Task 6: Sequence-based mutation analysis

From Bioinformatikpedia
Revision as of 13:21, 25 June 2011 by Meier (talk | contribs) (Execution)

Task description

A detailed task description can be found here.

Mutation selection

We selected the following ten mutations:

  • I65T
  • R71H
  • R158Q
  • R261Q
  • T266A
  • P275S
  • T278N
  • P281L
  • G312D
  • R408W

5 of these mutations are associated with our disease phenylketonuria the other 5 not. The 5 disease causing mutations are the most frequent missense/nonsense mutations of people who suffer from phenylketonuria. These numbers were taken from pahDB. However, at this point we are not going to tell which of these are the associated and which are not. We are going to lift this "secret" after our sequence based mutation analysis in order to validate our in silico generated predictions.

To keep our association secret we encrypted the file which contains the disease association for each mutation with the following linux command: "vim -x selected_mutations_and_association.txt"

The encrypted output is as follows:

Encrypted img.png


The decryption can be only performed with the correct password.

Physicochemical properties and changes

I65T

R71H

R158Q

R261Q

T266A

P275S

T278N

P281L

G312D

R408W

Mutations compared to BLOSUM62, PAM(1/250), PSSM and conservation of MSA with all mammalian homologous

BLOSUM 62 matrix

BLOSUM 62 Matrix
BLOSUM62 BCKDHA.gif
The BLOSUM 62 was calculated from blocks of clusters with a sequence identity of 62%. A positive score is given to the more likely substitutions while a negative score is given to the less likely substitutions. Source: [1] Disclaimer: This file is redistributed from Wikimedia and copyrighted under the Creative Commons licence.

PAM 1/250 matrix

PAM1 Matrix

A R N D C Q E G H I L K M F P S T W Y V
A 9867 2 9 10 3 8 17 21 2 6 4 2 6 2 22 35 32 0 2 18
R 1 9913 1 0 1 10 0 0 10 3 1 19 4 1 4 6 1 8 0 1
N 4 1 9822 36 0 4 6 6 21 3 1 13 0 1 2 20 9 1 4 1
D 6 0 42 9859 0 6 53 6 4 1 0 3 0 0 1 5 3 0 0 1
C 1 1 0 0 9973 0 0 0 1 1 0 0 0 0 1 5 1 0 3 2
Q 3 9 4 5 0 9876 27 1 23 1 3 6 4 0 6 2 2 0 0 1
E 10 0 7 56 0 35 9865 4 2 3 1 4 1 0 3 4 2 0 1 2
G 21 1 12 11 1 3 7 9935 1 0 1 2 1 1 3 21 3 0 0 5
H 1 8 18 3 1 20 1 0 9912 0 1 1 0 2 3 1 1 1 4 1
I 2 2 3 1 2 1 2 0 0 9872 9 2 12 7 0 1 7 0 1 33
L 3 1 3 0 0 6 1 1 4 22 9947 2 45 13 3 1 3 4 2 15
K 2 37 25 6 0 12 7 2 2 4 1 9926 20 0 3 8 11 0 1 1
M 1 1 0 0 0 2 0 0 0 5 8 4 9874 1 0 1 2 0 0 4
F 1 1 1 0 0 0 0 1 2 8 6 0 4 9946 0 2 1 3 28 0
P 13 5 2 1 1 8 3 2 5 1 2 2 1 1 9926 12 4 0 0 2
S 28 11 34 7 11 4 6 16 2 2 1 7 4 3 17 9840 38 5 2 2
T 22 2 13 4 1 3 2 2 1 11 2 8 6 1 5 32 9871 0 2 9
W 0 2 0 0 0 0 0 0 0 0 0 0 0 1 0 1 0 9976 1 0
Y 1 0 3 0 3 0 1 0 4 1 1 0 0 21 0 1 1 2 9945 1
V 13 2 1 1 3 2 2 3 3 57 11 1 17 1 3 2 10 0 2 9901

PAM250 Matrix

A R N D C Q E G H I L K M F P S T W Y V
A 13 6 9 9 5 8 9 12 6 8 6 7 7 4 11 11 11 2 4 9
R 3 17 4 3 2 5 3 2 6 3 2 9 4 1 4 4 3 7 2 2
N 4 4 6 7 2 5 6 4 6 3 2 5 3 2 4 5 4 2 3 3
D 5 4 8 11 1 7 10 5 6 3 2 5 3 1 4 5 5 1 2 3
C 2 1 1 1 52 1 1 2 2 2 1 1 1 1 2 3 2 1 4 2
Q 3 5 5 6 1 10 7 3 7 2 3 5 3 1 4 3 3 1 2 3
E 5 4 7 11 1 9 12 5 6 3 2 5 3 1 4 5 5 1 2 3
G 12 5 10 10 4 7 9 27 5 5 4 6 5 3 8 11 9 2 3 7
H 2 5 5 4 2 7 4 2 15 2 2 3 2 2 3 3 2 2 3 2
I 3 2 2 2 2 2 2 2 2 10 6 2 6 5 2 3 4 1 3 9
L 6 4 4 3 2 6 4 3 5 15 34 4 20 13 5 4 6 6 7 13
K 6 18 10 8 2 10 8 5 8 5 4 24 9 2 6 8 8 4 3 5
M 1 1 1 1 0 1 1 1 1 2 3 2 6 2 1 1 1 1 1 2
F 2 1 2 1 1 1 1 1 3 5 6 1 4 32 1 2 2 4 20 3
P 7 5 5 4 3 5 4 5 5 3 3 4 3 2 20 6 5 1 2 4
S 9 6 8 7 7 6 7 9 6 5 4 7 5 3 9 10 9 4 4 6
T 8 5 6 6 4 5 5 6 4 6 4 6 5 3 6 8 11 2 3 6
W 0 2 0 0 0 0 0 0 1 0 1 0 0 1 0 1 0 55 1 0
Y 1 1 2 1 3 1 1 1 3 2 2 1 2 15 1 2 2 3 31 2
V 7 4 4 4 4 4 4 4 5 4 15 10 4 10 5 5 5 72 4 17

PSSM

Position AA A R N D C Q E G H I L K M F P S T W Y V A R N D C Q E G H I L K M F P S T W Y V
1 M -3 -4 -5 -5 -3 -3 -4 -5 -4 0 5 -4 7 -1 -5 -4 -3 -3 -3 -1 0 0 0 0 0 0 0 0 0 0 66 0 34 0 0 0 0 0 0 0 1.13 0.65
2 S 4 -3 1 -3 -3 -3 -2 1 1 -4 -4 -3 -3 -5 -3 3 -1 -5 -4 -3 46 0 8 0 0 0 2 11 4 0 0 0 0 0 0 28 1 0 0 0 0.75 0.91
3 T 2 -3 2 -3 -4 -3 -3 2 2 -5 -5 -3 -4 -4 -2 4 1 3 -3 -4 19 0 9 0 0 0 0 13 6 0 0 0 0 0 1 39 9 5 0 0 0.68 1.04
4 A 2 -3 0 -1 -4 -3 -3 -1 -4 0 1 1 -2 -4 -4 2 -2 -5 -4 3 18 0 5 3 0 0 1 4 0 4 14 9 0 0 0 17 1 0 0 25 0.35 1.10
5 V -1 -5 -4 -5 3 -1 -3 -5 -5 5 0 -4 0 -3 -3 0 2 -5 -4 3 4 0 0 0 5 3 1 0 0 37 6 0 1 0 1 6 16 0 0 18 0.67 1.15
6 L 4 -1 -4 -2 -4 1 0 -2 -4 0 2 2 -2 -3 -4 -2 -3 -5 0 -1 33 3 0 2 0 7 6 2 0 5 20 13 0 1 0 1 0 0 3 4 0.39 1.19
7 E -2 -1 3 3 -6 0 5 -2 -3 -3 -5 0 -5 -6 -1 -1 -3 -6 -5 -5 3 3 17 17 0 2 42 2 0 2 0 5 0 0 2 4 1 0 0 0 0.86 1.21
8 N -3 1 4 4 -2 -3 -1 -1 0 -2 -5 1 -3 -5 0 2 -2 -6 -4 -5 0 9 24 24 1 0 2 4 2 3 0 7 1 0 5 15 1 0 0 0 0.65 1.26
9 P 1 -3 -1 -4 -4 -4 -4 -2 -1 4 -3 -1 -3 -2 5 0 -2 -5 1 -2 15 1 3 0 0 0 0 3 2 29 0 4 0 1 26 9 1 0 6 0 0.67 1.28
10 G 1 -2 1 -2 -5 0 3 2 0 -3 -1 -2 -4 -5 1 1 -1 -5 -3 -3 10 1 6 1 0 4 24 17 2 1 6 1 0 0 7 11 4 0 1 2 0.36 1.25
11 L -1 -4 2 4 -5 -3 0 -3 -4 -2 3 -3 -3 -2 -2 1 -2 -5 -1 -3 4 0 10 26 0 0 4 1 0 2 34 1 0 1 2 10 2 0 2 0 0.54 1.30
12 G 0 0 2 0 -5 0 1 2 1 -5 -4 0 -4 -5 -3 1 3 -5 -2 -3 8 5 11 6 0 4 11 13 3 0 1 6 0 0 1 10 19 0 1 1 0.35 1.31
13 R -2 3 0 -3 -5 2 3 -4 -3 -5 -3 2 -4 -5 4 1 1 -6 -5 -4 2 17 4 0 0 8 17 0 0 0 3 11 0 0 18 12 7 0 0 1 0.58 1.34
14 K -3 1 4 1 -4 1 2 -4 1 3 -3 2 -4 -2 -4 1 -2 -5 -2 -2 1 8 18 7 0 7 14 0 3 16 1 11 0 2 0 10 1 0 1 2 0.42 1.36
15 L -3 -3 4 0 -5 -1 3 -1 -2 1 1 -2 -3 4 -5 -2 -3 -4 -2 -3 1 1 19 3 0 2 23 6 0 10 14 2 0 16 0 2 0 0 1 0 0.49 1.33
16 S -3 -3 2 4 -5 -1 0 -4 -1 -1 -1 0 0 -1 -2 2 1 -5 -1 1 0 0 10 23 0 2 6 0 1 3 6 6 2 2 2 13 10 0 2 10 0.35 1.34
17 D -3 0 2 4 -5 -2 1 -1 0 0 -3 0 -1 -3 -4 -1 3 -5 -2 0 1 6 10 23 0 1 8 4 3 5 2 5 2 1 0 3 18 0 1 8 0.39 1.33
18 F -1 3 -4 -3 -3 -2 1 -1 1 -1 1 -1 -3 3 1 -1 -2 -4 0 -1 6 20 0 1 1 1 10 5 4 4 15 3 0 11 7 6 1 0 3 3 0.26 1.31
19 G -1 -3 3 1 -5 0 -3 3 0 -4 -2 -2 0 5 -5 -1 -2 -4 -3 -4 4 1 16 8 0 4 1 25 2 1 4 2 3 22 0 3 2 0 0 1 0.56 1.34
20 Q -3 2 5 0 -5 1 0 -2 -1 -1 2 2 -3 -1 -4 -3 -3 -5 -4 -2 1 10 28 5 0 5 5 2 1 4 18 13 0 3 1 0 0 0 0 3 0.48 1.37
21 E 0 -2 -1 1 -4 0 3 -3 -3 0 -3 1 -3 1 -4 1 1 -5 -1 1 6 1 3 7 0 3 21 2 0 6 1 10 0 6 0 10 10 0 2 11 0.27 1.35
22 T 1 -2 -1 -2 -3 -3 -2 1 -4 2 -1 -1 -2 -3 -3 1 4 -4 -3 0 11 1 3 2 0 0 2 11 0 15 4 3 1 1 1 11 26 0 1 7 0.36 1.30
23 S 0 3 -1 0 -4 -2 -2 1 -3 1 -2 -1 -3 -3 -2 3 -1 -4 -4 -1 8 16 3 5 0 1 1 12 0 8 4 4 0 1 2 28 2 0 0 4 0.35 1.28
24 Y -2 -1 -2 -2 -2 0 2 -3 0 1 -2 0 -2 5 -4 -1 -3 -2 5 -2 3 3 1 3 1 4 13 2 2 8 2 6 1 23 0 4 1 0 20 2 0.55 1.30
25 I -2 -1 -1 -2 -3 1 -1 -3 1 3 1 0 -1 -2 0 1 -1 -5 -3 2 3 3 4 3 1 6 3 2 4 17 15 6 1 1 5 10 4 0 1 14 0.19 1.31
26 E 0 -2 -1 1 -4 0 3 -3 -3 -3 -3 2 -1 1 1 0 -3 -2 -4 1 8 2 3 8 0 4 21 1 0 1 2 15 1 6 7 8 1 1 0 11 0.30 1.33
27 D -2 0 0 3 -2 -1 4 -3 -2 0 -3 -1 -3 -3 1 0 0 -5 -4 0 3 5 4 16 1 1 27 2 1 6 3 4 0 1 8 6 6 0 0 6 0.38 1.33
28 N 1 -3 3 2 -5 -1 3 2 1 -5 -4 0 -4 -5 1 0 -1 -5 -4 -2 12 1 12 10 0 2 18 17 4 0 2 5 0 0 7 5 3 0 0 3 0.39 1.33
29 C -1 1 0 -1 2 -1 2 -4 1 -1 -3 2 -3 0 4 0 -2 -2 -4 0 5 8 4 3 4 2 13 1 4 4 1 12 0 5 17 7 2 1 0 7 0.30 1.33
30 N -1 -2 3 3 -3 0 0 -3 0 -4 -4 0 -3 -4 -3 3 3 -5 -3 -3 5 2 12 16 0 4 6 1 3 0 1 5 1 1 1 26 16 0 1 1 0.51 1.33
31 Q -1 -2 0 -1 -4 0 1 5 -3 0 -4 -2 -3 -4 -1 0 -2 -2 0 -1 5 1 4 2 0 4 11 44 0 7 1 2 0 0 3 6 1 0 4 4 0.59 1.28
32 N 0 2 3 2 -1 -1 -1 -2 1 -2 -3 3 -2 -5 0 0 -2 -6 -4 0 6 12 15 13 1 2 2 3 3 2 1 19 1 0 5 6 1 0 0 7 0.36 1.33
33 G 1 -3 -1 5 -1 2 0 0 0 -1 -4 0 -2 -4 -4 -1 -2 -5 0 -2 13 1 2 36 1 9 4 8 2 4 0 6 1 0 0 3 1 0 4 3 0.54 1.28
34 A -2 3 0 -3 -1 0 0 -4 -3 -2 -1 5 -2 -5 -4 -1 0 -5 -4 -1 2 17 5 0 1 4 6 1 0 2 7 39 1 0 0 5 6 0 0 5 0.62 1.31
35 I 1 -4 -3 -4 -4 -1 -3 -4 -4 2 0 -2 1 0 -4 -1 6 -5 -4 0 10 0 1 0 0 3 1 0 0 11 10 2 3 3 0 1 50 0 0 5 0.76 1.33
36 S 2 -3 1 -1 2 -3 -2 -3 -4 -3 -5 -2 -4 -5 -3 5 2 -3 -4 -3 13 1 5 4 4 0 1 0 0 1 0 2 0 0 1 53 12 0 0 1 0.85 1.34
37 L -4 -5 -6 -6 -1 -5 -5 -6 -5 5 4 -5 1 0 -5 -5 -3 -5 -4 3 0 0 0 0 1 0 0 0 0 31 41 0 3 3 0 0 0 0 0 18 1.05 1.36
38 I -1 -2 -4 -5 -2 0 -2 -6 -5 4 3 -4 2 0 -5 -4 -3 -5 -4 3 4 2 1 0 1 4 2 0 0 28 23 0 5 4 0 0 1 0 0 24 0.70 1.36
39 F -3 -5 -6 -6 -1 -5 -6 -6 -5 2 1 -5 1 7 -6 -5 -3 -3 -1 2 1 0 0 0 1 0 0 0 0 10 14 0 3 54 0 0 1 0 0 15 1.28 1.36
40 S 0 1 -3 -3 -2 -2 -2 -2 2 0 -4 -2 -3 -2 -4 5 3 -5 -2 -3 8 6 0 0 1 1 2 2 5 6 0 2 0 1 0 49 15 0 1 1 0.71 1.36
41 L 0 -4 -4 -5 -2 -2 -5 -4 -5 1 4 -4 2 -2 1 -1 1 -5 -4 2 7 0 0 0 1 2 0 1 0 7 42 0 4 1 7 5 10 0 0 12 0.58 1.40
42 K -2 4 1 -1 -3 0 1 -4 2 -4 -4 4 -4 -5 2 0 -1 -6 -4 -3 3 21 8 3 1 3 7 0 5 1 1 25 0 0 9 7 3 0 0 2 0.58 1.39
43 E -3 -1 5 5 -6 -2 2 -4 2 -6 -6 -2 -5 -5 -4 -1 -2 -6 0 -4 1 3 31 36 0 0 11 0 5 0 0 1 0 0 1 3 2 0 4 1 1.06 1.39
44 E -3 3 0 -2 -6 2 3 1 -1 -5 -5 4 -3 -5 -2 -1 -3 -5 1 -3 1 16 4 1 0 9 20 10 1 0 0 24 0 0 2 4 1 0 5 2 0.59 1.40
45 V 1 -4 -5 -5 2 -3 -4 -5 -5 1 -2 -1 3 -2 5 -1 0 -1 -2 3 10 0 0 0 4 1 0 0 0 7 2 3 7 1 28 5 7 1 1 23 0.67 1.38
46 G -2 -4 1 -3 -5 -1 -2 6 -4 -4 -6 -3 -5 -6 0 0 -1 -5 -5 -5 1 0 7 1 0 3 3 69 0 1 0 0 0 0 5 5 4 0 0 0 1.29 1.36
47 A 4 -2 -1 -1 -1 -3 -1 1 -3 -2 -4 -3 -2 0 -1 3 0 -5 -4 -2 40 1 2 3 1 0 4 9 0 2 1 0 1 4 3 23 5 0 0 2 0.57 1.36
48 L -4 -5 -6 -6 -4 -5 -6 -6 -6 0 6 -5 2 0 -6 -5 -4 -4 -4 0 1 0 0 0 0 0 0 0 0 4 83 0 4 2 0 0 0 0 0 6 1.41 1.38
49 A 3 -1 -4 -4 1 -2 -2 -1 3 -2 -2 -1 -2 1 -2 2 -1 -4 4 1 21 3 0 0 3 1 2 3 8 1 3 4 1 5 2 19 2 0 14 9 0.39 1.38
50 K -2 4 2 2 -5 0 2 -4 2 -5 -5 3 1 -5 -4 0 -1 -6 -4 -5 2 24 9 10 0 4 13 0 5 0 0 18 3 0 0 7 3 0 0 0 0.63 1.38
51 V 3 -5 -4 -5 -1 -5 -5 -5 -5 4 2 -5 2 -2 -5 -2 0 -5 -2 2 25 0 1 0 1 0 0 0 0 27 19 0 4 1 0 2 5 0 2 14 0.66 1.39
52 L -2 -5 -6 -6 -1 -5 -6 -4 -6 1 6 -5 0 -1 -6 -5 -4 -4 -2 -1 3 0 0 0 1 0 0 1 0 6 84 0 1 2 0 0 0 0 1 2 1.36 1.39
53 R 1 2 0 0 -3 2 2 -1 -3 -5 -5 4 -2 -6 -4 1 -1 -6 -3 -3 12 9 5 4 0 7 12 3 0 0 0 31 1 0 0 9 2 0 1 2 0.52 1.39
54 L -1 -5 1 -4 -3 -4 -1 -5 -2 3 1 -3 -1 -3 4 -1 0 -3 -1 3 5 0 6 0 0 0 4 0 1 17 12 1 1 0 20 5 5 0 2 21 0.50 1.41
55 F -5 -5 -6 -6 -5 -6 -6 -6 -4 1 1 -5 1 8 -6 -5 -5 -2 1 -2 0 0 0 0 0 0 0 0 0 9 14 1 3 70 0 0 0 0 2 2 1.71 1.41
56 E 2 0 -2 0 -5 2 3 -3 1 -4 -5 3 -4 -4 -2 1 -1 -1 -2 -5 17 4 1 5 0 11 23 1 3 1 0 16 0 1 1 12 2 1 1 0 0.52 1.42
57 E -1 2 1 2 -5 0 3 -4 -3 -2 -3 2 -1 -6 -1 0 2 -6 -5 -4 4 11 7 13 0 3 19 0 0 2 2 14 2 0 3 7 13 0 0 0 0.45 1.41
58 N 0 2 2 -4 -2 -2 -1 -4 7 -5 -2 1 -3 3 -5 -2 -3 -1 3 -5 8 10 10 0 1 1 5 0 26 0 5 8 0 14 0 1 1 1 10 0 0.73 1.41
59 D -3 -1 2 2 -4 0 1 4 4 -6 -6 2 -5 -6 -4 -1 -4 -6 -3 -6 1 3 10 11 0 3 10 32 9 0 0 15 0 0 0 4 0 0 1 0 0.70 1.40
60 V 0 -5 -5 -6 -4 -5 -5 -1 -6 6 -1 -5 -2 -3 -5 -4 -1 -6 -4 4 8 0 0 0 0 0 0 6 0 43 3 0 0 0 0 0 3 0 0 35 1.03 1.41
61 N -3 -1 7 0 0 0 -1 -3 -1 -4 -6 1 -5 -6 -2 2 0 -6 -5 -5 1 3 51 4 2 4 2 1 1 1 0 9 0 0 2 16 4 0 0 0 1.04 1.44
62 L -4 -5 -6 -6 -4 -5 -6 -6 -6 3 5 -5 5 -3 -6 -5 -3 -5 -4 2 0 0 0 0 0 0 0 0 0 18 49 0 17 0 0 0 1 0 0 15 1.16 1.44
63 T -2 -2 -1 -4 3 0 -3 -4 2 0 1 -2 -1 -4 -5 2 5 -5 -2 0 1 1 3 0 6 3 1 1 6 4 13 2 1 0 0 15 36 0 1 6 0.58 1.49
64 H -4 3 -2 -1 -6 0 -1 -5 9 -2 -4 2 -2 -2 -5 -3 -4 -1 -1 -5 0 14 1 4 0 4 4 0 52 3 1 13 1 2 0 1 0 1 1 0 1.43 1.49
65 I -4 -6 -6 -6 -4 -6 -6 -7 -6 6 2 -6 0 1 -6 -5 -4 -5 -4 3 0 0 0 0 0 0 0 0 0 58 21 0 1 4 0 0 0 0 0 17 1.34 1.49
66 E -2 -1 -3 1 -6 0 7 -5 -3 -6 -6 -2 -5 -6 -4 1 -4 -6 -5 -5 3 2 0 5 0 3 79 0 0 0 0 0 0 0 0 8 0 0 0 0 1.62 1.53
67 S -2 -1 2 -3 -4 -3 -3 -4 -4 -3 -2 -2 -4 -5 -2 6 4 -6 -5 -4 0 3 8 0 0 0 0 0 0 1 5 1 0 0 2 58 22 0 0 0 1.06 1.56
68 R -4 8 -2 -4 -6 -2 -2 -5 -3 -2 -3 1 -1 -4 -5 -1 -4 -5 -4 -5 0 82 1 0 0 0 1 0 0 3 2 5 1 1 0 3 0 0 0 0 1.79 1.56
69 P -3 -2 -4 -2 -2 -2 -3 -3 -4 -4 0 2 -4 -5 7 -1 -2 -5 -5 -3 1 2 0 2 1 2 1 2 0 0 9 13 0 0 58 5 1 0 0 1 1.37 1.50
70 S 1 -1 0 -2 -1 -2 -2 -3 -4 -3 0 -3 -2 0 -2 5 -1 -5 -4 -2 12 3 5 1 1 1 1 1 0 1 9 0 1 4 1 52 3 0 0 3 0.69 1.50
71 R -1 4 2 -3 -5 2 0 -3 0 -5 -2 4 -4 -5 1 -2 -2 -5 -4 -3 4 27 10 1 0 8 6 2 2 0 5 24 0 0 7 2 2 0 0 1 0.64 1.49
72 L 0 4 0 -1 -3 0 -1 -2 -1 -2 -1 3 0 -1 -3 0 0 2 -1 -2 7 21 4 3 0 3 4 2 1 2 7 17 3 2 1 7 6 3 3 3 0.28 1.52
73 K -1 2 1 -1 -2 -1 1 2 0 -1 -2 2 0 0 -1 0 0 -5 -4 -2 5 9 6 3 1 2 11 16 2 3 4 13 3 4 3 8 5 0 0 2 0.19 1.50
74 K 0 0 2 1 0 -2 -3 1 -2 -3 -1 3 -2 -4 2 1 0 -5 -4 -3 8 6 11 8 2 1 1 10 1 1 7 16 1 1 10 9 7 0 0 1 0.27 1.50
75 D -2 -2 1 2 -5 -2 0 2 -2 -3 -3 1 -3 -2 -1 0 -2 8 0 0 2 2 8 10 0 1 6 14 1 1 2 8 1 1 3 7 2 20 4 8 0.59 1.50
76 E -1 -1 1 2 -3 3 4 -1 0 -5 -4 0 -2 -5 -3 1 0 -5 -3 -2 5 2 5 10 1 13 28 4 2 0 1 6 1 0 1 11 7 0 1 3 0.49 1.48
77 Y -1 -4 -3 -2 -5 0 -4 -5 3 -2 1 -4 1 3 -2 -1 -4 -2 7 -1 5 0 1 3 0 5 0 0 7 1 11 0 3 9 3 4 0 0 43 4 0.96 1.53
78 E -2 -1 1 3 1 -1 4 -4 -2 0 0 -2 -1 -2 -4 -2 -2 -5 -1 1 3 3 6 19 3 2 27 1 1 7 8 1 1 2 0 2 2 0 2 9 0.43 1.53
79 F -2 -2 -5 -5 1 -4 -5 -5 -4 2 -1 -4 1 7 -5 -4 -1 -3 2 2 3 3 0 0 3 0 0 0 0 11 4 0 3 45 0 0 4 0 5 16 0.97 1.33
80 F -4 -4 -5 -5 -4 -4 -5 -5 1 0 2 -4 3 6 -5 -2 0 3 4 -1 0 0 0 0 0 0 0 0 3 5 17 0 7 35 0 2 6 3 14 4 0.90 1.33
81 T -2 -2 -1 -5 -4 -4 -4 -5 -5 4 1 -4 1 0 -5 -4 0 -5 -3 5 3 2 4 0 0 0 0 0 0 23 11 0 3 3 0 0 5 0 0 43 0.79 1.33
82 H -2 1 0 5 -5 0 1 -1 0 -2 -5 1 -4 -1 -4 0 0 -5 -1 -2 2 8 4 36 0 3 10 4 2 2 1 10 0 3 0 5 5 0 2 2 0.57 1.33
83 L -2 -5 -5 -5 7 -4 -5 -5 -4 2 2 -5 1 3 -5 -2 -3 -4 -1 2 2 0 0 0 27 0 0 0 0 11 21 0 4 14 0 2 0 0 2 13 0.92 1.32
84 D -1 -1 -1 4 -5 0 5 -4 -2 0 -3 -1 -2 -3 -1 0 0 -5 -3 -3 4 3 2 21 0 2 37 0 1 5 2 2 1 1 3 6 6 0 1 2 0.61 1.33
85 K 0 -2 -1 -3 3 -2 -2 4 -4 -1 -2 1 2 1 1 -2 -2 -4 -4 1 7 1 3 1 7 2 2 29 0 3 2 8 5 7 7 2 2 0 0 10 0.37 1.31
86 R -2 1 2 1 -4 -1 2 -2 7 -2 -3 0 -4 -4 0 -1 1 -5 -3 -2 3 8 10 7 0 2 12 3 25 2 3 6 0 0 5 3 7 0 0 3 0.54 1.29
87 S -1 2 0 0 -1 0 3 1 1 -4 -4 1 -3 -5 -2 3 -1 -5 -4 -3 3 11 4 6 1 3 17 9 3 1 2 7 1 0 2 25 4 0 0 2 0.38 1.46
88 L -1 0 1 4 0 0 0 -2 -2 -1 0 1 -1 0 -4 0 0 -4 0 -1 4 6 5 21 2 3 6 2 1 4 11 8 2 4 1 7 5 0 3 5 0.18 1.36
89 P -1 -1 1 2 -4 2 3 0 0 -1 -4 0 -1 -4 2 0 -3 2 -1 -2 5 4 6 12 0 8 21 8 2 4 1 4 2 0 10 6 1 3 2 2 0.32 1.38
90 A 0 1 3 1 -4 1 2 -4 -1 -1 -2 2 -1 -3 0 -1 -1 -5 -4 0 8 7 15 7 0 6 12 1 1 5 4 14 1 1 4 3 4 0 0 6 0.26 1.43
91 L -3 -4 -2 -3 -2 -3 -5 -4 -5 2 4 -3 1 0 -5 -1 -2 -4 -1 3 2 1 2 2 1 1 0 1 0 11 40 1 3 4 0 6 2 0 2 21 0.62 1.59
92 T 0 0 2 1 -5 1 1 -1 1 1 0 2 1 -4 -2 0 -2 -5 -3 0 9 5 8 6 0 5 7 4 3 7 10 11 3 1 2 7 2 0 1 6 0.12 1.59
93 N 1 1 2 2 -2 3 2 -2 0 -4 -2 1 -3 -5 -3 0 -1 -5 -4 -4 11 6 9 10 1 16 15 2 2 1 4 10 1 0 1 7 4 0 0 1 0.38 1.59
94 I 3 -4 -3 -5 -2 -4 -2 -3 -2 2 2 -1 0 -2 -5 -1 -1 -5 -2 2 28 0 1 0 1 0 3 2 1 12 21 3 2 1 0 5 3 0 2 15 0.44 1.62
95 I -2 -4 -3 -5 0 -1 -2 -5 -5 4 3 -2 1 0 -5 -3 -1 -5 -2 1 4 1 2 0 2 2 3 1 0 26 33 3 3 3 0 1 4 0 1 10 0.60 1.62
96 K -1 1 -1 1 -1 1 3 -2 -1 -3 -1 3 -3 -3 -2 0 -1 -5 -3 -4 6 8 3 7 1 7 20 3 1 1 8 20 0 1 2 6 3 0 1 1 0.35 1.62
97 I 0 0 0 1 0 -1 2 -2 -1 -1 1 -1 2 -1 -4 2 -2 -5 -1 -2 9 6 5 7 2 2 15 3 1 3 15 4 4 2 0 15 2 0 2 2 0.19 1.59
98 L -2 -2 -3 -2 -4 -1 -3 -6 -2 1 5 -2 2 1 -5 -4 -2 -5 -4 1 3 3 1 2 0 3 1 0 1 6 56 3 4 5 0 0 2 0 0 9 0.76 1.62
99 R -1 4 -1 -1 -2 2 0 -1 -4 1 -1 3 0 -5 -4 0 -1 -5 -4 -1 4 20 2 3 1 10 5 5 0 7 5 21 2 0 0 6 4 0 0 5 0.39 1.60
100 H -1 2 2 1 -5 3 3 -1 2 -4 -4 1 -4 -5 -2 0 0 -5 -3 -4 4 12 8 7 0 12 21 4 5 1 1 7 0 0 1 7 6 0 1 1 0.44 1.58
101 D -3 2 1 2 0 2 2 -2 4 0 -2 1 -3 -3 -3 1 -1 -4 0 -3 1 11 7 10 2 8 12 3 9 6 4 8 0 1 1 9 4 0 4 1 0.28 1.53
102 I 1 -4 -2 -2 4 -3 -2 -3 1 1 0 -4 -3 0 -2 0 1 -2 -1 3 14 1 2 2 10 1 2 2 3 8 8 1 0 4 2 6 9 1 2 24 0.35 1.52
103 G 2 0 -1 0 1 1 -2 1 0 0 -2 0 -1 -4 -1 3 1 -4 -4 -2 15 6 3 4 3 6 1 10 2 5 5 6 1 0 3 20 7 0 0 3 0.20 1.52
104 A 1 -2 -1 -1 -4 -1 0 -2 -4 -2 -1 -2 2 4 -1 3 -1 -2 0 -1 11 2 2 4 0 2 5 3 0 2 6 2 5 20 4 21 4 1 3 4 0.31 1.56
105 T -2 -1 0 -2 -4 -2 -3 -1 0 0 0 -1 0 2 -1 0 2 -3 4 2 3 3 5 2 0 1 1 5 2 5 8 4 2 7 4 6 13 0 13 16 0.23 1.56
106 V -2 0 0 -1 2 -1 -2 -3 -4 0 0 3 -1 2 1 -2 -1 -2 -3 2 2 5 4 3 5 3 3 2 0 6 10 18 1 9 6 2 3 1 0 17 0.26 1.61
107 H -2 0 3 -1 -1 -1 -1 -3 3 0 -1 2 -1 -2 -2 0 -1 -5 -1 3 4 5 12 3 1 3 4 2 8 5 5 12 1 2 2 6 3 0 2 21 0.26 1.60
108 E -1 -4 -2 -1 -4 -2 2 -4 -3 3 3 -2 -2 0 -5 -2 -1 -5 -3 1 6 0 2 4 0 1 14 1 1 15 32 2 0 3 0 3 4 0 1 9 0.42 1.66
109 L -2 -3 -1 0 -4 -1 -2 3 -4 1 2 -1 -1 -1 -1 -1 0 3 -4 -1 3 1 3 5 0 3 2 21 0 7 23 5 1 3 3 3 7 4 0 5 0.27 1.67
110 S -1 -1 1 0 -5 0 -1 0 -4 0 -2 1 1 -5 1 2 1 -5 0 1 5 4 7 5 0 5 4 9 0 6 4 8 3 0 7 13 8 0 3 10 0.13 1.86
111 R -2 1 1 0 -5 1 1 -1 1 -1 -2 1 1 0 -1 0 0 3 2 -1 3 6 7 6 0 6 9 4 3 4 4 10 3 4 3 8 5 4 6 4 0.14 1.83
112 D -1 -4 3 2 -5 0 3 -2 1 -2 -2 0 -4 -1 1 0 0 -5 2 -2 5 0 12 11 0 3 17 3 3 3 4 5 0 2 8 7 7 0 6 3 0.27 1.78
113 K -1 0 1 0 3 1 0 -1 2 0 -1 0 2 1 0 0 0 -5 1 -4 6 6 5 6 5 5 6 6 5 6 6 6 5 5 6 6 6 0 5 0 0.11 1.89
114 K 0 0 0 2 1 0 0 1 -4 0 -2 3 1 -5 0 1 0 -5 -5 0 6 4 4 10 3 4 6 11 0 5 4 15 3 0 4 10 4 0 0 6 0.18 1.80
115 K 0 -4 1 0 -5 1 0 0 3 0 -1 0 2 1 -4 0 0 -4 2 0 6 0 6 6 0 6 6 6 6 6 6 6 6 6 0 6 6 0 6 6 0.13 1.67
116 D -1 0 1 0 3 1 0 -1 2 0 -4 0 -4 1 0 0 0 4 -4 0 6 6 6 6 6 6 6 6 6 6 1 6 0 6 6 6 6 6 0 6 0.17 1.78
117 T 0 0 1 0 3 1 0 0 -4 0 -1 0 2 -4 -4 0 0 -5 1 0 6 6 6 6 6 6 6 6 0 6 6 6 6 0 0 6 6 0 6 6 0.13 1.67
118 V 0 -4 0 0 -4 0 -1 -1 2 1 -1 -1 2 0 -4 -1 0 -5 -4 4 6 0 4 6 0 4 4 6 5 9 4 4 5 4 0 6 5 0 0 27 0.28 1.63
119 P 1 -1 -2 -2 -3 -1 2 -1 1 0 -2 -2 -3 -3 6 -1 -1 -4 -3 -1 11 3 1 1 0 2 15 4 4 7 3 1 0 1 39 3 3 0 0 3 0.69 0.70
120 W -3 -3 -3 -1 -3 -3 -3 -3 -3 0 -3 -3 -2 -1 -3 0 2 11 0 -3 1 1 1 4 0 1 1 1 0 8 1 1 0 1 1 10 14 54 0 1 1.66 0.71
121 F 1 1 -3 -3 -3 -3 -3 -3 -2 -1 -2 -3 -2 6 -3 0 0 -1 3 -2 14 8 1 1 0 1 1 1 0 3 1 1 0 48 1 6 6 0 7 1 0.73 0.71
122 P -2 -2 -3 -3 -4 -2 -2 -3 -3 -4 -4 2 -3 -4 8 -2 -2 -4 -4 -3 1 1 1 1 0 1 1 1 0 1 1 14 0 1 75 1 1 0 0 1 1.81 0.71
123 R -3 1 1 -3 4 2 1 0 3 -4 0 1 3 -5 1 -3 1 -5 -4 -4 0 8 8 0 8 8 8 8 8 0 8 8 8 0 8 0 8 0 0 0 0.37 1.22
124 T -3 2 0 2 -1 0 0 -4 5 -5 -4 4 1 -5 -4 2 -1 -5 -2 -3 0 10 4 10 2 2 4 0 14 0 0 29 5 0 0 15 4 0 1 1 0.58 1.04
125 I 0 -2 -4 1 -4 -4 -1 -5 -5 6 0 -4 -2 -3 0 -2 -3 -5 -4 2 9 3 0 9 0 0 3 0 0 51 5 0 0 0 4 3 0 0 0 12 0.72 1.04
126 Q 1 2 1 -3 -2 0 1 -1 1 -4 -4 0 -4 2 -4 3 -1 -4 0 -4 10 10 8 0 1 5 8 5 3 0 0 6 0 12 0 29 3 0 2 0 0.39 1.04
127 E -4 0 -1 6 -6 1 4 0 4 -6 -6 -2 -5 -5 -4 -2 -3 -6 -4 -5 0 5 0 49 0 5 25 6 10 0 0 0 0 0 0 0 0 0 0 0 1.13 0.98
128 L -1 -4 -5 -5 -3 -4 -5 -5 -5 0 5 -4 -1 1 -5 -1 1 2 -3 0 4 0 0 0 0 0 0 0 0 4 68 0 0 4 0 5 8 3 0 5 0.87 0.98
129 D -3 -3 0 7 -5 3 1 -4 -3 -5 -6 1 -5 -6 -4 0 -3 -6 -5 -5 0 0 3 64 0 14 4 0 0 0 0 7 0 0 0 8 0 0 0 0 1.29 0.98
130 R -3 3 0 -1 -4 1 0 -3 1 -2 -1 3 -3 -1 0 0 0 -4 2 0 0 14 3 2 0 7 4 1 4 1 7 24 0 2 5 6 5 0 7 8 0.29 0.96
131 F -3 -4 -4 -4 7 -4 -4 -4 -4 2 1 -4 -2 2 -4 1 0 -3 1 0 1 0 0 0 29 0 0 1 0 14 12 0 0 11 0 12 6 0 6 7 0.77 1.03
132 A 0 1 1 1 4 1 -3 0 3 -4 -4 -3 -3 -3 -4 0 1 -4 2 0 8 8 8 8 8 8 0 8 8 0 1 0 0 0 0 8 8 0 8 8 0.30 1.23
133 N -2 -1 4 1 -2 2 0 1 7 -6 -5 -1 -1 -5 1 -1 -3 -5 -3 -5 2 3 18 8 1 12 5 11 25 0 0 4 1 0 6 3 1 0 0 0 0.72 1.21
134 Q -3 2 -1 -1 2 2 2 -5 3 -3 2 -1 -2 -4 -4 -1 0 -5 -4 1 0 13 2 3 4 11 16 0 8 0 23 3 0 0 0 3 5 0 0 9 0.38 1.15
135 I 0 -4 -1 -5 0 -4 -4 -5 2 4 2 -2 2 -3 -5 -3 1 -5 -4 4 8 0 4 0 2 0 0 0 5 21 16 2 6 0 0 0 7 0 0 29 0.57 1.13
136 L -3 1 -4 -1 -4 -3 -2 -1 -4 0 3 -3 5 -3 -5 -1 3 -5 -4 -1 0 7 0 5 0 0 3 6 0 3 30 0 18 0 0 3 23 0 0 3 0.58 1.19
137 S 0 0 0 0 -5 0 1 -2 2 -1 -2 3 4 -5 -4 2 -1 -5 -4 -1 7 5 5 4 0 4 11 2 5 4 3 22 11 0 0 13 2 0 0 3 0.34 1.26
138 Y 0 1 0 -4 -4 -3 -4 -5 2 0 -1 -3 2 3 -5 0 0 -3 4 2 7 9 4 0 0 0 0 0 4 4 4 0 6 14 0 9 5 0 13 19 0.39 1.11
139 G -3 -3 2 2 -4 2 1 1 -3 1 -4 1 -3 -5 -4 1 1 -5 -4 1 0 0 10 10 0 10 10 10 0 10 0 10 0 0 0 10 10 0 0 10 0.30 1.00
140 A 2 -2 -2 -2 -4 -3 1 0 -4 -1 -4 -2 -4 -5 5 1 -1 -6 -5 -1 22 1 1 2 0 0 9 7 0 5 0 2 0 0 32 13 2 0 0 4 0.71 1.18
141 E 1 -3 1 4 -5 1 4 -3 4 -5 -5 -3 -4 -5 -4 -1 1 -6 -4 -3 14 0 5 21 0 5 28 2 11 0 0 0 0 0 0 3 10 0 0 2 0.70 1.17
142 L -1 -4 1 -4 -4 0 -4 -5 -4 -2 3 -2 0 0 4 -2 2 -5 -4 -3 4 0 7 0 0 4 0 0 0 0 36 1 2 4 19 3 13 0 0 0 0.49 1.17
143 D 0 2 1 4 2 2 -1 -4 -3 -5 -5 -2 -1 -5 -4 2 0 -5 -5 -4 6 11 7 29 4 9 3 0 0 0 0 0 2 0 0 14 7 0 0 0 0.50 1.22
144 A 1 -2 -3 1 1 0 2 -4 1 0 0 0 3 -4 0 0 0 -5 -4 -2 12 2 0 7 3 5 12 0 3 7 9 6 8 0 5 7 4 0 0 1 0.11 1.22
145 D 1 2 -1 3 -4 1 -1 -2 -3 1 0 -1 -3 0 -4 -1 -3 -4 -1 -3 12 13 3 19 0 8 3 2 0 9 8 4 0 4 0 3 0 0 2 0 0.19 1.11
146 H -3 2 -3 2 -4 0 -2 -4 5 -4 -1 -2 -3 2 3 1 -3 -3 3 -4 0 11 0 11 0 5 0 0 13 0 5 0 0 8 14 12 0 0 11 0 0.39 0.94
147 P 1 -3 -3 -3 -4 2 1 1 -3 -2 0 -3 -2 -4 2 -2 1 -4 -4 1 11 0 0 0 0 11 11 11 0 0 11 0 0 0 11 0 11 0 0 11 0.19 0.89
148 G 1 -3 -2 0 0 -1 1 6 -3 -5 -4 -1 -4 -5 -3 -2 0 -4 -4 -4 9 0 0 5 2 3 9 56 0 0 1 4 0 0 0 1 6 0 0 1 0.88 1.01
149 F 0 -1 -4 -4 -4 -3 -2 -4 0 -1 -1 -1 5 6 -4 -3 -3 -2 3 -1 7 3 0 0 0 0 3 1 2 2 4 4 19 41 0 1 0 0 8 4 0.86 1.04
150 K 1 -1 0 -2 -4 -1 -2 0 3 -4 -3 3 -3 -4 3 2 2 -4 -3 -3 11 2 3 2 0 3 0 6 7 0 2 17 0 0 15 14 16 0 0 0 0.42 1.04
151 D 0 -4 0 6 -4 -3 0 1 -3 -4 -3 -3 -4 -5 0 -2 1 -5 -4 -4 6 0 3 57 0 0 3 11 0 0 2 0 0 0 4 0 11 0 0 0 1.00 1.04
152 P 0 -1 0 1 -4 1 1 -1 -2 0 -1 1 -1 -4 2 -1 2 -5 -4 1 7 2 5 7 0 7 9 4 1 4 5 8 1 0 12 2 13 0 0 13 0.20 1.04
153 V 1 -4 -1 -2 -4 -2 2 -4 -4 0 -1 -2 0 -2 -4 0 0 -5 -4 4 15 0 3 2 0 1 13 0 0 4 4 1 2 1 0 7 6 0 0 41 0.48 1.05
154 Y -3 -3 -3 -4 -4 2 -3 -4 -2 -4 -3 -3 -3 3 -4 1 3 -1 7 -3 0 0 0 0 0 13 0 0 0 0 0 0 0 10 0 11 22 0 44 0 1.07 1.02
155 R 1 5 -2 -1 -5 0 -3 -2 -3 -1 -4 0 -1 -5 2 -3 1 4 -4 -2 14 37 2 3 0 3 0 3 0 4 0 5 2 0 9 0 11 6 0 2 0.63 1.18
156 A 1 0 -2 -1 3 2 2 -4 -3 -3 -3 5 0 -5 2 -1 -2 -5 -4 -2 11 4 1 2 6 7 13 0 0 1 2 36 2 0 8 2 2 0 0 2 0.56 1.18
157 R -3 6 2 -3 -5 1 -2 -4 -3 -4 1 2 -3 -5 2 -1 -3 -5 -4 -4 0 45 11 0 0 5 0 0 0 0 14 9 0 0 11 5 0 0 0 0 0.82 1.00
158 R -3 6 -3 0 -4 1 -2 -4 -3 -3 -1 1 2 -4 -4 -3 0 -4 -3 0 1 50 0 6 0 6 1 1 0 0 7 7 6 0 0 1 6 0 0 7 0.80 1.06
159 K 0 1 1 1 -4 1 1 0 -3 -4 -4 1 3 -4 -4 0 1 -4 2 0 8 8 7 8 0 7 8 8 0 0 1 8 7 0 0 8 8 0 7 8 0.22 1.34
160 Q -2 0 -3 2 -5 3 2 -4 2 0 -2 -1 1 0 -4 0 -2 1 3 -1 4 4 0 14 0 13 14 1 5 6 2 3 4 4 0 8 1 2 12 3 0.36 1.46
161 F -4 -5 0 -5 -4 -4 -5 -2 0 4 0 -4 -2 5 1 -4 -4 3 4 -1 0 0 6 0 0 0 0 3 3 29 8 0 0 21 8 0 0 3 13 3 0.75 1.45
162 A 4 -4 -1 0 0 1 -2 -2 -4 -4 -2 -3 -1 -1 -2 2 1 -5 -4 0 42 0 3 5 2 6 2 3 0 0 3 0 1 3 2 14 7 0 0 6 0.54 1.56
163 D 0 2 0 3 -5 2 2 -2 5 -5 -3 0 0 -5 0 -1 -1 -5 -4 -3 6 10 3 18 0 9 15 3 13 0 3 5 2 0 4 3 4 0 0 2 0.45 1.60
164 I 0 -1 -4 -2 1 0 -4 -5 -5 3 2 -1 1 -1 -1 -1 3 -5 -4 1 8 4 0 3 3 4 0 0 0 14 20 4 3 3 3 4 18 0 0 9 0.33 1.61
165 A 4 1 0 0 -4 0 -1 0 1 -5 -2 0 -4 -5 1 0 0 -5 -4 -4 36 8 5 5 0 5 4 6 4 0 4 4 0 0 7 7 5 0 0 0 0.43 1.64
166 Y -1 0 1 0 -5 1 0 -1 2 0 -1 0 2 1 0 0 0 -5 1 0 6 6 5 6 0 5 6 6 5 6 6 6 5 5 6 6 6 0 5 6 0.08 1.89
167 N -1 0 2 2 -5 1 -1 -1 3 -2 0 1 -4 2 -1 -1 -1 -5 -1 0 5 6 9 13 0 5 3 4 7 2 11 9 0 8 3 4 4 0 2 6 0.18 1.75
168 Y 1 -2 -4 -5 0 -1 -4 -5 4 -4 -2 -1 -4 1 0 -1 -4 4 6 1 12 2 0 0 2 3 0 0 10 0 3 4 0 6 6 4 0 6 30 10 0.76 1.75
169 R -2 4 0 -1 -5 0 -3 -2 2 -1 -2 3 1 -5 -1 -1 2 -5 0 -1 4 19 3 4 0 4 0 4 6 4 5 17 3 0 4 4 12 0 3 4 0.34 1.89
170 H -1 0 0 0 2 0 0 -1 2 0 -1 0 2 1 0 -1 0 4 1 -1 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 0.09 2.12
171 G 0 -3 1 1 -4 1 0 0 3 0 -4 0 2 -4 1 0 0 4 -4 0 7 0 7 7 0 7 7 7 6 7 1 7 6 0 7 7 7 6 0 7 0.23 1.56
172 Q -3 -1 1 5 0 4 1 -2 -1 -2 -3 0 -1 -5 -4 0 -1 -5 -5 0 2 3 5 28 2 21 7 2 1 2 2 5 1 0 0 7 3 0 0 7 0.58 1.60
173 P 0 -1 -2 1 -5 1 1 -2 0 -2 -3 0 -4 -5 6 0 -1 -5 -5 -3 9 3 2 6 0 7 10 3 3 2 2 5 0 0 39 5 3 0 0 2 0.77 1.58
174 I -3 -1 0 0 -4 4 -1 -2 1 4 0 -1 1 -4 0 -2 -1 -5 -4 0 1 3 4 5 0 21 4 3 3 22 9 3 4 0 4 3 3 0 0 7 0.39 1.56
175 P -1 -2 0 0 -5 -1 -1 4 2 -5 -5 -1 -4 -1 5 -3 -2 -5 -4 -2 5 3 4 4 0 3 4 28 4 0 1 3 0 3 29 0 3 0 0 3 0.70 1.60
176 R -4 0 1 0 3 1 0 -5 2 0 -1 0 2 1 -5 0 0 4 2 0 0 6 6 6 6 6 6 0 6 6 6 6 6 6 0 6 6 6 6 6 0.23 1.78
177 V -1 -2 -2 0 -3 -2 0 -4 -1 4 -1 -3 -1 -3 -2 -2 -1 -4 -1 4 5 2 2 6 0 2 7 1 1 27 3 1 1 0 2 2 3 0 2 31 0.54 1.30
178 E 0 -1 0 2 -4 0 4 -2 2 -2 -2 -1 -3 -4 -1 -1 0 -4 -3 -2 7 3 4 13 0 4 34 3 6 2 4 3 0 1 3 3 7 0 0 3 0.45 1.12
179 Y -4 -3 -4 -4 -4 -3 -4 -4 3 -3 -3 -4 -3 3 -4 -3 -3 8 8 -3 1 1 1 1 0 0 1 1 7 1 1 1 0 9 1 1 1 18 56 1 1.70 1.05
180 M -1 -4 0 0 2 -3 -3 0 -4 -4 -2 -1 1 0 1 3 4 -5 -4 -3 5 0 4 5 4 0 0 8 0 0 5 4 4 4 6 21 29 0 0 0 0.47 1.45
181 E 0 -1 0 2 -5 1 3 -1 1 -1 -2 0 -4 -4 2 -1 -1 -5 0 -2 7 4 3 10 0 7 23 4 3 3 4 7 0 0 9 5 4 0 3 3 0.29 1.45
182 E 1 -1 -1 1 -1 2 5 -2 -1 -1 -4 -2 -3 -4 -2 0 0 -1 -4 0 11 3 2 7 1 10 35 2 1 5 1 1 0 0 2 6 6 1 0 6 0.46 1.17
183 E -3 -2 1 3 -5 1 6 -3 -2 -4 -4 -2 -4 -4 -3 -2 -3 -4 -4 -4 1 1 8 18 0 4 61 1 0 1 1 1 0 0 1 1 1 0 0 1 1.15 1.04
184 K -3 -1 2 0 -4 2 -1 -3 7 1 -2 0 -3 -1 -3 -2 0 -4 -2 -1 1 2 10 4 0 8 3 1 35 9 3 6 0 2 1 1 7 0 0 5 0.71 1.04
185 K 3 0 0 2 -1 0 2 -1 -1 -3 -3 1 -1 -4 -3 -1 -1 4 -3 -2 25 4 5 10 1 4 15 3 2 2 2 10 2 0 1 3 2 5 0 2 0.34 1.18
186 T -1 -1 -3 -4 -3 -3 -3 -4 -4 3 1 -3 1 -3 -4 -2 5 -4 -3 2 4 4 0 1 0 0 1 1 0 17 10 1 4 0 1 1 39 0 0 17 0.68 1.18
187 W -4 0 -5 -5 -4 -4 -4 -4 -4 -4 -3 -4 -3 1 -5 -4 -4 12 2 -4 1 5 0 1 0 0 1 1 0 1 1 1 0 5 1 1 1 76 6 1 2.92 1.18
188 G -1 3 0 1 -5 1 -1 2 3 -1 -4 1 1 -4 -4 0 -1 -5 0 -4 5 18 4 7 0 7 4 19 6 4 1 8 4 0 0 6 4 0 4 0 0.37 1.62
189 T 0 3 -1 1 2 1 1 -4 1 0 -1 -1 1 0 -4 -1 2 -5 0 0 6 14 3 7 4 5 8 0 4 6 6 4 3 3 0 3 14 0 4 6 0.19 1.62
190 V -1 -5 -5 -5 2 -4 -5 -5 -5 2 3 -5 -2 -3 -2 -4 -3 -5 -4 5 4 0 0 0 5 0 0 0 0 8 29 0 0 0 2 0 0 0 0 47 0.91 1.36
191 F -2 -4 -5 -5 0 -4 -5 -5 1 0 0 -5 4 5 -5 -2 -2 4 6 0 2 0 0 0 2 0 0 0 4 4 7 0 11 24 0 3 3 5 27 6 0.94 1.48
192 K 0 4 1 1 -5 0 2 -1 0 -3 -3 0 -4 -5 -1 0 1 -5 -4 -2 8 25 7 7 0 4 12 5 2 1 3 5 0 0 3 6 10 0 0 3 0.37 1.48
193 T -2 5 0 -2 -1 2 2 -4 -1 -2 -2 2 -1 -5 -4 0 1 -5 -4 -3 2 28 5 2 1 7 14 0 2 3 5 13 1 0 0 6 9 0 0 2 0.52 1.48
194 L -4 1 1 -4 -5 5 -3 -5 1 0 3 -3 2 -4 -5 -1 -1 -5 -4 -1 0 8 8 0 0 26 0 0 4 4 33 0 4 0 0 3 3 0 0 5 0.68 1.56
195 K 0 0 -1 -4 0 1 -1 -3 3 -1 0 2 3 -1 -5 0 1 1 -1 1 7 5 3 0 2 5 3 2 7 2 11 14 6 2 0 6 8 2 2 12 0.20 1.56
196 S -1 0 1 0 3 1 0 -1 2 0 -1 0 2 -5 1 0 0 -6 -5 0 6 6 6 6 6 6 6 6 6 6 6 6 6 0 6 6 6 0 0 6 0.14 1.78
197 L -1 -1 0 -6 1 -1 -5 -3 0 0 4 0 2 0 -6 -4 -2 -5 1 1 4 3 4 0 3 3 0 2 2 4 45 6 5 3 0 0 2 0 4 9 0.54 1.61
198 Y -1 -5 -2 -6 -5 -4 -5 -3 3 1 3 -3 1 0 -6 -2 -2 3 5 0 5 0 2 0 0 0 0 2 8 9 31 2 4 2 0 3 2 3 22 6 0.67 1.61
199 K 0 2 0 -1 -5 1 1 -2 1 -3 -3 1 1 -6 4 0 -1 -6 -5 -2 6 10 5 2 0 7 9 2 4 2 2 9 3 0 24 7 4 0 0 3 0.45 1.61
200 T -1 0 -1 2 -5 0 -1 3 -1 -4 -3 2 -4 -5 -1 0 3 -6 -3 -3 4 5 2 12 0 4 2 20 2 1 3 16 0 0 2 5 20 0 1 1 0.42 1.51
201 H -3 4 -1 -2 -1 -3 -4 -5 7 -2 0 0 -1 -1 -5 -3 -1 -4 3 1 1 20 2 2 2 0 0 0 28 1 9 4 2 3 0 1 3 0 11 11 0.78 1.51
202 A 6 -5 -5 -5 2 -4 -4 -3 -5 -4 -1 -4 0 -2 -4 -1 -1 -5 -4 -1 77 0 0 0 4 0 0 0 0 0 5 0 2 2 0 3 4 0 0 3 1.25 1.51
203 C 0 -5 -2 -5 10 -5 -5 -5 4 -2 -4 -5 -4 0 -1 0 -1 -5 -2 -1 9 0 1 0 55 0 0 0 10 2 0 0 0 4 3 7 3 0 1 4 1.65 1.48
204 Y -1 0 1 0 -5 1 0 -1 2 0 -1 0 2 -4 0 0 0 -5 1 0 6 6 6 6 0 6 6 6 6 6 6 6 6 0 6 6 6 0 6 6 0.10 1.78
205 E 0 0 -3 0 1 1 5 -2 1 -4 -2 -1 -4 0 0 0 -3 -5 -4 -1 8 4 0 4 4 6 36 4 4 0 4 4 0 4 4 7 0 0 0 5 0.48 1.62
206 Y -3 -4 -4 -5 -5 -1 -4 -5 4 -2 -2 -4 -3 5 -5 -4 -4 -1 7 -2 2 0 0 0 0 2 0 0 11 2 3 0 0 27 0 0 0 0 47 3 1.46 1.32
207 N -3 -1 3 -1 0 0 -4 -5 -2 2 4 -2 3 -1 -5 -2 -3 -5 -4 0 1 4 14 3 2 4 0 0 1 10 40 3 6 2 0 3 0 0 0 6 0.53 1.36
208 H 0 2 1 3 0 2 3 -3 3 -4 -5 0 -1 -3 -2 -2 -2 -5 1 -3 7 10 5 15 2 10 22 1 7 1 0 5 2 1 1 2 2 0 5 1 0.46 1.46
209 I 2 -5 2 -1 2 -4 -4 5 0 -1 -3 -4 0 -3 -5 -1 -2 -5 -2 0 18 0 12 3 4 0 0 38 2 3 2 0 2 1 0 4 1 0 2 7 0.64 1.46
210 F -2 -5 -5 -6 -4 -5 -5 -6 -5 1 4 -2 1 5 -3 -5 -2 4 0 0 2 0 0 0 0 0 0 0 0 8 39 3 3 28 2 0 2 5 2 6 0.89 1.42
211 P 0 0 -1 1 -2 1 2 -1 1 -3 -3 1 0 -5 4 -1 -2 -5 -4 -3 8 4 3 7 1 6 14 6 3 1 3 10 3 0 21 4 2 0 0 2 0.37 1.36
212 L -2 1 -3 0 -4 1 -1 -2 0 0 4 3 0 -3 -4 -2 -2 -4 -4 -2 3 9 0 6 0 6 3 3 2 5 36 16 2 0 0 2 3 0 0 2 0.40 1.34
213 L -1 -4 -4 -4 -3 -4 -4 -1 -4 1 5 -4 2 2 -4 -4 -3 -3 -3 -1 5 1 1 1 0 1 1 5 0 7 58 1 4 9 1 1 1 0 0 3 0.81 1.27
214 E -1 -1 -1 1 -1 3 3 -1 -2 0 -1 0 -1 -3 -1 1 -1 -3 -3 0 4 3 2 8 1 12 23 4 1 5 6 6 2 1 3 9 4 0 1 6 0.25 1.14
215 K -1 1 -1 2 -3 0 2 -1 -1 -1 -1 3 -1 -2 -2 -1 -1 -3 -2 -2 4 8 3 13 1 4 16 5 1 3 6 18 1 2 2 3 3 0 1 4 0.26 1.02
216 Y 1 -1 2 0 -1 -1 2 -2 3 -2 -1 -1 -2 0 -2 -1 0 -2 3 -2 13 3 10 4 2 2 12 3 8 2 6 4 1 4 2 5 6 0 9 3 0.20 1.02
217 C -1 0 -1 -1 7 -1 -2 0 -3 -1 1 -1 0 -2 -2 0 0 -3 -3 -1 5 5 2 3 26 2 2 7 1 4 17 4 2 1 2 6 6 0 1 3 0.51 1.10
218 G 0 0 1 -1 -4 -3 -3 5 0 1 -2 -2 -3 -4 -3 -2 -3 -4 -4 -1 7 5 6 3 0 1 2 49 2 8 4 2 0 1 2 2 1 0 0 5 0.71 1.34
219 F -2 -2 -5 -5 -1 -4 -5 -4 -3 1 3 -4 3 4 -5 -3 -4 -2 6 -1 3 3 0 0 1 0 0 1 0 9 27 0 6 16 0 1 0 0 27 2 0.85 1.46
220 H 0 3 0 -1 0 -1 0 0 -1 -4 -2 -1 -4 -3 3 2 0 -5 -4 -1 6 17 5 3 2 2 5 8 1 0 4 3 0 1 14 19 5 0 0 4 0.32 1.46
221 E 1 2 -2 0 -3 0 4 -1 -1 0 -2 1 -4 -5 3 -1 -1 -5 -5 -2 11 9 1 5 1 3 25 5 2 5 4 7 0 0 12 3 3 0 0 2 0.36 1.52
222 D -3 -2 1 5 -4 0 3 0 1 -4 -4 -1 -3 -1 0 0 1 -4 -1 -4 1 2 6 32 0 4 16 7 3 1 1 2 0 3 4 6 8 0 2 1 0.52 0.98
223 N -1 4 2 -1 -1 1 0 1 3 -3 -4 1 -1 -1 -3 0 -1 -4 -1 -3 4 23 9 4 1 6 6 12 6 2 1 7 1 2 1 7 3 0 2 2 0.32 0.99
224 I -1 -4 -4 -4 -3 -4 -4 -4 -4 6 1 -4 2 -2 -4 -3 -1 -4 -3 3 6 1 0 1 0 0 1 1 0 53 9 1 4 0 1 1 3 0 0 18 0.90 1.01
225 P -1 -4 -4 -3 -4 -3 -1 -4 -4 0 -4 -3 -4 -4 8 -3 -3 -5 -4 -3 4 1 0 1 0 0 5 1 0 5 1 1 0 0 78 1 1 0 0 1 1.97 1.01
226 Q -3 1 1 3 -1 6 0 -3 0 -4 -4 1 -3 -5 -3 0 -2 -4 -4 -2 1 6 7 19 2 41 3 1 2 0 1 7 0 0 0 6 2 0 0 3 0.78 1.05
227 L -3 -4 -4 -5 -4 -2 -4 -5 1 1 4 -2 2 5 -2 -4 -3 -3 0 0 1 0 0 0 0 2 0 1 5 8 39 2 6 25 3 1 0 0 2 4 0.72 1.05
228 E 0 1 -1 3 -4 3 3 -1 -1 -4 -3 -1 -1 -4 0 1 -2 -4 0 -2 7 8 3 15 0 12 23 4 1 0 2 3 1 0 4 8 2 0 3 3 0.38 1.19
229 D 0 0 -1 5 -5 1 3 -1 1 -3 -3 -1 -4 -3 -4 -2 0 -5 -4 -2 7 5 1 36 0 5 20 4 3 1 3 2 0 1 0 1 6 0 0 3 0.62 1.19
230 V -1 -4 -4 -4 -3 -4 -4 -4 -4 3 1 -4 3 -3 -4 -1 0 -4 -3 5 5 0 0 0 0 0 1 1 0 19 13 1 8 0 0 5 6 0 0 38 0.71 1.21
231 S -1 -3 4 0 1 -3 -3 -1 1 -2 -4 -3 -4 -4 -1 4 0 -4 0 -4 4 0 23 5 3 0 0 3 3 3 1 0 0 0 3 39 6 0 4 0 0.66 1.24
232 Q -1 0 1 0 3 1 0 -1 2 0 -1 0 2 -5 0 0 0 4 -4 0 6 6 5 6 5 5 6 6 5 6 6 6 5 0 6 6 6 5 0 6 0.14 1.89
233 F -2 0 -1 -5 1 -1 -1 -2 1 -1 -2 0 -4 6 0 -2 -1 2 2 1 4 5 4 0 3 3 3 3 3 4 3 5 0 29 6 3 4 3 6 9 0.45 1.89
234 L -4 -5 -5 -5 -4 -4 -5 -5 -5 1 6 -5 2 1 -1 -5 -4 -4 -3 0 1 0 0 0 0 0 0 0 0 5 72 0 4 5 4 0 0 0 0 4 1.20 1.53
235 Q 0 1 -1 -1 -5 2 0 -1 2 -3 -2 4 2 -2 -4 1 -1 -5 -1 -3 6 6 2 3 0 9 6 4 4 2 4 30 6 2 0 10 2 0 2 2 0.41 1.56
236 T 2 1 -2 1 0 0 3 -2 -3 -4 -2 2 -3 -5 1 0 0 -5 -4 -3 17 9 1 7 2 4 19 2 0 0 5 12 0 0 8 7 5 0 0 2 0.34 1.17
237 C 1 3 -2 -3 2 0 1 -4 1 0 0 1 0 -3 -4 0 1 -4 -3 -2 12 19 1 0 5 3 11 1 4 5 10 9 3 1 0 5 9 0 0 2 0.27 1.15
238 T -2 -3 -2 -3 -3 -2 -3 -1 -3 -3 -2 -3 -3 -4 -3 2 7 -4 -3 -2 2 1 1 1 0 1 1 4 0 1 2 1 0 0 1 12 71 0 0 2 1.18 1.11
239 G -2 -2 1 -1 -4 0 -3 6 -1 -5 -5 -3 -4 -5 -4 -1 -3 -4 -4 -5 1 2 5 3 0 4 0 75 2 0 1 0 0 0 0 4 0 0 0 0 1.35 1.03
240 F -4 -4 -5 -5 -4 -4 -4 -4 -4 -3 -2 -4 2 6 -5 -4 -4 10 1 -3 1 0 0 0 0 0 0 1 0 0 2 0 6 37 0 1 0 47 2 0 2.09 1.03
241 R 0 3 -1 -2 -2 3 1 -1 1 -3 -3 0 -1 -4 -3 1 3 -4 -3 -3 9 15 2 1 1 14 10 5 3 1 2 5 1 0 1 8 22 0 0 1 0.39 1.00
242 L 0 -4 -4 -4 1 -4 -4 -4 -4 3 4 -4 0 -1 -4 -2 0 -3 0 3 8 1 0 1 3 0 1 1 0 16 36 1 1 2 1 2 4 0 4 19 0.54 1.00
243 R 0 4 -3 -3 0 1 -1 -3 -3 -1 -2 0 -2 -3 -3 -1 -1 -4 0 3 8 29 0 1 2 6 4 2 0 2 3 4 0 0 1 3 3 0 4 28 0.47 1.00
244 P 2 -2 -2 -1 -2 -2 -2 -1 -3 -3 -4 -1 -2 -4 7 -1 -1 -2 -4 -2 18 2 1 4 1 1 1 4 0 1 1 4 1 0 50 2 3 1 0 3 1.05 1.00
245 V 2 -4 -4 -4 0 -3 -4 -2 -4 0 -1 -4 -2 -3 -4 -3 0 -4 -3 6 15 1 0 1 2 0 1 3 0 2 3 1 0 0 1 1 4 0 0 64 0.89 1.00
246 A 2 -2 -3 1 -4 1 0 0 1 -4 -4 -1 -3 -2 5 0 -1 -4 -3 -2 22 2 0 7 0 6 7 6 4 1 1 3 0 2 30 5 2 0 0 2 0.58 0.96
247 G 1 -4 0 0 -4 -3 -1 6 -3 -4 -4 -3 0 -4 -3 -2 -3 -4 -4 -4 11 1 3 5 0 0 3 67 0 1 1 1 3 0 1 1 1 0 0 1 1.15 0.96
248 L -2 -4 -4 -4 -3 -1 -4 -2 -3 0 4 -4 1 3 -4 -3 -3 1 3 -1 4 1 0 1 0 3 1 3 0 5 50 1 3 11 1 1 1 2 11 2 0.65 0.96
249 L -3 -4 -4 -4 2 -4 -4 -5 -4 4 4 -4 2 -2 -4 -4 -3 -4 -3 3 1 1 0 1 4 0 1 1 0 30 38 1 5 0 1 1 1 0 0 16 0.79 0.96
250 S -1 1 1 0 -4 -2 -2 -2 1 -3 -4 -1 -3 -4 6 3 0 -4 -4 -3 2 7 5 5 0 0 1 3 4 2 1 2 0 0 37 23 6 0 0 1 0.80 0.96
251 S 1 -3 0 2 -4 1 0 -1 -1 -3 -2 -3 -3 2 4 0 -3 -3 0 -2 12 1 4 14 0 7 5 5 1 1 3 1 0 11 23 6 1 0 3 2 0.43 0.96
252 R 0 5 0 2 -4 0 0 -2 3 -4 -2 0 -3 -2 -1 -1 0 -4 -3 -2 8 34 3 12 0 3 6 3 6 1 3 3 0 2 3 3 6 0 0 4 0.47 1.08
253 D 0 1 0 4 -4 0 2 -4 1 -1 -1 -1 -3 -4 0 -2 0 -4 -4 1 7 9 3 23 0 4 14 1 4 3 5 2 0 0 4 2 6 0 0 12 0.32 1.08
254 F -4 -4 -4 -4 -4 -4 -4 -4 -3 -2 -2 -4 -2 8 -4 -4 -4 2 3 -3 1 1 0 1 0 0 1 1 0 1 1 1 0 80 1 1 1 3 7 1 1.77 0.97
255 L -3 -4 -4 -4 0 -4 -4 -4 -3 0 3 -4 3 6 -4 -4 -2 -2 3 -2 1 1 0 1 2 0 1 1 0 3 27 1 8 42 1 1 3 0 8 1 0.94 0.97
256 G 2 -1 1 2 -4 0 4 0 -3 -4 -4 -1 -3 0 -3 1 -1 2 -2 -3 18 2 6 11 0 3 27 8 0 1 1 3 0 4 1 8 3 3 1 1 0.40 0.97
257 G -1 -3 -3 -3 0 -2 -1 2 5 -2 2 -3 2 2 -4 1 -3 -3 0 -2 4 1 0 1 2 1 4 14 16 1 24 1 6 8 1 10 1 0 3 1 0.38 0.97
258 L -3 -3 -4 -4 -3 2 -3 -4 -4 1 5 -3 1 -1 -4 -4 -3 -1 -3 -1 1 1 0 1 0 12 1 1 0 5 71 1 2 1 1 1 1 1 0 1 0.94 0.97
259 A 6 -1 -2 -3 -3 -1 -2 0 -3 -3 -2 -2 -3 -4 -3 1 -2 -4 -1 -2 68 3 1 1 0 2 2 5 0 1 3 1 0 0 1 10 1 0 2 1 0.87 0.97
260 F -2 -1 4 1 -4 1 0 -2 2 -3 -2 -1 -1 4 -4 -1 -2 -3 2 -3 3 3 25 9 0 6 6 3 6 1 3 2 1 19 1 2 1 0 8 1 0.49 0.97
261 R -2 6 0 -3 -1 0 -2 0 0 -4 -4 3 -3 -4 -2 -1 -3 -4 -3 -4 2 47 5 1 2 3 1 8 2 1 1 22 0 0 2 3 1 0 0 1 0.87 0.94
262 V -2 3 -2 -3 -3 1 -1 -3 -1 0 0 1 -1 -2 -3 -2 -1 -4 -1 4 2 19 2 1 0 6 4 2 1 3 8 7 1 1 1 2 4 0 3 35 0.41 0.95
263 F -4 -4 -4 -2 -4 -4 -5 -5 0 -2 1 -5 -2 8 -5 -4 -4 -1 2 -3 0 0 0 2 0 0 0 0 2 0 16 0 0 71 0 0 0 0 4 0 1.51 1.00
264 H -2 -2 -2 -3 0 1 -3 -4 5 -3 -4 -3 -3 -2 7 -3 -3 -5 -1 1 3 2 2 0 2 6 0 0 15 0 0 0 0 2 52 0 0 0 2 12 1.24 1.00
265 C 1 -4 -3 -4 6 -3 -4 -4 2 3 -1 -4 -2 -3 -4 2 0 -4 -3 3 13 0 0 0 17 0 0 0 5 20 3 0 0 0 0 17 5 0 0 18 0.60 1.00
266 T 4 0 -3 -4 -3 -3 -3 0 -4 -4 -4 -3 -3 -4 -3 0 5 -4 1 -3 40 4 0 0 0 0 0 6 0 0 0 0 0 0 0 5 40 0 5 0 0.83 1.06
267 Q -1 0 0 0 2 2 -3 -4 -4 1 0 -3 1 -4 -4 2 3 4 -4 -1 5 6 4 5 4 11 0 0 0 8 9 0 4 0 0 15 18 6 0 4 0.34 1.22
268 Y -4 0 0 2 -5 0 0 -5 2 -4 -4 -4 -4 5 -5 -4 0 7 3 -1 0 5 5 13 0 5 7 0 5 0 0 0 0 23 0 0 6 16 11 5 0.81 1.22
269 I -3 -5 -5 -2 -4 -4 -5 -6 -5 6 2 -5 5 -3 -5 -4 -1 -5 -4 2 0 0 0 3 0 0 0 0 0 51 14 0 16 0 0 0 3 0 0 13 1.06 1.11
270 R -4 8 -3 -4 -6 -1 -3 -5 -3 -6 -5 0 -4 -6 -5 -3 -4 -5 -4 -5 0 100 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2.22 1.22
271 H -2 1 -1 -1 0 1 -1 -2 8 -5 -5 1 -4 -4 -1 0 1 -5 0 -2 2 8 3 3 2 5 3 3 41 0 0 7 0 0 3 7 8 0 2 2 0.89 1.22
272 G 0 2 -2 -2 0 -1 1 0 2 -1 -1 -1 0 -2 3 0 -2 1 -1 -1 6 14 2 2 2 2 8 8 6 3 5 4 2 2 17 8 2 2 2 5 0.23 1.22
273 S 0 -1 1 2 -5 0 4 -1 2 -5 -5 -1 -4 -2 -2 4 0 -6 -4 -5 5 2 6 12 0 2 24 3 4 0 0 3 0 2 2 29 5 0 0 0 0.59 1.31
274 K -1 -1 0 3 -1 3 3 -4 3 -5 -5 0 -1 -5 -4 2 -1 0 -2 -2 4 3 4 17 1 12 22 0 6 0 0 6 2 0 0 14 4 1 2 2 0.52 1.31
275 P -3 -4 -4 2 -4 -4 -2 -5 -4 2 1 -4 1 2 5 -3 -2 -4 -3 2 0 0 0 12 0 0 2 0 0 13 13 0 3 9 29 0 2 0 0 17 0.64 0.83
276 M -3 -1 2 5 -5 -1 2 0 0 -3 0 -2 3 0 -2 -1 -2 -4 -1 -4 1 4 8 33 0 1 13 7 2 0 10 1 9 4 1 2 1 0 2 0 0.47 0.83
277 Y -4 -4 -1 -5 -4 -3 -4 -5 5 -3 -2 -4 3 4 -5 -4 -4 -1 8 -3 0 0 3 0 0 0 0 0 14 0 0 0 10 18 0 0 0 0 55 0 1.40 0.83
278 T -1 -3 -1 -3 -3 -2 1 -3 -3 0 1 -3 -2 -4 -3 3 4 -5 -4 -1 4 0 2 0 0 0 10 0 0 7 14 0 0 0 0 28 33 0 0 3 0.52 0.83
279 P 0 0 -3 2 -4 2 0 -4 -3 -1 -2 -1 -3 -5 6 -2 -1 -5 -4 -1 7 5 0 13 0 12 6 0 0 4 4 3 0 0 38 0 3 0 0 4 0.77 0.83
280 E 0 -2 -2 0 -5 -1 6 -4 -2 -4 -1 0 -3 0 -3 -2 -1 -4 -3 -4 7 0 0 2 0 0 70 0 0 0 9 3 0 4 0 0 4 0 0 0 0.99 0.83
281 P -3 -4 -4 -3 -5 -3 0 -4 -3 -5 -5 -3 -4 -4 8 -3 -3 -4 2 -4 0 0 0 0 0 0 6 0 0 0 0 0 0 0 84 0 0 0 10 0 2.19 0.83
282 D 0 -3 3 7 -5 -2 -1 -3 -3 -5 -5 -2 -5 -5 2 -2 -3 -6 -5 -5 8 0 16 65 0 0 0 0 0 0 0 0 0 0 11 0 0 0 0 0 1.26 0.78
283 I -1 -4 -3 2 4 -3 -3 -2 -4 2 -1 -3 1 0 2 -1 2 -4 -1 1 3 0 0 16 10 0 0 3 0 15 5 0 4 4 11 3 13 0 3 12 0.34 0.78
284 C 1 -5 -5 -5 7 -4 -5 -4 -4 2 0 -4 -2 5 0 -3 -3 -3 -1 1 16 0 0 0 24 0 0 0 0 16 5 0 0 27 5 0 0 0 0 7 0.79 0.78
285 H -3 -2 -1 -3 -4 -1 -2 -4 9 -5 -4 -2 -3 -3 -4 1 2 -4 -1 -4 0 0 0 0 0 0 0 0 72 0 0 0 0 0 0 14 13 0 0 0 1.61 0.75
286 E -3 -3 -2 4 -5 -1 5 2 -3 -4 0 -1 -3 -4 -3 -2 -3 -5 -4 -4 0 0 0 23 0 0 47 14 0 0 13 1 0 0 0 0 0 0 0 0 0.80 0.75
287 L -1 -2 -3 -3 0 -2 -3 -2 -3 2 3 2 0 -1 -3 -1 -2 -3 -1 2 5 1 1 1 2 1 1 3 0 10 33 14 1 2 1 5 2 0 2 15 0.29 0.65
288 L 0 -3 -3 -4 -3 -3 -3 -3 -3 2 2 -3 0 6 -3 -2 -2 -2 1 0 9 1 1 1 0 1 1 1 0 10 23 1 2 39 1 2 1 0 2 4 0.62 0.65
289 G -1 -3 -2 -2 0 -2 -3 6 4 -4 -4 -3 -3 -3 -3 -2 -3 -3 -3 -4 3 1 1 1 3 1 1 69 14 1 1 1 0 1 1 1 1 0 0 1 1.15 0.65
290 H -3 -2 -1 -3 -3 -1 -2 -3 9 -3 1 -2 -2 -2 -3 -2 -3 -3 0 -3 1 1 1 1 0 1 1 1 72 1 15 1 0 1 1 1 1 0 0 1 1.48 0.65
291 V 1 -3 -3 -3 4 -3 -3 -1 -3 1 2 -3 3 -2 -3 -2 -1 -3 -3 4 14 1 1 1 9 1 1 5 0 4 17 1 7 1 1 2 3 0 0 33 0.39 0.65
292 P -1 -2 0 -3 5 -3 -3 2 -4 -2 -4 -3 -4 -5 7 -1 -3 -5 -5 -4 5 2 4 0 13 0 0 14 0 2 0 0 0 0 56 2 0 0 0 0 1.35 0.75
293 L -2 -4 -5 -5 3 -1 -4 -5 -4 2 3 -4 6 1 2 -4 -1 3 0 -1 3 0 0 0 6 3 0 0 0 10 29 0 22 5 10 0 3 4 3 3 0.64 1.00
294 F -3 -4 -5 -5 -4 -4 -5 -5 2 2 4 -4 2 2 -5 0 -3 -4 -2 1 0 0 0 0 0 0 0 0 5 11 53 0 5 10 0 10 0 0 0 6 0.76 1.00
295 S 3 -4 -4 -1 -3 -3 -4 -1 -4 0 1 -3 4 0 -4 0 1 -4 0 1 33 0 0 3 0 0 0 3 0 4 11 0 14 3 0 6 9 0 3 9 0.43 1.00
296 D -3 -3 5 5 -5 0 0 -3 4 -1 -5 -3 -4 -5 -4 1 -1 -5 -4 -4 0 0 30 34 0 3 5 0 9 4 0 0 0 0 0 10 2 0 0 0 0.94 1.12
297 R -1 1 -4 0 -6 1 -1 -1 -5 -1 -2 0 -4 -6 6 -1 -4 -6 -5 -1 5 8 0 5 0 6 4 5 0 4 4 6 0 0 44 5 0 0 0 4 0.89 1.61
298 S -1 1 1 2 -5 -1 1 -2 0 -2 -1 -1 0 -1 -1 2 0 2 0 -1 5 8 7 11 0 3 8 3 3 3 7 3 3 3 3 15 7 3 3 4 0.14 1.61
299 F -4 1 -5 -6 -5 -5 -5 -6 -3 0 -1 -4 1 7 -6 -4 -1 -2 5 -1 0 7 0 0 0 0 0 0 0 4 4 0 3 57 0 0 3 0 17 4 1.36 1.19
300 A 6 -4 -1 -4 2 -3 -4 -1 -4 -3 0 -3 1 -4 -4 0 -3 -5 -4 0 69 0 4 0 4 0 0 3 0 0 7 0 3 0 0 5 0 0 0 5 0.96 1.19
301 Q 0 1 2 1 -5 2 1 0 3 -5 -1 1 -4 -5 -4 1 1 -5 -4 -4 8 8 8 8 0 8 8 8 8 0 8 8 0 0 0 8 8 0 0 0 0.29 1.22
302 F -3 -5 -5 -6 -5 -5 -5 -6 0 0 0 -5 0 7 -1 -5 -2 -2 5 -1 2 0 0 0 0 0 0 0 2 4 8 0 2 54 4 0 3 0 18 4 1.32 1.36
303 S -1 -1 -1 -5 1 -4 -4 -5 -4 -1 1 -2 3 2 -2 2 3 -5 0 2 5 3 3 0 3 0 0 0 0 3 14 3 7 9 2 17 16 0 4 12 0.34 1.52
304 Q -1 2 -3 -4 0 5 1 -5 5 -2 -5 0 -4 -1 -5 -1 -1 2 0 -2 6 11 0 0 2 33 9 0 13 3 0 4 0 3 0 5 3 3 3 3 0.73 1.52
305 E -1 1 1 0 -5 1 0 -5 3 0 -1 0 2 1 -5 0 0 -5 2 0 6 6 6 6 0 6 6 0 6 6 6 6 6 6 0 6 6 0 6 6 0.18 1.67
306 I -2 -5 -5 -6 0 -5 -5 -1 -3 3 1 -5 1 4 -5 -3 -4 -2 6 -1 4 0 0 0 2 0 0 5 0 21 10 0 4 16 0 2 0 0 34 2 0.92 1.25
307 G 0 -5 -3 -4 3 -4 -1 7 -5 -6 -6 -4 -5 -6 -5 -1 -4 -5 -6 -5 6 0 0 0 6 0 5 79 0 0 0 0 0 0 0 5 0 0 0 0 1.60 1.25
308 L 0 2 -2 -2 2 2 2 -2 -4 -2 2 2 -1 -2 -2 -2 -3 -5 -4 -2 7 11 1 2 5 10 14 2 0 1 25 12 1 1 2 2 0 0 0 3 0.33 1.25
309 A 3 -4 -2 -5 1 -4 -4 0 -5 2 2 -1 0 -4 -4 -1 -1 -5 -4 1 31 0 1 0 2 0 0 6 0 11 22 5 2 0 0 5 3 0 0 11 0.45 1.25
310 S 2 0 -2 -4 -1 -4 -4 4 -4 -1 -3 -3 -4 0 -2 3 -3 -5 0 -1 15 6 1 0 1 0 0 36 0 4 2 0 0 4 1 21 0 0 3 5 0.58 1.25
311 L 0 1 -4 -5 1 -1 -3 -5 -4 0 4 -2 1 1 -4 -1 -2 0 -1 1 9 9 0 0 3 3 1 0 0 5 40 3 2 6 0 4 2 1 2 8 0.42 1.20
312 G 2 2 -1 -1 -2 0 -1 3 -1 -2 -4 3 -1 -5 -4 -1 1 -5 -4 -4 16 12 2 4 1 4 2 20 1 3 0 21 2 0 0 4 7 0 0 0 0.42 1.27
313 A 5 -4 -2 0 0 -1 0 -2 3 -2 -2 -3 -4 0 -4 -1 -1 -5 -2 -1 54 0 2 7 2 2 5 2 7 1 3 0 0 4 0 3 2 0 1 5 0.66 1.32
314 P -1 0 -1 1 1 0 2 -2 1 1 -2 -1 1 -1 0 1 1 2 -4 -2 5 4 3 8 3 4 14 3 4 7 4 3 4 3 5 13 7 3 0 3 0.15 1.67
315 D 0 1 0 3 -6 1 2 0 2 -6 -2 2 -5 -6 2 0 0 -6 -5 -5 6 7 4 15 0 5 14 8 4 0 4 12 0 0 10 5 5 0 0 0 0.38 1.67
316 E -1 -1 1 2 -5 0 4 2 -3 -5 -5 1 -5 -5 -3 1 -3 -6 -1 -2 4 3 5 12 0 4 27 18 0 0 1 8 0 0 1 12 0 0 2 3 0.53 1.43
317 Y 2 1 -2 4 -5 1 3 -3 -2 -1 -4 -2 0 -2 -4 -2 -2 -1 1 -1 19 6 1 22 0 6 20 2 1 3 1 1 3 1 0 2 1 1 5 6 0.45 1.43
318 I -3 2 -5 -5 0 -1 -5 -4 -4 4 3 -2 3 1 -5 -2 -2 1 -1 1 2 11 0 0 2 3 0 1 0 23 27 1 7 6 0 3 2 2 2 8 0.50 1.32
319 E 0 -1 -2 1 -5 2 3 -3 -1 -2 -2 2 -2 -5 0 1 -2 3 -4 -1 9 3 1 8 0 8 20 1 1 2 5 11 1 0 4 13 2 5 0 6 0.31 1.33
320 K 0 2 0 -4 -5 1 -1 -4 2 -4 1 3 1 2 -4 0 -2 3 1 -4 8 12 4 0 0 8 4 0 6 0 12 17 3 11 0 5 2 4 4 0 0.34 1.17
321 L -1 -4 -5 -6 -4 -4 -5 -5 -5 3 5 -1 2 1 -5 -4 -3 -4 -3 1 7 0 0 0 0 0 0 0 0 17 53 5 5 6 0 0 0 0 0 8 0.81 1.07
322 A 3 1 -4 -4 -4 1 -1 1 -4 -1 -1 -1 1 0 -1 1 0 -5 -4 -1 28 8 0 0 0 6 4 10 0 4 6 4 4 4 4 10 5 0 0 5 0.27 1.28
323 T -1 5 2 0 -5 2 -3 -1 2 -5 -5 1 -4 -5 -4 0 1 -5 -4 -1 5 38 8 5 0 8 0 5 5 0 0 6 0 0 0 6 10 0 0 5 0.65 1.28
324 I -3 -4 -5 -5 4 -4 -5 -5 -4 2 3 -4 3 3 1 -4 -1 -4 -2 2 0 0 0 0 11 0 0 0 0 9 31 0 9 12 8 0 4 0 0 15 0.61 0.81
325 Y 1 -3 0 -4 -4 -3 -3 -4 5 -3 -1 -3 -3 3 -4 -1 -3 4 7 -3 12 0 5 0 0 0 0 0 13 0 4 0 0 14 0 5 0 6 40 0 0.96 0.81
326 W -2 -4 -5 -5 1 1 -4 -4 -4 -3 -1 -4 1 2 1 -4 -4 11 0 -1 4 0 0 0 4 7 0 0 0 0 5 0 4 8 8 0 0 55 0 6 1.76 0.81
327 F -4 1 -4 -5 -4 -4 -4 -5 1 -2 0 -3 0 6 -5 -2 -3 5 5 -3 0 9 0 0 0 0 0 0 3 0 7 0 3 48 0 4 0 9 17 0 1.07 0.76
328 T 1 -3 -2 -3 1 -3 -3 -3 -4 -1 -3 -3 -2 -4 -3 2 6 -4 -3 1 11 0 0 0 3 0 0 0 0 3 0 0 0 0 0 13 61 0 0 9 0.84 0.76
329 V -1 -4 -4 -5 -3 0 -4 -5 -4 3 1 -4 2 0 -4 -3 -1 5 -2 5 4 0 0 0 0 5 0 0 0 15 9 0 6 3 0 0 2 8 0 48 0.69 0.71
330 E -2 -2 -2 0 -4 1 6 -3 -2 -4 -4 -1 -3 -4 -3 2 -2 -4 -3 -4 0 0 0 0 0 4 75 0 0 0 0 0 0 0 0 16 0 0 0 0 1.15 0.68
331 F -3 -4 -2 -4 1 -4 -4 -4 -2 -2 -2 -4 -2 7 -4 -2 -1 -1 4 -1 0 0 2 0 4 0 0 0 0 0 1 0 0 68 0 2 4 0 13 3 1.24 0.68
332 G -1 -3 -2 -2 -3 -3 -3 7 -3 -4 -4 -3 -4 -4 -3 -2 -3 -3 -4 -4 1 1 0 1 0 0 1 90 0 1 1 1 0 0 1 1 1 0 0 1 1.51 0.58
333 L 1 -3 -3 -3 -2 -2 -3 -3 -3 2 2 -3 4 -2 -3 -2 2 -3 -2 2 15 1 1 1 0 1 1 1 0 15 16 1 15 1 1 1 15 0 0 15 0.36 0.57
334 C -3 -4 -4 -4 7 -4 -4 -4 -4 3 1 -4 3 -3 -4 -1 0 -4 1 3 1 1 0 1 26 0 1 1 0 14 12 1 9 0 1 5 5 0 5 18 0.77 1.06
335 K 0 3 0 -1 0 1 -1 0 0 -2 -2 4 0 -3 -3 -1 -1 1 1 -2 7 15 4 4 2 7 4 7 2 3 3 26 2 0 1 3 3 2 5 3 0.31 1.06
336 Q -2 -1 0 0 -5 4 4 -2 0 -5 -5 1 -4 -6 -4 -1 3 -5 -4 -5 2 2 4 4 0 22 32 3 2 0 0 10 0 0 0 3 17 0 0 0 0.77 1.32
337 G -1 -1 3 3 -5 0 0 2 1 -2 -3 -1 -4 -5 2 -2 -2 -6 -5 -2 5 3 17 19 0 3 6 15 3 2 3 4 0 0 11 2 2 0 0 3 0.44 1.32
338 D -1 -4 2 2 -5 0 2 5 -1 -6 -6 -1 -5 -5 -2 -2 -2 4 -5 -5 4 0 10 12 0 4 12 43 1 0 0 3 0 0 2 2 1 6 0 0 0.82 1.32
339 S -1 0 1 0 -5 1 0 -1 2 0 -1 0 2 1 1 0 0 -6 -4 0 6 6 6 6 0 6 6 6 6 6 6 6 6 6 6 6 6 0 0 6 0.10 1.78
340 I -4 1 1 -4 3 1 -4 -5 -4 1 0 0 3 1 1 0 0 -4 2 0 0 7 7 0 7 7 0 0 0 7 7 7 7 7 7 7 7 0 7 7 0.27 1.44
341 K -2 5 -2 -2 1 0 2 -4 -2 -4 -4 5 -2 -5 -3 -2 -2 -5 -4 -3 1 30 1 0 3 2 12 0 0 0 0 47 1 0 0 1 1 0 0 1 0.92 0.77
342 A 4 -4 -4 -4 0 -3 -4 1 -4 4 -1 -3 0 -3 -4 -1 -2 -4 -4 1 44 0 0 0 2 0 0 13 0 26 3 0 2 0 0 1 0 0 0 10 0.60 0.77
343 Y -4 -4 2 -4 -1 -3 -4 -5 0 -2 -2 -4 -3 3 -5 -3 -3 0 8 -3 0 0 11 0 2 0 0 0 0 2 3 0 0 9 0 0 0 0 74 0 1.53 0.77
344 G -2 1 -2 -3 -5 -3 -4 7 -4 -6 -5 -3 -4 -5 -4 -2 -3 -4 -5 -5 0 11 0 0 0 0 0 89 0 0 0 0 0 0 0 0 0 0 0 0 1.64 0.77
345 A 5 2 -3 -3 -3 -2 -3 1 -3 -3 -4 -2 -3 -4 -3 2 -2 -5 -4 -1 58 15 0 0 0 0 0 11 0 0 0 0 0 0 0 13 0 0 0 3 0.74 0.75
346 G 0 -4 -2 2 -4 -3 -3 6 3 -5 -5 -3 -4 -5 -4 -1 -2 -5 -4 -3 6 0 0 13 0 0 0 66 8 0 0 0 0 0 0 2 2 0 0 2 1.11 0.75
347 L -1 -4 -5 -5 5 -4 -5 -5 -5 5 3 -4 3 -2 -5 -4 -3 -4 -3 1 3 0 0 0 13 0 0 0 0 38 32 0 8 0 0 0 0 0 0 6 0.84 0.75
348 L -1 -4 -4 -4 5 -3 -4 -4 -4 3 4 -4 1 -2 -4 -3 -2 -3 -3 2 4 0 0 0 13 0 1 1 0 22 41 0 2 0 0 1 0 0 0 11 0.68 0.68
349 S -1 -2 -1 -2 -3 -2 -2 0 4 -4 -4 -2 -3 -3 -2 5 1 -4 -2 -3 1 0 0 0 0 0 1 5 13 0 1 0 0 0 0 67 8 0 0 1 0.87 0.68
350 S 0 2 -1 -2 3 -2 -2 -1 -2 -4 -4 -1 -3 -4 -2 5 -1 -4 -3 -3 4 14 0 0 6 0 1 3 0 0 1 0 0 0 0 68 0 0 0 1 0.82 0.68
351 F -1 1 -2 -1 -1 -2 -2 -3 1 2 -2 -1 -2 1 3 1 -1 -3 3 -1 3 9 1 4 1 1 1 2 3 13 2 4 0 6 15 15 3 0 14 4 0.27 0.68
352 G -1 -1 1 0 -4 0 2 5 -1 -4 -4 1 -3 -4 -3 0 0 -4 -4 -4 5 2 7 4 0 3 15 42 1 1 1 9 0 0 1 5 4 0 0 1 0.58 0.71
353 E -2 -2 -2 -1 -4 1 6 -3 -2 -4 -4 -1 -3 0 -3 1 -2 -4 -3 -3 1 1 0 1 0 4 71 1 0 1 1 1 0 5 1 12 1 0 0 1 1.04 0.71
354 L 1 -3 -3 -3 6 -3 -3 -2 -3 -1 3 -3 0 -2 -3 1 1 -3 -3 -1 11 1 0 1 17 0 1 2 0 3 32 1 1 0 1 14 11 0 0 3 0.47 0.71
355 Q -2 3 -2 0 -2 1 1 -3 -1 -1 0 1 -1 -4 -2 0 2 -5 -4 1 2 16 1 5 1 6 11 1 1 3 11 10 1 0 1 8 13 0 0 9 0.23 0.88
356 Y -3 -3 -1 -2 -2 -1 0 -4 8 -5 -5 -4 -4 2 -5 -2 -4 2 7 -5 1 1 3 2 1 3 5 1 35 0 0 0 0 6 0 3 0 3 36 0 1.43 1.48
357 C 4 -5 -4 -5 6 -4 -4 -3 -5 -2 -3 -4 0 3 -4 2 -1 -5 -4 0 40 0 0 0 17 0 0 1 0 2 1 0 3 12 0 16 2 0 0 7 0.87 1.48
358 L -2 0 -5 -5 1 -3 -5 -6 0 1 4 -2 4 1 -5 -3 -1 -4 -1 1 2 6 0 0 3 1 0 0 2 6 42 2 10 7 0 2 4 0 2 10 0.62 1.44
359 S -1 -2 2 -1 -2 0 1 -2 -1 -4 -5 -1 -4 -5 -2 5 2 -5 -4 -3 2 1 9 3 1 3 8 2 1 1 1 4 0 0 1 50 11 0 0 1 0.73 1.40
360 E 1 -2 1 5 -5 0 0 3 -4 -5 -5 -2 -1 -5 2 -1 -2 -6 -5 -3 10 2 5 32 0 4 4 19 0 0 0 2 2 0 10 3 3 0 0 1 0.65 1.43
361 K 0 -1 1 1 -1 -1 2 -1 -1 0 -3 4 -2 -5 -1 0 0 -6 -5 -2 7 1 6 6 1 2 16 4 2 5 2 28 1 0 3 6 7 0 0 3 0.38 1.46
362 P 2 -5 -3 -2 2 -3 -1 -4 -5 -1 -3 -4 0 -5 6 -1 -2 -6 -5 2 21 0 1 2 4 1 4 0 0 2 2 0 2 0 41 3 1 0 0 16 0.96 1.45
363 K -3 1 3 -1 -1 1 4 -5 -1 -1 -2 3 -2 -2 0 -3 -2 -5 -4 -1 1 6 15 2 1 5 28 0 1 4 3 17 1 2 6 0 2 0 0 5 0.50 1.45
364 L -4 4 -4 -5 -2 -2 -4 -6 3 3 0 2 -1 1 -5 -4 -2 -5 2 2 0 22 0 0 1 1 0 0 7 20 7 13 1 6 0 0 3 0 6 14 0.59 1.48
365 L -3 4 -3 -3 -5 0 1 -4 0 2 1 2 0 0 -5 -2 -2 -5 0 0 1 24 1 1 0 4 9 1 2 12 12 15 2 4 0 3 1 0 3 7 0.43 1.48
366 P 0 1 -2 1 -6 -1 1 -1 -3 -4 -5 0 -2 -6 6 -2 -3 -1 -2 -4 7 7 1 8 0 2 8 5 1 1 1 6 1 0 46 2 1 1 1 1 0.99 1.48
367 L -5 -5 -6 -6 -5 -5 -6 -6 -1 -1 2 -6 0 8 -6 -4 -5 4 3 -3 0 0 0 0 0 0 0 0 1 2 18 0 2 61 0 1 0 6 8 0 1.63 1.48
368 E -3 -2 2 6 -6 -1 2 -3 -2 -4 -6 -1 -5 -6 -4 1 -1 -6 -5 -3 1 2 8 53 0 2 12 1 1 1 0 3 0 0 0 11 3 0 0 2 1.09 1.48
369 L -2 -5 -5 -5 -5 -5 -5 -6 -5 3 2 -5 1 -2 6 -4 -1 -6 -5 1 3 0 0 0 0 0 0 0 0 14 23 0 3 2 42 0 4 0 0 10 1.13 1.49
370 E 0 -2 -1 1 -2 1 4 -4 1 -1 -1 0 1 1 -3 0 -2 -5 -4 -1 8 2 3 8 1 5 30 1 3 4 7 5 3 7 1 5 1 0 0 5 0.34 1.43
371 K 1 2 -2 3 -5 0 0 -4 1 1 -2 1 -2 -4 -3 -1 1 -1 -4 1 13 13 1 16 0 4 6 0 3 7 3 8 1 1 1 4 9 1 0 10 0.27 1.46
372 T 3 -5 -4 -3 2 -4 -4 -5 0 2 -2 -3 2 -4 -1 -3 3 -6 -4 4 22 0 0 1 4 0 0 0 2 10 2 1 6 0 2 0 22 0 0 27 0.65 1.47
373 A 3 -1 -5 -5 5 -2 -5 0 -5 1 2 -4 5 -1 -5 -1 -2 -5 -4 -1 24 3 0 0 11 2 0 7 0 9 18 0 15 2 0 4 1 0 0 3 0.57 1.46
374 I -3 4 2 2 -2 1 0 -3 -1 -3 -2 1 -3 -3 -1 -3 0 -6 -2 0 1 26 8 12 1 6 6 1 1 1 5 9 1 1 4 1 6 0 2 8 0.40 1.47
375 Q -3 2 -3 -4 -5 5 1 -5 -1 -2 -3 0 0 -5 -4 -2 5 -5 -2 -2 1 9 0 0 0 30 7 0 1 2 2 4 2 0 0 1 39 0 1 2 0.91 1.47
376 N -2 0 -1 1 -6 -2 3 -4 0 -5 -4 2 1 -6 5 -1 -1 -6 -5 -2 3 5 3 8 0 1 21 1 2 0 1 11 4 0 30 4 4 0 0 3 0.73 1.47
377 Y -2 -5 -5 -6 5 -4 -5 -4 -1 -2 -4 -5 -4 3 -4 -2 -4 -1 8 -2 2 0 0 0 13 1 0 1 1 2 0 0 0 11 1 3 0 0 64 2 1.76 1.47
378 T -3 4 0 4 -6 1 0 -4 -1 0 -2 -1 -3 -5 3 -1 -3 -3 0 -2 2 22 3 21 0 7 4 0 2 7 4 3 0 0 14 3 1 0 4 2 0.51 1.48
379 V -3 -5 -5 2 -4 -5 -5 -6 -6 7 -1 0 -2 -3 -1 -4 -1 -6 -3 1 1 0 0 11 0 0 0 0 0 63 3 6 0 1 3 0 4 0 1 8 1.12 1.48
380 T -3 -4 0 5 -3 2 -1 -3 -3 -5 -4 -3 -4 -4 -4 0 5 -2 -1 -3 0 0 3 32 0 10 2 2 0 0 1 0 0 1 0 4 40 1 2 1 0.96 1.48
381 E -1 0 -1 0 -2 0 1 0 2 2 -4 2 -2 -5 -4 1 3 -6 -4 -3 5 4 3 6 1 4 10 7 6 13 0 12 1 0 0 9 18 0 0 1 0.32 1.48
382 F -4 -5 -1 -6 -5 -3 -4 -6 -3 -1 0 -4 5 5 0 -4 -3 -2 6 -1 0 0 3 0 0 0 1 0 0 3 8 1 17 23 5 0 1 0 34 3 1.13 1.43
383 Q -3 -2 -2 -3 -5 8 -1 -4 4 -5 -5 -1 -3 -5 2 -3 -3 -5 -3 -5 0 0 0 0 0 76 0 0 12 0 0 0 0 0 12 0 0 0 0 0 1.62 1.04
384 P -1 -1 1 1 -5 1 4 -4 1 -5 -3 1 -4 -5 4 -1 -1 -5 -4 -4 3 3 7 5 0 6 32 0 3 0 3 8 0 0 23 4 3 0 0 0 0.70 1.04
385 L 0 -1 3 -1 0 0 -1 0 3 0 -2 -1 0 -4 -4 -1 3 -5 -4 1 10 3 14 2 2 4 3 7 8 5 3 3 2 0 0 3 20 0 0 12 0.27 1.04
386 Y -4 -4 -5 -5 -4 -4 -4 -5 -1 -2 2 -4 -2 3 -5 -4 -4 0 8 -3 0 0 0 0 0 0 0 0 0 0 22 0 0 10 0 0 0 0 67 0 1.52 0.83
387 Y -4 -4 -5 -5 1 -5 -5 -5 -2 -2 -1 -5 1 7 -5 -4 -4 4 5 -3 0 0 0 0 3 0 0 0 0 0 3 0 4 67 0 0 0 5 18 0 1.49 0.78
388 V 0 -3 -5 -5 0 -4 -2 -5 -4 2 -1 -4 0 -2 -5 -2 -1 -4 4 5 6 1 0 0 2 0 3 0 0 9 3 0 2 0 0 2 3 0 15 56 0.86 1.10
389 A 2 -4 -4 -4 2 -4 -4 -4 -4 4 1 -4 -2 0 -4 1 2 -4 -3 0 18 0 0 0 4 0 0 0 0 27 15 0 0 4 0 10 16 0 0 4 0.50 1.06
390 E -3 0 1 5 -5 -1 4 -3 -1 -5 -5 0 -4 -5 2 -1 -2 -5 -4 -5 1 6 7 32 0 2 28 1 1 0 0 3 0 0 11 4 2 0 0 0 0.80 1.06
391 S -1 -3 1 3 -4 -1 -1 -1 0 -5 -5 -1 -4 -5 -3 6 0 -5 -4 -4 1 0 5 15 0 1 2 4 3 0 0 2 0 0 0 63 3 0 0 0 0.93 1.06
392 F -4 -5 -5 -5 0 -5 -5 -5 -4 2 2 -5 0 7 -5 -4 -3 -2 2 -1 0 0 0 0 2 0 0 0 0 10 20 0 2 52 0 0 1 0 6 4 1.16 1.06
393 N 0 -1 -1 3 -2 1 4 -2 -1 -4 -3 1 -4 -3 -2 1 -1 -5 -4 -3 8 2 2 18 1 6 34 2 1 0 2 9 0 1 1 10 2 0 0 1 0.56 1.05
394 D -2 -1 -1 4 -5 3 3 -4 4 -3 -4 0 -2 -1 -3 -1 -1 -4 0 -4 3 3 1 21 0 16 23 0 10 1 0 5 1 3 0 5 3 0 3 1 0.60 1.05
395 A 3 -4 -4 -5 2 -4 -4 -3 -4 0 4 -4 3 -3 -4 -2 -3 -4 -3 0 27 0 0 0 4 0 0 2 0 3 50 0 6 0 0 1 0 0 0 4 0.74 1.05
396 K -2 0 -2 0 -4 0 0 -4 -2 0 0 3 0 3 -4 0 -1 -3 2 -2 3 5 1 6 0 3 6 1 1 6 10 23 3 14 0 6 4 0 8 2 0.29 1.08
397 E -1 0 0 4 -3 3 5 -3 -1 -3 -3 0 -4 -5 -4 0 -2 -5 -3 -3 4 6 3 23 0 11 35 1 1 1 2 3 0 0 0 7 1 0 1 1 0.72 1.13
398 K 0 0 -2 -1 -4 1 -1 -4 -4 3 1 4 -1 -4 -2 -1 -2 -5 -4 2 6 4 1 4 0 5 4 1 0 17 12 25 1 0 1 3 1 0 0 14 0.35 1.12
399 V 1 -4 -4 -4 0 -3 -3 -4 -4 0 3 -4 5 2 -4 -1 0 -4 -3 1 12 0 0 0 1 0 2 1 0 4 33 0 16 7 0 6 6 0 0 10 0.52 1.10
400 R -1 5 -1 1 -5 1 2 -1 1 -1 -4 2 -2 -4 -2 -2 -3 -4 0 -2 4 33 2 9 0 6 12 5 3 5 1 9 1 0 1 2 1 0 4 2 0.50 1.12
401 N 0 0 0 1 -2 2 3 -1 -3 -1 -2 2 3 -4 -3 0 1 -1 -2 -1 9 5 3 7 1 8 18 4 0 3 4 11 7 0 0 7 7 1 1 3 0.23 1.14
402 F -3 -4 -3 3 -4 -3 -3 -4 -3 0 0 -4 0 6 -4 -3 -3 4 4 -3 2 1 0 19 0 0 1 1 0 4 8 1 2 36 1 1 1 5 17 1 0.90 1.09
403 A 4 -3 -3 -3 0 -2 -1 0 -2 2 1 -3 0 0 -3 -1 -1 2 -3 0 34 1 0 1 2 2 4 6 1 13 12 1 2 4 1 4 4 3 0 6 0.35 1.10
404 A 2 0 2 1 -2 1 1 -1 -2 -3 -2 1 5 -4 -3 0 -2 -4 -4 -3 21 4 8 7 1 5 11 4 1 1 2 10 15 0 0 8 1 0 0 1 0.36 1.14
405 T 1 0 -1 -2 -4 2 -2 -1 1 -3 0 1 -2 -3 -2 2 4 -2 -3 -3 12 6 3 2 0 8 2 5 3 0 9 7 1 1 1 14 25 1 0 0 0.32 1.17
406 I 0 -3 -4 -5 -1 -2 -3 -1 -4 4 2 -3 6 0 -4 -3 -1 -4 -1 0 7 1 0 0 1 1 1 4 0 27 21 1 19 3 0 2 3 0 2 5 0.59 1.17
407 P -1 -1 -2 0 0 3 0 -2 1 -2 -1 2 -3 -3 3 -1 -2 -5 -2 1 5 3 2 6 2 15 6 3 3 2 5 13 0 1 13 4 2 0 1 13 0.26 1.21
408 R 0 6 -3 0 -4 -1 -1 -2 0 -1 -1 3 -3 -4 -1 -3 -1 -5 -4 -3 7 40 0 4 0 2 2 2 2 5 7 18 0 0 3 0 4 0 0 2 0.65 1.20
409 P -3 -1 -2 4 -5 1 2 -4 -4 -4 -3 -1 -4 -6 6 -2 -3 -6 -5 -5 1 3 1 23 0 5 12 1 0 1 3 3 0 0 45 3 0 0 0 0 1.19 1.24
410 F -3 -5 -3 -3 -5 -5 -4 -5 2 -3 0 -5 0 8 -4 -2 -2 -2 0 -3 1 0 1 2 0 0 1 0 6 0 6 0 2 73 1 3 3 0 1 1 1.55 1.22
411 S 3 -3 -2 -1 -4 -1 1 2 -1 0 -3 -1 -2 -3 0 2 0 -5 -3 -2 25 1 1 4 0 2 11 15 1 6 1 3 1 1 5 13 6 0 1 2 0.31 1.27
412 V -1 -3 -5 -3 -1 -4 -4 -4 -5 0 0 -4 -3 -3 6 -3 0 -5 -4 4 5 1 0 1 1 0 0 1 0 4 11 1 0 1 37 1 5 0 0 30 0.93 1.27
413 R -1 5 -2 -2 0 -3 -3 -5 1 0 1 2 -1 -3 -4 -3 -1 1 1 -1 5 31 1 2 2 0 0 0 3 5 17 13 1 0 0 1 4 2 5 5 0.48 1.27
414 Y -4 -4 -3 -3 -5 -4 -3 -2 1 -3 -3 -4 -3 5 -5 -4 -4 -1 8 -4 0 0 1 1 0 0 1 3 3 0 1 0 0 26 0 0 0 0 61 0 1.72 1.23
415 D 0 -2 4 5 -5 1 2 -4 -3 -5 -5 -2 -4 -5 2 -2 -1 -6 -5 -5 8 1 25 30 0 7 12 0 0 0 1 1 0 0 12 0 3 0 0 0 0.85 1.23
416 P 0 0 -1 -3 -5 -2 -2 -4 -2 -4 -4 -2 -4 0 7 -1 -3 -6 -4 -2 9 6 3 0 0 1 2 0 1 1 1 1 0 5 63 4 0 0 0 2 1.50 1.24
417 Y 0 -2 -2 -2 -5 -2 0 -4 1 -1 0 3 -2 1 -4 -3 -2 -2 6 -2 8 1 2 2 0 1 7 1 3 4 11 18 0 6 1 1 2 0 33 1 0.62 1.24
418 T 0 -2 -2 -2 -4 -2 0 -4 1 -2 -3 -2 -3 -1 -2 0 6 -4 3 -2 9 2 1 2 0 1 5 0 3 1 2 1 0 2 2 5 50 0 11 1 0.72 1.25
419 Q 1 1 -2 0 -1 5 2 0 -1 -5 -2 2 -2 -5 -2 -1 -3 -5 -4 -4 12 6 1 4 1 31 13 6 1 0 5 14 1 0 2 3 0 0 0 0 0.56 1.25
420 R 3 1 -1 -1 -1 0 -1 -2 -4 -3 -4 -2 -3 -5 -2 4 3 -5 -4 -3 25 7 2 2 1 5 3 1 0 1 1 1 0 0 2 31 16 0 0 1 0.56 1.24
421 I 0 -4 -2 -2 -4 -4 -4 2 -5 4 0 -3 -2 -3 -2 -2 -1 -5 -4 4 7 0 2 2 0 0 0 16 0 24 6 1 0 0 2 3 3 0 0 32 0.55 1.16
422 E 1 -3 -1 4 -3 1 5 -4 3 -3 -4 -1 -4 -5 -3 -2 -2 -5 -4 -3 12 0 1 21 1 5 42 0 6 2 1 2 0 0 0 2 2 0 0 1 0.80 1.12
423 V 0 -4 -5 -5 -3 -3 -4 -3 -5 4 0 -3 1 -3 -3 -3 -2 -5 -3 6 6 0 0 0 0 1 0 2 0 20 5 2 2 0 1 0 2 0 0 58 0.93 1.10
424 L -1 -4 -5 -5 -4 -2 -5 -5 -5 2 5 -3 0 -1 -5 -2 -2 -4 -3 0 4 0 0 0 0 2 0 0 0 10 70 2 1 2 0 4 2 0 0 3 0.96 1.15
425 D -2 -2 0 6 -5 -2 1 -3 -4 -5 -5 1 -2 -6 3 0 0 -6 -4 -5 3 2 4 42 0 1 6 1 0 0 0 10 1 0 17 5 6 0 1 0 0.86 1.19
426 N -1 -2 2 2 -2 -1 0 2 -1 -5 -5 -1 -4 -3 -2 3 2 -5 -3 -2 3 2 12 12 1 2 6 13 2 0 0 3 0 1 2 26 14 0 1 3 0.44 1.19
427 T -2 -2 -2 5 -5 -1 -1 -4 -4 0 -2 1 -1 -2 2 -2 2 -6 -5 0 3 2 1 37 0 2 3 0 0 5 3 9 1 2 10 2 11 0 0 9 0.56 1.20
428 Q -1 5 -1 1 -4 3 0 -2 2 -4 -3 1 -4 -3 0 -1 -2 -5 -2 -2 5 32 2 7 0 11 6 3 6 1 3 9 0 1 5 5 1 0 1 2 0.50 1.20
429 Q 1 0 -2 -1 -3 2 -3 -3 -2 0 -3 2 0 -4 -4 1 -2 -5 -4 4 12 5 1 3 0 10 0 1 1 4 0 16 2 0 0 13 1 0 0 31 0.44 1.19
430 L -3 -2 -2 -5 -4 -4 -3 -3 -5 5 3 -3 1 0 -5 -4 -3 -4 -1 2 1 2 2 0 0 0 2 2 0 34 32 1 2 4 0 0 0 0 2 15 0.75 1.19
431 K 0 0 2 -2 0 3 1 -4 2 -2 -3 2 -1 -5 -1 -1 3 -5 -4 -2 9 4 9 2 2 13 9 0 6 3 2 11 2 0 3 2 24 0 0 2 0.39 1.20
432 I 0 5 2 0 -3 -1 0 -2 1 -2 -1 -1 -2 -2 -4 0 1 -5 -4 -1 6 32 12 6 0 1 5 2 3 2 6 2 1 1 0 6 8 0 0 5 0.41 1.20
433 L 0 -5 -4 -5 -2 -4 -4 4 1 -2 3 -4 -1 -2 -5 0 -3 -5 -4 1 9 0 0 0 1 0 1 36 4 1 28 0 1 1 0 7 1 0 0 12 0.63 1.20
434 A 1 -4 -2 -3 -2 -4 -3 -3 -5 0 2 -4 1 -1 -1 0 4 -5 -3 2 10 0 1 1 1 0 1 1 0 5 19 0 3 2 3 6 31 0 1 17 0.48 1.20
435 D -1 3 2 0 -3 3 1 3 1 -5 -5 0 -4 -5 -4 1 -2 -2 -3 -5 3 14 11 5 1 15 10 20 3 1 0 5 0 0 0 10 1 1 1 0 0.50 1.19
436 S -3 0 2 3 -2 2 5 -2 1 -5 -5 0 -4 -5 -4 0 -1 -3 -4 -3 1 4 10 17 1 9 36 3 4 0 0 3 0 0 0 8 4 0 0 1 0.69 1.13
437 I -3 -4 -5 -5 -3 -4 -5 -6 -4 4 3 -4 3 0 -5 -4 0 -4 2 3 0 0 0 0 0 0 0 0 0 24 34 0 6 2 0 0 5 0 7 22 0.76 0.93
438 N -3 4 3 -1 -5 3 -1 -3 2 -5 -5 4 -4 -5 -4 1 -2 -5 -4 -5 0 22 17 3 0 16 1 0 5 0 0 24 0 0 0 11 0 0 0 0 0.77 0.92
439 S -1 -3 1 2 -3 0 2 2 4 -4 -1 -3 -3 -2 -4 2 0 -5 -2 -3 3 0 7 11 0 4 12 18 11 1 6 0 0 2 0 17 6 0 1 1 0.37 0.91
440 E -1 -3 0 4 -5 1 5 -1 -2 -5 -5 -2 1 -5 -3 -2 -3 -5 -3 -4 5 0 3 27 0 5 50 5 0 0 0 0 4 0 0 0 0 0 1 0 0.98 0.89
441 I -1 -4 -5 -5 -3 -4 -5 -5 -5 2 4 -4 4 1 -5 -3 -2 -4 -3 2 5 0 0 0 0 0 0 0 0 13 49 0 13 7 0 1 1 0 0 12 0.80 0.89
442 G -2 -2 3 2 1 2 0 0 2 -4 -2 0 -3 -5 -4 2 0 -5 -4 -2 2 1 16 14 4 12 3 8 4 0 4 6 0 0 0 18 5 0 0 3 0.37 0.89
443 I 0 -4 0 -4 -3 0 -3 -4 4 4 0 -2 -1 -3 -4 0 2 -5 -3 1 9 0 4 0 0 4 0 0 11 32 7 1 1 0 0 7 15 0 0 9 0.47 0.89
444 L -3 -4 -5 -5 -3 -4 -1 -6 -5 2 5 -4 1 0 -5 -4 0 -4 -3 2 0 0 0 0 0 0 4 0 0 10 61 0 2 3 0 0 5 0 0 14 0.83 0.89
445 C 0 -2 1 0 5 1 -1 0 -1 -2 -3 -1 1 -3 -4 2 3 -5 -4 -1 7 1 7 4 13 5 4 7 2 1 1 4 3 1 0 14 23 0 0 3 0.37 0.89
446 S -2 -3 4 4 0 -1 1 -2 3 -4 -3 -1 -4 -3 -4 1 2 -5 -1 -3 2 0 21 26 2 2 7 2 7 0 2 3 0 1 0 10 12 0 2 1 0.56 0.89
447 A 6 -4 -3 -4 -3 -3 -3 -2 -4 -3 -1 -3 -3 1 -3 1 -1 -4 -3 -1 77 0 0 0 0 0 0 0 0 0 4 0 0 6 0 8 2 0 0 2 0.97 0.85
448 L 0 -4 -5 -5 -3 -4 -5 -5 -5 1 5 -4 2 0 -5 -4 -3 -4 -3 1 9 0 0 0 0 0 0 0 0 6 71 0 5 2 0 0 0 0 0 7 0.94 0.85
449 Q 0 1 3 1 -2 0 2 0 0 -5 -3 2 -4 -5 -3 2 -2 -5 -4 -3 6 9 18 8 1 3 15 8 2 0 2 12 0 0 0 15 1 0 0 1 0.39 0.85
450 K 0 3 -1 -3 -5 0 -1 -4 -3 -4 -4 6 -2 -5 -3 -1 -1 -5 -1 -1 6 12 2 0 0 1 2 0 0 0 0 66 1 0 0 2 2 0 2 5 0.95 0.83
451 I -3 -4 -5 -4 -1 -4 -5 -5 -5 4 4 -4 6 -1 -5 -4 -3 -4 -3 1 0 0 0 1 1 0 0 0 0 32 39 0 23 1 0 0 0 0 0 4 0.95 0.83
452 K -2 2 -2 -2 -5 4 2 -3 -2 -4 -4 5 -3 -5 -3 -2 -2 -4 -3 -4 0 11 0 0 0 24 10 0 0 0 0 55 0 0 0 0 0 0 0 0 0.91 0.53

MSA with all mammalian homologous

We identified homologous sequences from mammalians with the help of HSSP. We used the entry 1J8U. Then we checked whether the homologous sequences of this entry are from mammalians and whether they are not only a "Fragment". The reason for this is that fragment sequences are very short and may not be very helpful for our alignment. The following entries fulfilled these requirements:

FASTA Header
PDBID|CHAIN|SEQUENCE
P00439|PH4H_HUMAN Phenylalanine-4-hydroxylase OS=Homo sapiens GN=PAH PE=1 SV=1
Q16265|Q16265_HUMAN PAH protein (Fragment) OS=Homo sapiens GN=PAH PE=4 SV=1
Q16021|Q16021_HUMAN PAH protein (Fragment) OS=Homo sapiens GN=PAH PE=2 SV=2
Q8TEY0|Q8TEY0_HUMAN Phenylalanine hydroxylase OS=Homo sapiens GN=PAH PE=2 SV=1
Q16266|Q16266_HUMAN PAH protein (Fragment) OS=Homo sapiens GN=PAH PE=4 SV=1
Q91WV1|Q91WV1_MOUSE Phenylalanine hydroxylase OS=Mus musculus GN=Pah PE=2 SV=1
B2R8I4|B2R8I4_HUMAN cDNA, FLJ93916, highly similar to Homo sapiens phenylalanine hydroxylase (PAH), mRNA OS=Homo sapiens PE=2 SV=1
Q8TEY0|Q8TEY0_HUMAN Phenylalanine hydroxylase OS=Homo sapiens GN=PAH PE=2 SV=1
Q5RDX0|Q5RDX0_PONAB Putative uncharacterized protein DKFZp469G0337 OS=Pongo abelii GN=DKFZp469G0337 PE=2 SV=1
E2R3S1|E2R3S1_CANFA Uncharacterized protein OS=Canis familiaris GN=PAH PE=4 SV=1
E2R366|E2R366_CANFA Uncharacterized protein OS=Canis familiaris GN=PAH PE=4 SV=1
Q91WV1|Q91WV1_MOUSE Phenylalanine hydroxylase OS=Mus musculus GN=Pah PE=2 SV=1
Q3UEH8|Q3UEH8_MOUSE Putative uncharacterized protein OS=Mus musculus GN=Pah PE=2 SV=1
P16331|PH4H_MOUSE Phenylalanine-4-hydroxylase OS=Mus musculus GN=Pah PE=1 SV=3
Q2KIH7|PH4H_BOVIN Phenylalanine-4-hydroxylase OS=Bos taurus GN=PAH PE=2 SV=1
D3Z270|D3Z270_MOUSE Uncharacterized protein OS=Mus musculus GN=Pah PE=4 SV=1
P04176|PH4H_RAT Phenylalanine-4-hydroxylase OS=Rattus norvegicus GN=Pah PE=1 SV=3
Q8HXR0|Q8HXR0_MACMU Tryptophan hydroxylase (Fragment) OS=Macaca mulatta GN=TPH PE=2 SV=1
Q6AYW2|Q6AYW2_RAT Phenylalanine hydroxylase OS=Rattus norvegicus GN=Pah PE=2 SV=1
B4DPN2|B4DPN2_HUMAN cDNA FLJ56667, highly similar to Phenylalanine-4-hydroxylase (EC 1.14.16.1) OS=Homo sapiens PE=2 SV=1
Q14CC5|Q14CC5_HUMAN TPH2 protein OS=Homo sapiens GN=TPH2 PE=2 SV=1
Q8IWU9|TPH2_HUMAN Tryptophan 5-hydroxylase 2 OS=Homo sapiens GN=TPH2 PE=1 SV=1
Q2HZ26|TPH2_MACMU Tryptophan 5-hydroxylase 2 OS=Macaca mulatta GN=TPH2 PE=2 SV=1
Q8CGU9|TPH2_RAT Tryptophan 5-hydroxylase 2 OS=Rattus norvegicus GN=Tph2 PE=2 SV=1
P17752|TPH1_HUMAN Tryptophan 5-hydroxylase 1 OS=Homo sapiens GN=TPH1 PE=1 SV=4
Q86Y20|Q86Y20_HUMAN Tryptophan hydroxylase (Fragment) OS=Homo sapiens PE=2 SV=1
Q86WC5|Q86WC5_HUMAN Tryptophan hydroxylase (Fragment) OS=Homo sapiens PE=2 SV=1
Q86Y19|Q86Y19_HUMAN Tryptophan hydroxylase (Fragment) OS=Homo sapiens PE=2 SV=1
Q9JHZ8|Q9JHZ8_MOUSE Tryptophan hydroxylase (Fragment) OS=Mus musculus GN=Tph1 PE=2 SV=1
Q8K3R1|Q8K3R1_MESAU Tryptophane hydroxylase OS=Mesocricetus auratus PE=2 SV=1
E1BGX6|E1BGX6_BOVIN Uncharacterized protein OS=Bos taurus GN=TPH2 PE=4 SV=1
Q0EAB8|TPH2_HORSE Tryptophan 5-hydroxylase 2 OS=Equus caballus GN=TPH2 PE=2 SV=1
Q0VBT4|Q0VBT4_MOUSE Tryptophan hydroxylase 2 OS=Mus musculus GN=Tph2 PE=2 SV=1
B6EY10|B6EY10_CANFA Tryptophan hydroxylase 1 isoform 1 OS=Canis familiaris GN=TPH1 PE=2 SV=1
Q8CGV2|TPH2_MOUSE Tryptophan 5-hydroxylase 2 OS=Mus musculus GN=Tph2 PE=2 SV=1
P09810|TPH1_RAT Tryptophan 5-hydroxylase 1 OS=Rattus norvegicus GN=Tph1 PE=2 SV=2
P17290|TPH1_RABIT Tryptophan 5-hydroxylase 1 OS=Oryctolagus cuniculus GN=TPH1 PE=1 SV=2
P17532|TPH1_MOUSE Tryptophan 5-hydroxylase 1 OS=Mus musculus GN=Tph1 PE=2 SV=1
Q3UK52|Q3UK52_MOUSE Tryptophan hydroxylase 1 OS=Mus musculus GN=Tph1 PE=2 SV=1
Q76IQ3|TY3H_CANFA Tyrosine 3-monooxygenase OS=Canis familiaris GN=TH PE=2 SV=1
P04177|TY3H_RAT Tyrosine 3-monooxygenase OS=Rattus norvegicus GN=Th PE=1 SV=3
Q8IZE2|Q8IZE2_HUMAN Putative tyrosine hydroxylase variant (Fragment) OS=Homo sapiens PE=2 SV=1
Q8IZE1|Q8IZE1_HUMAN Truncated tyrosine hydroxylase (Fragment) OS=Homo sapiens PE=2 SV=1
Q8N1X9|Q8N1X9_HUMAN cDNA FLJ37295 fis, clone BRAMY2015311, moderately similar to TRYPTOPHAN 5-MONOOXYGENASE (EC 1.14.16.4) OS=Homo sapiens PE=2 SV=1
Q8MJD2|Q8MJD2_RABIT Tyrosine hydroxylase (Fragment) OS=Oryctolagus cuniculus PE=2 SV=1
Q8HY50|Q8HY50_RABIT Tyrosine hydroxylase (Fragment) OS=Oryctolagus cuniculus PE=2 SV=1
Q95LQ6|Q95LQ6_HORSE Tyrosine hydroxylase (Fragment) OS=Equus caballus GN=TH PE=2 SV=1
Q8HZ55|Q8HZ55_PANTR Tyrosine hydroxylase (Fragment) OS=Pan troglodytes PE=4 SV=1
Q8HZ54|Q8HZ54_9PRIM Tyrosine hydroxylase (Fragment) OS=Gorilla gorilla PE=4 SV=1
Q8MIU1|Q8MIU1_PIG Tyrosine hydroxylase (Fragment) OS=Sus scrofa PE=4 SV=1
Q8HZ53|Q8HZ53_PONPY Tyrosine hydroxylase (Fragment) OS=Pongo pygmaeus PE=4 SV=1
Q8HXJ0|Q8HXJ0_MACFA Putative uncharacterized protein OS=Macaca fascicularis PE=2 SV=1
P97517|P97517_PHOSU Tyrosine hydroxylase (Fragment) OS=Phodopus sungorus PE=2 SV=1
P07101|TY3H_HUMAN Tyrosine 3-monooxygenase OS=Homo sapiens GN=TH PE=1 SV=5
Q2M3B4|Q2M3B4_HUMAN Tyrosine hydroxylase OS=Homo sapiens GN=TH PE=2 SV=1
B6EY12|B6EY12_CANFA Tryptophan hydroxylase 2 OS=Canis familiaris GN=TPH2 PE=2 SV=1
B7ZL73|B7ZL73_HUMAN TH protein OS=Homo sapiens GN=TH PE=2 SV=1
E0V877|E0V877_MICOH Tyrosine hydroxylase OS=Microtus ochrogaster GN=TH PE=4 SV=1
Q3UTB3|Q3UTB3_MOUSE Putative uncharacterized protein OS=Mus musculus GN=Th PE=2 SV=1
Q76IQ3|TY3H_CANFA Tyrosine 3-monooxygenase OS=Canis familiaris GN=TH PE=2 SV=1
Q8K3R1|Q8K3R1_MESAU Tryptophane hydroxylase OS=Mesocricetus auratus PE=2 SV=1
P24529|TY3H_MOUSE Tyrosine 3-monooxygenase OS=Mus musculus GN=Th PE=1 SV=3
B3RFH4|B3RFH4_SORAR Tyrosine 3-monooxygenase (Predicted) OS=Sorex araneus GN=TH PE=4 SV=1
B7NZU5|B7NZU5_RABIT Tyrosine hydroxylase isoform b (Predicted) OS=Oryctolagus cuniculus GN=TH PE=4 SV=1
Q0PWM3|Q0PWM3_HUMAN Tyrosine hydroxylase isoform D1b,2,8,9 OS=Homo sapiens GN=TH PE=2 SV=1
Q0PWM2|Q0PWM2_HUMAN Tyrosine hydroxylase isoform D2,8,9 OS=Homo sapiens GN=TH PE=2 SV=1
B2KIN8|B2KIN8_RHIFE Tyrosine hydroxylase (Predicted) OS=Rhinolophus ferrumequinum GN=TH PE=4 SV=1
P17289|TY3H_BOVIN Tyrosine 3-monooxygenase OS=Bos taurus GN=TH PE=1 SV=5
Q8HXJ0|Q8HXJ0_MACFA Putative uncharacterized protein OS=Macaca fascicularis PE=2 SV=1
B6EY11|B6EY11_CANFA Tryptophan hydroxylase 1 isoform 2 OS=Canis familiaris GN=TPH1 PE=2 SV=1
Q3TZH2|Q3TZH2_MOUSE Putative uncharacterized protein OS=Mus musculus GN=Tph1 PE=2 SV=1
Q8N1X9|Q8N1X9_HUMAN cDNA FLJ37295 fis, clone BRAMY2015311, moderately similar to TRYPTOPHAN 5-MONOOXYGENASE (EC 1.14.16.4) OS=Homo sapiens PE=2 SV=1
Q08EN2|Q08EN2_HUMAN TPH1 protein OS=Homo sapiens GN=TPH1 PE=2 SV=1


After we had all our FASTA sequences we used t-coffee 3D to create our MSA. We utilized the following command to create our MSA with the structure of 1J8U as reference:

  • t_coffee ../homo_seq.fasta -method sap_pair,slow_pair -template_file 1J8U

The resulting MSA is as follows:

T coffee homo ali pah.png

I65T

R71H

R158Q

R261Q

T266A

P275S

T278N

P281L

G312D

R408W

Mutations and secondary structure

Predicted secondary structure

We took the secondary structure prediction from Task 3:

Reference MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAK
1PHZ ------------------GQETSYIEDNSNQNGAISLIFSLKEEVGALAK
DSSP --------------------------------------------------
PSIPRED CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCHHHHH
JPred --HHHH--HHHHHHHHHH---------------EEEEEEEE----HHHHH
Reference VLRLFEENDVNLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRH
1PHZ VLRLFEENDINLTHIESRPSRLNKDEYEFFTYLDKRTKPVLGSIIKSLRN
DSSP --------------------------------------------------
PSIPRED HHHHHHHCCCCEEEEECCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHCC
JPred HHHHHHH---EEEEEE----------EEEEEEEE---HHHHHHHHHHHHH
Reference DIGATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPGFK
1PHZ DIGATVHELSRDKEKNTVPWFPRTIQELDRFANQI------LDADHPGFK
DSSP -----------------.....SBGGGGGGTT.S.------..TTSTTTT
PSIPRED CCEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCC
JPred H-----EEE----------------HHHHHH---EEE-------------
Reference DPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKT
1PHZ DPVYRARRKQFADIAYNYRHGQPIPRVEYTEEEKQTWGTVFRTLKALYKT
DSSP .HHHHHHHHHHHHHHHH..TTS........HHHHHHHHHHHHHHHHHHHH
PSIPRED CHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCC
JPred -HHHHHHHHHHHH-----------------HHHHHHHHHHHHHHHHH---
Reference HACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLS
1PHZ HACYEHNHIFPLLEKYCGFREDNIPQLEDVSQFLQTCTGFRLRPVAGLLS
DSSP HB.HHHHHHHHHHHHHS..BTTB...HHHHHHHHHHHT..EEEE.SS...
PSIPRED CHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCEEEECCCCCC
JPred --HHHHHHHHHHHHHH----------HHHHHHHHHHH---EEEE------
Reference SRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFA
1PHZ SRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFA
DSSP HHHHHHHHTTTEEEE......TT.TT..SS..HHHHHTTTTTTTTSHHHH
PSIPRED HHHHHHHCCCCEECCCEEEECCCCCCCCCCCCHHHHHHCCCCCCCCCHHH
JPred HHHHHHHH----EEEEEEE-----------HHHHHHHH--------HHHH
Reference QFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSS
1PHZ QFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKEGDSIKAYGAGLLSS
DSSP HHHHHHHHHHTT..HHHHHHHHHHHHTTTTT.EEEETTEEEE..HHHHT.
PSIPRED HHHHHHHHHCCCCCHHHHHHHHHHEEEEEEEEEECCCCCEEEECCCCCCC
JPred HHHHHHHHHHH---HHHHHHHHH-HHHEEEEEEEEE---EEEEE------
Reference FGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVR
1PHZ FGELQYCLSDKPKLLPLELEKTACQEYSVTEFQPLYYVAESFSDAKEKVR
DSSP HHHHHHTTSSSS..EE..HHHHTT....SSS..S..EEES.HHHHHHHHH
PSIPRED HHHHHHHHCCCCCCCCCCHHHHHCCCCCCCCCCEEEEEECCHHHHHHHHH
JPred HHHHHHHH-----EE---HHHHH-----------EEEE---HHHHHHHHH
Reference NFAATIPRPFSVRYDPYTQRIEVLDNTQQLKILADSINSEIGILCSALQK
1PHZ TFAATIPRPFSVRYDPYTQRVEVLDNT-----------------------
DSSP HHHHTS..SSEEEEETTTTEEEEE.HHHHHHHHHHHHHHHHHHHHHHHHH
PSIPRED HHHHHCCCCCEEEECCCCCEEEECCCHHHHHHHHHHHHHHHHHHHHHHHH
JPred HHHHHH------------EEEEE---HHHHHHHHHHHHHHHHHHHHHHHH
Reference IK
1PHZ --
DSSP T.
PSIPRED HC
JPred --


I65T

R71H

R158Q

R261Q

T266A

P275S

T278N

P281L

G312D

R408W

Predicting the effect of mutations with SNAP, SIFT and Polyphen2

SNAP

Execution

snapfun -i reference.fasta -m mutations.txt -o markus_snap.txt

Result

mutation effect Reliability Expected Accuracy
R408W Non-neutral 4 82%
I65T Non-neutral 5 87%
R261Q Non-neutral 5 87%
G312D Non-neutral 1 63%
R71H Neutral 0 53%
P281L Non-neutral 3 78%
R158Q Non-neutral 6 93%
P275S Non-neutral 2 70%
T266A Non-neutral 2 70%
T278N Non-neutral 4 82%

SIFT

Execution

To run our predictions with SIFT we used the webservice. We had the following input (See also figure):

SIFT input
  • Sequence: Fasta sequence from the Uniprot entry P00439.
  • Substitutions: our ten selected substitutions
  • Database to search: UniRef90_2011_Apr
  • Median conservation of sequences: 3.00
  • Removed sequences: If sequence identity is greater than 90%

Results

Position Reference AA Mutated AA Predicted effect Score Median sequence conservation Sequences represented at this position
65 I T AFFECT PROTEIN FUNCTION 0 3.03 64
71 R H AFFECT PROTEIN FUNCTION 0.05 3.03 64
158 R Q AFFECT PROTEIN FUNCTION 0 3 64
261 R Q AFFECT PROTEIN FUNCTION 0 3.01 65
266 T A AFFECT PROTEIN FUNCTION 0 3.01 65
275 P S AFFECT PROTEIN FUNCTION 0 3.01 65
278 T N AFFECT PROTEIN FUNCTION 0 3.01 65
281 P L AFFECT PROTEIN FUNCTION 0 3.01 65
312 G D AFFECT PROTEIN FUNCTION 0 3.01 65
408 R W AFFECT PROTEIN FUNCTION 0 3 64

Polyphen2

Execution

To run our predictions with Polyphen2 we used the webservice. We had the following input (See also figure):

Polyphen2 input
  • Sequence: Fasta sequence from the Uniprot entry P00439.
  • Substitutions: our ten selected substitutions
  • Classifier model: HumDiv
  • Genome assembly: GRCh37/hg19
  • Transcripts: canonical
  • Annotations: missense

Results

#o_snp_id snp_id acc pos aa1 aa2 prediction pph2_prob pph2_FPR ph2_TPR
P00439_I65T P00439_I65T P00439 65 I T probably damaging 1 0.0001 0.0002
P00439_R71H P00439_R71H P00439 71 R H possibly damaging 0.936 0.0539 0.796
P00439_R158Q P00439_R158Q P00439 158 R Q probably damaging 1 0.0001 0.0002
P00439_R261Q rs5030849 P00439 261 R Q probably damaging 1 0.0001 0.0002
P00439_T266A P00439_T266A P00439 266 T A probably damaging 1 0.0001 0.0002
P00439_P275S P00439_P275S P00439 275 P S probably damaging 1 0.0001 0.0002
P00439_T278N P00439_T278N P00439 278 T N probably damaging 0.998 0.0114 0.269
P00439_P281L P00439_P281L P00439 281 P L probably damaging 1 0.0001 0.0002
P00439_G312D P00439_G312D P00439 312 G D probably damaging 1 0.0001 0.0002
P00439_R408W P00439_R408W P00439 408 R W probably damaging 1 0.0001 0.0002

I65T

R71H

R158Q

R261Q

T266A

P275S

T278N

P281L

G312D

R408W

Discussion