Difference between revisions of "Journal Task4 PKU"
(Created page with "Phenylketonuria » Homology based structure predictions » Journal <hr>") |
(→single template) |
||
(6 intermediate revisions by one other user not shown) | |||
Line 1: | Line 1: | ||
[[Phenylketonuria]] » [[Homology-based_structure_prediction_(PKU)|Homology based structure predictions]] » Journal |
[[Phenylketonuria]] » [[Homology-based_structure_prediction_(PKU)|Homology based structure predictions]] » Journal |
||
<hr> |
<hr> |
||
+ | == Datasets == |
||
+ | To get homologous structures we performed three different searches with three different web-services and compared them to our findings from [[Sequence_Search_and_Multiple_Sequence_Alignment_(PKU)#Datasets|Task2]]. |
||
+ | We got three outputfiles which were parsed and the related files got downloaded from the PDB by using these scripts |
||
+ | ===HHPred=== |
||
+ | <source lang="perl"> |
||
+ | my $id; |
||
+ | my $Evalue; |
||
+ | my $Identities; |
||
+ | my $bool = "F"; |
||
+ | |||
+ | open(IN,"<". $ARGV[0]); |
||
+ | open(OUT80, ">dataset_80.txt"); |
||
+ | open(OUT40, ">dataset_40.txt"); |
||
+ | open(OUT20, ">dataset_20.txt"); |
||
+ | |||
+ | mkdir("output"); |
||
+ | |||
+ | while(<IN>) { |
||
+ | chomp; |
||
+ | if( ($_ =~ /^>\d+/ )) { |
||
+ | $_ =~ />(.{4}).+/; |
||
+ | $id = $1; |
||
+ | $bool ="T"; |
||
+ | } |
||
+ | if($bool eq "T" && $_ =~ /^.*Probab/) |
||
+ | { |
||
+ | $_ =~ /^.*Probab=.+E-value=(.+)\s+Score=.+Aligned_cols=.+Identities=(.+)%\s+Similarity=.+/; |
||
+ | $bool ="F"; |
||
+ | $Evalue = $1; |
||
+ | $Identities = $2; |
||
+ | if($Evalue <= $ARGV[1] && $Identities > 80){ |
||
+ | print OUT80 "$id\t$Evalue\t$Identities\n"; |
||
+ | @args = ("wget", "http://pdb.rcsb.org/pdb/files/". $id . ".pdb", "--output-document=output/$id.pdb"); |
||
+ | system(@args) == 0 or die "system @args failed: $?" |
||
+ | } |
||
+ | elsif($Evalue <= $ARGV[1] && $Identities < 30){ |
||
+ | print OUT20 "$id\t$Evalue\t$Identities\n"; |
||
+ | @args = ("wget", "http://pdb.rcsb.org/pdb/files/". $id . ".pdb", "--output-document=output/$id.pdb"); |
||
+ | system(@args) == 0 or die "system @args failed: $?" |
||
+ | } |
||
+ | elsif($Evalue <= $ARGV[1] && $Identities > 40) |
||
+ | { |
||
+ | print OUT40 "$id\t$Evalue\t$Identities\n"; |
||
+ | @args = ("wget", "http://pdb.rcsb.org/pdb/files/". $id . ".pdb", "--output-document=output/$id.pdb"); |
||
+ | system(@args) == 0 or die "system @args failed: $?" |
||
+ | } |
||
+ | } |
||
+ | } |
||
+ | close OUT80; |
||
+ | close OUT40; |
||
+ | close OUT20; |
||
+ | </source> |
||
+ | |||
+ | === Coma === |
||
+ | <source lang="perl"> |
||
+ | my $id; |
||
+ | my $Evalue; |
||
+ | my $Identities; |
||
+ | my $Positives; |
||
+ | my $bool = "F"; |
||
+ | |||
+ | open(IN,"<". $ARGV[0]); |
||
+ | open(OUT80, ">dataset_coma_80.txt"); |
||
+ | open(OUT40, ">dataset_coma_40.txt"); |
||
+ | open(OUT20, ">dataset_coma_20.txt"); |
||
+ | |||
+ | mkdir("outputcoma"); |
||
+ | |||
+ | while(<IN>) { |
||
+ | chomp; |
||
+ | if( ($_ =~ /^>\d+/ )) { |
||
+ | $_ =~ />(.{4}).+/; |
||
+ | $id = $1; |
||
+ | $bool ="T"; |
||
+ | } |
||
+ | elsif($bool eq "T" && $_ =~ /^Score/){ |
||
+ | $_ =~ /.+Expect\s+=\s+(.+)\s+P-value.+/; |
||
+ | $Evalue = $1; |
||
+ | } |
||
+ | elsif($bool eq "T" && $_ =~ /^Identities/) |
||
+ | { |
||
+ | $_ =~ /Identities.+\((\d+)%\)\s+Positives.+\((\d+)%\)\s+Gaps.+/; |
||
+ | $bool ="F"; |
||
+ | $Identities = $1; |
||
+ | $Positives = $2; |
||
+ | if($Evalue <= $ARGV[1] && $Identities > 80){ |
||
+ | print OUT80 "$id\t$Evalue\t$Identities\t$Positives\n"; |
||
+ | @args = ("wget", "http://pdb.rcsb.org/pdb/files/". $id . ".pdb", "--output-document=outputcoma/$id.pdb"); |
||
+ | system(@args) == 0 or die "system @args failed: $?" |
||
+ | } |
||
+ | elsif($Evalue <= $ARGV[1] && $Identities < 30){ |
||
+ | print OUT20 "$id\t$Evalue\t$Identities\t$Positives\n"; |
||
+ | @args = ("wget", "http://pdb.rcsb.org/pdb/files/". $id . ".pdb", "--output-document=outputcoma/$id.pdb"); |
||
+ | system(@args) == 0 or die "system @args failed: $?" |
||
+ | } |
||
+ | elsif($Evalue <= $ARGV[1] && $Identities > 40) |
||
+ | { |
||
+ | print OUT40 "$id\t$Evalue\t$Identities\t$Positives\n"; |
||
+ | @args = ("wget", "http://pdb.rcsb.org/pdb/files/". $id . ".pdb", "--output-document=outputcoma/$id.pdb"); |
||
+ | system(@args) == 0 or die "system @args failed: $?" |
||
+ | } |
||
+ | } |
||
+ | } |
||
+ | |||
+ | close OUT80; |
||
+ | close OUT40; |
||
+ | close OUT20; |
||
+ | </source> |
||
+ | === PDBe === |
||
+ | <source lang="perl"> |
||
+ | my $id; |
||
+ | my $Evalue; |
||
+ | my $Identities; |
||
+ | my $bool = "F"; |
||
+ | |||
+ | open(IN,"<". $ARGV[0]); |
||
+ | open(OUT80, ">dataset_80.txt"); |
||
+ | open(OUT40, ">dataset_40.txt"); |
||
+ | open(OUT20, ">dataset_20.txt"); |
||
+ | |||
+ | mkdir("output"); |
||
+ | |||
+ | while(<IN>) { |
||
+ | chomp; |
||
+ | |||
+ | if( ($_ =~ /^\d+/ )) { |
||
+ | @linesplit = split( /\t/,$_); |
||
+ | |||
+ | $id = $linesplit[0]; |
||
+ | $Evalue = $linesplit[8]; |
||
+ | $Identities = $linesplit[7]; |
||
+ | if($Evalue <= $ARGV[1] && $Identities > 80){ |
||
+ | print OUT80 "$id\t$Evalue\t$Identities\n"; |
||
+ | @args = ("wget", "http://pdb.rcsb.org/pdb/files/". $id . ".pdb", "--output-document=output/$id.pdb"); |
||
+ | system(@args) == 0 or die "system @args failed: $?" |
||
+ | } |
||
+ | elsif($Evalue <= $ARGV[1] && $Identities < 30){ |
||
+ | print OUT20 "$id\t$Evalue\t$Identities\n"; |
||
+ | @args = ("wget", "http://pdb.rcsb.org/pdb/files/". $id . ".pdb", "--output-document=output/$id.pdb"); |
||
+ | system(@args) == 0 or die "system @args failed: $?" |
||
+ | } |
||
+ | elsif($Evalue <= $ARGV[1] && $Identities > 40) |
||
+ | { |
||
+ | print OUT40 "$id\t$Evalue\t$Identities\n"; |
||
+ | @args = ("wget", "http://pdb.rcsb.org/pdb/files/". $id . ".pdb", "--output-document=output/$id.pdb"); |
||
+ | system(@args) == 0 or die "system @args failed: $?" |
||
+ | } |
||
+ | } |
||
+ | |||
+ | } |
||
+ | close OUT80; |
||
+ | close OUT40; |
||
+ | close OUT20; |
||
+ | </source> |
||
+ | |||
+ | == Modeller == |
||
+ | Modeller needs the target as a .pir-file which we provided as mentioned above |
||
+ | >P1;2pah |
||
+ | sequence:2pah:::::::0.00: 0.00 |
||
+ | MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDV |
||
+ | NLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPW |
||
+ | FPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYM |
||
+ | EEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGF |
||
+ | RLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFA |
||
+ | QFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSE |
||
+ | KPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQR |
||
+ | IEVLDNTQQLKILADSINSEIGILCSALQKIK* |
||
+ | |||
+ | === single template === |
||
+ | For a single template we used the two scripts as mentioned in the [[Using_Modeller_for_TASK_4|tutorial]] created last year. In the following we only show one example of our scripts. |
||
+ | ---- |
||
+ | '''Alignment step''' |
||
+ | <source lang="python"> |
||
+ | from modeller import * |
||
+ | |||
+ | log.verbose() |
||
+ | env = environ() |
||
+ | aln = alignment(env) |
||
+ | mdl = model(env, file='input/1phz', model_segment=('FIRST:@', 'END:')) |
||
+ | aln.append_model(mdl, align_codes='1phz', atom_files='1phz') |
||
+ | aln.append(file='input/2pah.pir', align_codes='2pah') |
||
+ | aln.align2d() |
||
+ | aln.check() |
||
+ | aln.write(file='output/1phz-1pah-2d.ali', alignment_format='PIR') |
||
+ | aln.malign() |
||
+ | aln.check() |
||
+ | aln.write(file='output/1phz-1pah.ali', alignment_format='PIR') |
||
+ | </source> |
||
+ | |||
+ | ---- |
||
+ | '''Modelling step''' |
||
+ | <source lang="python"> |
||
+ | from modeller import * |
||
+ | from modeller.automodel import * |
||
+ | |||
+ | log.verbose() |
||
+ | env = environ() |
||
+ | a = automodel(env, |
||
+ | alnfile = 'output/1phz-2pah.ali', |
||
+ | knowns = '1phz', |
||
+ | sequence = '2pah', |
||
+ | assess_methods=(assess.DOPE, assess.GA341)) |
||
+ | a.starting_model= 1 |
||
+ | a.ending_model = 1 |
||
+ | a.make() |
||
+ | </source> |
||
+ | |||
+ | |||
+ | [[Category: Phenylketonuria 2012]] |
Latest revision as of 11:56, 29 August 2012
Phenylketonuria » Homology based structure predictions » Journal
Datasets
To get homologous structures we performed three different searches with three different web-services and compared them to our findings from Task2. We got three outputfiles which were parsed and the related files got downloaded from the PDB by using these scripts
HHPred
<source lang="perl"> my $id; my $Evalue; my $Identities; my $bool = "F";
open(IN,"<". $ARGV[0]); open(OUT80, ">dataset_80.txt"); open(OUT40, ">dataset_40.txt"); open(OUT20, ">dataset_20.txt");
mkdir("output");
while(<IN>) { chomp; if( ($_ =~ /^>\d+/ )) { $_ =~ />(.{4}).+/; $id = $1; $bool ="T"; } if($bool eq "T" && $_ =~ /^.*Probab/) { $_ =~ /^.*Probab=.+E-value=(.+)\s+Score=.+Aligned_cols=.+Identities=(.+)%\s+Similarity=.+/; $bool ="F"; $Evalue = $1; $Identities = $2; if($Evalue <= $ARGV[1] && $Identities > 80){ print OUT80 "$id\t$Evalue\t$Identities\n"; @args = ("wget", "http://pdb.rcsb.org/pdb/files/". $id . ".pdb", "--output-document=output/$id.pdb"); system(@args) == 0 or die "system @args failed: $?" } elsif($Evalue <= $ARGV[1] && $Identities < 30){ print OUT20 "$id\t$Evalue\t$Identities\n"; @args = ("wget", "http://pdb.rcsb.org/pdb/files/". $id . ".pdb", "--output-document=output/$id.pdb"); system(@args) == 0 or die "system @args failed: $?" } elsif($Evalue <= $ARGV[1] && $Identities > 40) { print OUT40 "$id\t$Evalue\t$Identities\n"; @args = ("wget", "http://pdb.rcsb.org/pdb/files/". $id . ".pdb", "--output-document=output/$id.pdb"); system(@args) == 0 or die "system @args failed: $?" } } } close OUT80; close OUT40; close OUT20; </source>
Coma
<source lang="perl"> my $id; my $Evalue; my $Identities; my $Positives; my $bool = "F";
open(IN,"<". $ARGV[0]); open(OUT80, ">dataset_coma_80.txt"); open(OUT40, ">dataset_coma_40.txt"); open(OUT20, ">dataset_coma_20.txt");
mkdir("outputcoma");
while(<IN>) { chomp; if( ($_ =~ /^>\d+/ )) { $_ =~ />(.{4}).+/; $id = $1; $bool ="T"; } elsif($bool eq "T" && $_ =~ /^Score/){ $_ =~ /.+Expect\s+=\s+(.+)\s+P-value.+/; $Evalue = $1; } elsif($bool eq "T" && $_ =~ /^Identities/) { $_ =~ /Identities.+\((\d+)%\)\s+Positives.+\((\d+)%\)\s+Gaps.+/; $bool ="F"; $Identities = $1; $Positives = $2; if($Evalue <= $ARGV[1] && $Identities > 80){ print OUT80 "$id\t$Evalue\t$Identities\t$Positives\n"; @args = ("wget", "http://pdb.rcsb.org/pdb/files/". $id . ".pdb", "--output-document=outputcoma/$id.pdb"); system(@args) == 0 or die "system @args failed: $?" } elsif($Evalue <= $ARGV[1] && $Identities < 30){ print OUT20 "$id\t$Evalue\t$Identities\t$Positives\n"; @args = ("wget", "http://pdb.rcsb.org/pdb/files/". $id . ".pdb", "--output-document=outputcoma/$id.pdb"); system(@args) == 0 or die "system @args failed: $?" } elsif($Evalue <= $ARGV[1] && $Identities > 40) { print OUT40 "$id\t$Evalue\t$Identities\t$Positives\n"; @args = ("wget", "http://pdb.rcsb.org/pdb/files/". $id . ".pdb", "--output-document=outputcoma/$id.pdb"); system(@args) == 0 or die "system @args failed: $?" } } }
close OUT80; close OUT40; close OUT20; </source>
PDBe
<source lang="perl"> my $id; my $Evalue; my $Identities; my $bool = "F";
open(IN,"<". $ARGV[0]); open(OUT80, ">dataset_80.txt"); open(OUT40, ">dataset_40.txt"); open(OUT20, ">dataset_20.txt");
mkdir("output");
while(<IN>) { chomp;
if( ($_ =~ /^\d+/ )) { @linesplit = split( /\t/,$_);
$id = $linesplit[0]; $Evalue = $linesplit[8]; $Identities = $linesplit[7]; if($Evalue <= $ARGV[1] && $Identities > 80){ print OUT80 "$id\t$Evalue\t$Identities\n"; @args = ("wget", "http://pdb.rcsb.org/pdb/files/". $id . ".pdb", "--output-document=output/$id.pdb"); system(@args) == 0 or die "system @args failed: $?" } elsif($Evalue <= $ARGV[1] && $Identities < 30){ print OUT20 "$id\t$Evalue\t$Identities\n"; @args = ("wget", "http://pdb.rcsb.org/pdb/files/". $id . ".pdb", "--output-document=output/$id.pdb"); system(@args) == 0 or die "system @args failed: $?" } elsif($Evalue <= $ARGV[1] && $Identities > 40) { print OUT40 "$id\t$Evalue\t$Identities\n"; @args = ("wget", "http://pdb.rcsb.org/pdb/files/". $id . ".pdb", "--output-document=output/$id.pdb"); system(@args) == 0 or die "system @args failed: $?" } }
} close OUT80; close OUT40; close OUT20; </source>
Modeller
Modeller needs the target as a .pir-file which we provided as mentioned above
>P1;2pah sequence:2pah:::::::0.00: 0.00 MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDV NLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPW FPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYM EEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGF RLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFA QFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSE KPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQR IEVLDNTQQLKILADSINSEIGILCSALQKIK*
single template
For a single template we used the two scripts as mentioned in the tutorial created last year. In the following we only show one example of our scripts.
Alignment step <source lang="python"> from modeller import *
log.verbose() env = environ() aln = alignment(env) mdl = model(env, file='input/1phz', model_segment=('FIRST:@', 'END:')) aln.append_model(mdl, align_codes='1phz', atom_files='1phz') aln.append(file='input/2pah.pir', align_codes='2pah') aln.align2d() aln.check() aln.write(file='output/1phz-1pah-2d.ali', alignment_format='PIR') aln.malign() aln.check() aln.write(file='output/1phz-1pah.ali', alignment_format='PIR') </source>
Modelling step <source lang="python"> from modeller import * from modeller.automodel import *
log.verbose() env = environ() a = automodel(env,
alnfile = 'output/1phz-2pah.ali', knowns = '1phz', sequence = '2pah', assess_methods=(assess.DOPE, assess.GA341))
a.starting_model= 1 a.ending_model = 1 a.make() </source>