Difference between revisions of "Journal Task4 PKU"
(→Modeller) |
(→single template) |
||
(2 intermediate revisions by one other user not shown) | |||
Line 188: | Line 188: | ||
aln.check() |
aln.check() |
||
aln.write(file='output/1phz-1pah.ali', alignment_format='PIR') |
aln.write(file='output/1phz-1pah.ali', alignment_format='PIR') |
||
+ | </source> |
||
+ | ---- |
||
− | |||
+ | '''Modelling step''' |
||
+ | <source lang="python"> |
||
+ | from modeller import * |
||
+ | from modeller.automodel import * |
||
+ | |||
+ | log.verbose() |
||
+ | env = environ() |
||
+ | a = automodel(env, |
||
+ | alnfile = 'output/1phz-2pah.ali', |
||
+ | knowns = '1phz', |
||
+ | sequence = '2pah', |
||
+ | assess_methods=(assess.DOPE, assess.GA341)) |
||
+ | a.starting_model= 1 |
||
+ | a.ending_model = 1 |
||
+ | a.make() |
||
</source> |
</source> |
||
+ | |||
+ | |||
+ | [[Category: Phenylketonuria 2012]] |
Latest revision as of 11:56, 29 August 2012
Phenylketonuria » Homology based structure predictions » Journal
Datasets
To get homologous structures we performed three different searches with three different web-services and compared them to our findings from Task2. We got three outputfiles which were parsed and the related files got downloaded from the PDB by using these scripts
HHPred
<source lang="perl"> my $id; my $Evalue; my $Identities; my $bool = "F";
open(IN,"<". $ARGV[0]); open(OUT80, ">dataset_80.txt"); open(OUT40, ">dataset_40.txt"); open(OUT20, ">dataset_20.txt");
mkdir("output");
while(<IN>) { chomp; if( ($_ =~ /^>\d+/ )) { $_ =~ />(.{4}).+/; $id = $1; $bool ="T"; } if($bool eq "T" && $_ =~ /^.*Probab/) { $_ =~ /^.*Probab=.+E-value=(.+)\s+Score=.+Aligned_cols=.+Identities=(.+)%\s+Similarity=.+/; $bool ="F"; $Evalue = $1; $Identities = $2; if($Evalue <= $ARGV[1] && $Identities > 80){ print OUT80 "$id\t$Evalue\t$Identities\n"; @args = ("wget", "http://pdb.rcsb.org/pdb/files/". $id . ".pdb", "--output-document=output/$id.pdb"); system(@args) == 0 or die "system @args failed: $?" } elsif($Evalue <= $ARGV[1] && $Identities < 30){ print OUT20 "$id\t$Evalue\t$Identities\n"; @args = ("wget", "http://pdb.rcsb.org/pdb/files/". $id . ".pdb", "--output-document=output/$id.pdb"); system(@args) == 0 or die "system @args failed: $?" } elsif($Evalue <= $ARGV[1] && $Identities > 40) { print OUT40 "$id\t$Evalue\t$Identities\n"; @args = ("wget", "http://pdb.rcsb.org/pdb/files/". $id . ".pdb", "--output-document=output/$id.pdb"); system(@args) == 0 or die "system @args failed: $?" } } } close OUT80; close OUT40; close OUT20; </source>
Coma
<source lang="perl"> my $id; my $Evalue; my $Identities; my $Positives; my $bool = "F";
open(IN,"<". $ARGV[0]); open(OUT80, ">dataset_coma_80.txt"); open(OUT40, ">dataset_coma_40.txt"); open(OUT20, ">dataset_coma_20.txt");
mkdir("outputcoma");
while(<IN>) { chomp; if( ($_ =~ /^>\d+/ )) { $_ =~ />(.{4}).+/; $id = $1; $bool ="T"; } elsif($bool eq "T" && $_ =~ /^Score/){ $_ =~ /.+Expect\s+=\s+(.+)\s+P-value.+/; $Evalue = $1; } elsif($bool eq "T" && $_ =~ /^Identities/) { $_ =~ /Identities.+\((\d+)%\)\s+Positives.+\((\d+)%\)\s+Gaps.+/; $bool ="F"; $Identities = $1; $Positives = $2; if($Evalue <= $ARGV[1] && $Identities > 80){ print OUT80 "$id\t$Evalue\t$Identities\t$Positives\n"; @args = ("wget", "http://pdb.rcsb.org/pdb/files/". $id . ".pdb", "--output-document=outputcoma/$id.pdb"); system(@args) == 0 or die "system @args failed: $?" } elsif($Evalue <= $ARGV[1] && $Identities < 30){ print OUT20 "$id\t$Evalue\t$Identities\t$Positives\n"; @args = ("wget", "http://pdb.rcsb.org/pdb/files/". $id . ".pdb", "--output-document=outputcoma/$id.pdb"); system(@args) == 0 or die "system @args failed: $?" } elsif($Evalue <= $ARGV[1] && $Identities > 40) { print OUT40 "$id\t$Evalue\t$Identities\t$Positives\n"; @args = ("wget", "http://pdb.rcsb.org/pdb/files/". $id . ".pdb", "--output-document=outputcoma/$id.pdb"); system(@args) == 0 or die "system @args failed: $?" } } }
close OUT80; close OUT40; close OUT20; </source>
PDBe
<source lang="perl"> my $id; my $Evalue; my $Identities; my $bool = "F";
open(IN,"<". $ARGV[0]); open(OUT80, ">dataset_80.txt"); open(OUT40, ">dataset_40.txt"); open(OUT20, ">dataset_20.txt");
mkdir("output");
while(<IN>) { chomp;
if( ($_ =~ /^\d+/ )) { @linesplit = split( /\t/,$_);
$id = $linesplit[0]; $Evalue = $linesplit[8]; $Identities = $linesplit[7]; if($Evalue <= $ARGV[1] && $Identities > 80){ print OUT80 "$id\t$Evalue\t$Identities\n"; @args = ("wget", "http://pdb.rcsb.org/pdb/files/". $id . ".pdb", "--output-document=output/$id.pdb"); system(@args) == 0 or die "system @args failed: $?" } elsif($Evalue <= $ARGV[1] && $Identities < 30){ print OUT20 "$id\t$Evalue\t$Identities\n"; @args = ("wget", "http://pdb.rcsb.org/pdb/files/". $id . ".pdb", "--output-document=output/$id.pdb"); system(@args) == 0 or die "system @args failed: $?" } elsif($Evalue <= $ARGV[1] && $Identities > 40) { print OUT40 "$id\t$Evalue\t$Identities\n"; @args = ("wget", "http://pdb.rcsb.org/pdb/files/". $id . ".pdb", "--output-document=output/$id.pdb"); system(@args) == 0 or die "system @args failed: $?" } }
} close OUT80; close OUT40; close OUT20; </source>
Modeller
Modeller needs the target as a .pir-file which we provided as mentioned above
>P1;2pah sequence:2pah:::::::0.00: 0.00 MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDV NLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPW FPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYM EEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGF RLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFA QFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSE KPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQR IEVLDNTQQLKILADSINSEIGILCSALQKIK*
single template
For a single template we used the two scripts as mentioned in the tutorial created last year. In the following we only show one example of our scripts.
Alignment step <source lang="python"> from modeller import *
log.verbose() env = environ() aln = alignment(env) mdl = model(env, file='input/1phz', model_segment=('FIRST:@', 'END:')) aln.append_model(mdl, align_codes='1phz', atom_files='1phz') aln.append(file='input/2pah.pir', align_codes='2pah') aln.align2d() aln.check() aln.write(file='output/1phz-1pah-2d.ali', alignment_format='PIR') aln.malign() aln.check() aln.write(file='output/1phz-1pah.ali', alignment_format='PIR') </source>
Modelling step <source lang="python"> from modeller import * from modeller.automodel import *
log.verbose() env = environ() a = automodel(env,
alnfile = 'output/1phz-2pah.ali', knowns = '1phz', sequence = '2pah', assess_methods=(assess.DOPE, assess.GA341))
a.starting_model= 1 a.ending_model = 1 a.make() </source>