of some single exceptions the same aligned target sequences from the database. |
||
− | ==== PSI-BLAST ==== |
||
− | * Using an E-value cutoff of 0.005, PSI-BLAST produced 756 alignments for 3 iterations and 1257 for 5 iterations. |
||
− | * Using an E-value cutoff of 10E-6, PSI-BLAST produced 756 alignments for 3 iterations and 1257 for 5 iterations. |
||
− | ==== HHsearch ==== |
||
− | HHsearch produced 33 alignments for the search against PDB and 74 alignments for search against Interpro. |
||
− | ==== Comparison ==== |
||
[[Image:Scores identity.jpeg|thumb|right| The density of alignment scores and percentage of identical residues within the alignments are plotted]] |
[[Image:Scores identity.jpeg|thumb|right| The density of alignment scores and percentage of identical residues within the alignments are plotted]] |
||
[[Image:overlap.jpeg|thumb|right| The number of shared target sequences between two methods is shown in the upper panel (self overlaps not shown). The lower panel depicts how many percent of the aligned target sequences of a given method (x-axis) are shared with the other methods.]] |
[[Image:overlap.jpeg|thumb|right| The number of shared target sequences between two methods is shown in the upper panel (self overlaps not shown). The lower panel depicts how many percent of the aligned target sequences of a given method (x-axis) are shared with the other methods.]] |
Revision as of 13:36, 23 May 2011
Contents
Sequence
>sp|P15289|ARSA_HUMAN Arylsulfatase A OS=Homo sapiens GN=ARSA PE=1 SV=3
MGAPRSLLLALAAGLAVARPPNIVLIFADDLGYGDLGCYGHPSSTTPNLDQLAAGGLRFT
DFYVPVSLCTPSRAALLTGRLPVRMGMYPGVLVPSSRGGLPLEEVTVAEVLAARGYLTGM
AGKWHLGVGPEGAFLPPHQGFHRFLGIPYSHDQGPCQNLTCFPPATPCDGGCDQGLVPIP
LLANLSVEAQPPWLPGLEARYMAFAHDLMADAQRQDRPFFLYYASHHTHYPQFSGQSFAE
RSGRGPFGDSLMELDAAVGTLMTAIGDLGLLEETLVIFTADNGPETMRMSRGGCSGLLRC
GKGTTYEGGVREPALAFWPGHIAPGVTHELASSLDLLPTLAALAGAPLPNVTLDGFDLSP
LLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFTQGSAHSDTTADPACHASSSL
TAHEPPLLYDLSKDPGENYNLLGGVAGATPEVLQALKQLQLLKAQLDAAVTFGPSQVARG
EDPALQICCHPGCTPRPACCHCPDPHA
Source
Database Searches
FASTA, BLAST and PSI-BLAST were run against the non-redundant database (NR). HHsearch was run through the web interface<ref>http://toolkit.lmb.uni-muenchen.de/hhpred</ref> aigainst the PDB and Interpro database. The following parameter settings were used:
- BLAST:
blastall -p blastp -i refSeq.fasta -d /data/blast/nr/nr > blastp
with refSeq.fasta being the file containing the reference sequence and blastp the * PSI-BLAST:blastpgp -i refSeq.fasta -d /data/blast/nr/nr -e"e-value" -j "#iterations" > psiblast_"e-value"_"#iterations"
- PSI-BLAST was run with the following parameter settings:
- e-value cutoff 0.005, 3 iterations (Psi-blast1)
- e-value cutoff 0.005, 5 iterations (Psi-blast2)
- e-value cutoff 10E-6, 3 iterations (Psi-blast3)
- e-value cutoff 10E-6, 5 iterations (Psi-blast4)
- HHsearch: We used the online version of hhPred <ref>http://toolkit.lmb.uni-muenchen.de/hhpred</ref> with default parameters. One search was performed against PDB and one against Interpro.
Alignment results
We wrote a perl script to parse the output files of the individual programs and extracted identifier, alignment score and the percentage of identical residues within the alignment.
Mapping of identifier
The non-redundant database contains entries from various databases, including RefSeq, PDB, PIR, PRF, GenBank and Swiss-Prot. In order to compare results of NR database searches with the results of the HHpred searches, a mapping of the IDs is necessary. Furthermore, the entries in HSSP - which is used later to benchmark the alignment results - contains only references to the UniProtKB accession number (ACCNUM). To overcome this problem we downloaded a mapping table between the IDs from <ref>http://pir.georgetown.edu/pirwww/search/idmapping.shtml</ref>. This table was used - together with some short perl scripts - to map IDs between the databases and compare the results.
Summary of database searches
In this section, we give a short summary description of the search results of the individual programs and the compare them to each other.
Comparison of the methods
- FASTA yielded with 4733 alignments the highest number of hits.
- BLAST produced 252 alignments.
- PSI-BLAST
- Using an E-value cutoff of 0.005, PSI-BLAST produced 756 alignments for 3 iterations and 1257 for 5 iterations.
- Using an E-value cutoff of 10E-6, PSI-BLAST produced 756 alignments for 3 iterations and 1257 for 5 iterations.
- HHsearch produced 33 alignments for the search against PDB and 74 alignments for search against Interpro.
FASTA shows the highest number of alignments, probably due to the fact, that no e-value cutoff was chosen. Contrary, hhsearch has very few alignments. This could be ascribed to the fact, that completely different databases were used for the alignments and Interpro and pdb just did not have as much homolguous sequences as the nr database. This is also supported by the benchmark with HSSP (see next section). Aother interesting fact is that the results of PSI-BLAST depended for our parameter setting only on the number of iterations. Ragarding the results for the number of iterations, both e-value cutoffs yielded excepted of some single exceptions the same aligned target sequences from the database.
HSSP
Method | Recall (GI) | Recall (pdb) | Precision (GI) |
FASTA | 0.92 | 0.67 | 0.23 |
BLAST | 0.11 | 0.42 | 0.54 |
Psi-blast1 | 0.21 | 0.42 | 0.65 |
Psi-blast2 | 0.23 | 0.5 | 0.62 |
Psi-blast3 | 0.21 | 0.42 | 0.65 |
Psi-blast4 | 0.23 | 0.5 | 0.62 |
hhpred (pdb) | 0.01 | 1 | 0.11 |
hhpred (interpro) | 0.01 | 0.92 | 0.12 |
Multiple Alignments
For building the multiple Alignments the results of the Psiblast run with e-value cutoff of 10E-6 and 5 iterations were divided into 6 groups by sequence identity:
- <20%
- 20% - 39%
- 40% - 59%
- 60% - 89%
- 90% - 99%
- >99%
The sequences with <20% and >99% sequence identitiy were ignored and 5 samples were randomly picked from the other ranges. So 20 sequences were available for the multiple alignments.
References
<references />