Task 6: Sequence-based mutation analysis

From Bioinformatikpedia
Revision as of 18:47, 24 June 2011 by Pfeiffenberger (talk | contribs) (Polyphen2)

Task description

A detailed task description can be found here.

Mutation selection

We selected the following ten mutations:

  • I65T
  • R71H
  • R158Q
  • R261Q
  • T266A
  • P275S
  • T278N
  • P281L
  • G312D
  • R408W

5 of these mutations are associated with our disease phenylketonuria the other 5 not. The 5 disease causing mutations are the most frequent missense/nonsense mutations of people who suffer from phenylketonuria. These numbers were taken from pahDB. However, at this point we are not going to tell which of these are the associated and which are not. We are going to lift this "secret" after our sequence based mutation analysis in order to validate our in silico generated predictions.

To keep our association secret we encrypted the file which contains the disease association for each mutation with the following linux command: "vim -x selected_mutations_and_association.txt"

The encrypted output is as follows:

Encrypted img.png


The decryption can be only performed with the correct password.

Physicochemical properties and changes

I65T

R71H

R158Q

R261Q

T266A

P275S

T278N

P281L

G312D

R408W

Mutations compared to BLOSUM62, PAM(1/250), PSSM and conservation of MSA with all mammalian homologous

BLOSUM 62 matrix

BLOSUM 62 Matrix
BLOSUM62 BCKDHA.gif
The BLOSUM 62 was calculated from blocks of clusters with a sequence identity of 62%. A positive score is given to the more likely substitutions while a negative score is given to the less likely substitutions. Source: [1] Disclaimer: This file is redistributed from Wikimedia and copyrighted under the Creative Commons licence.

PAM 1/250 matrix

PAM1 Matrix

A R N D C Q E G H I L K M F P S T W Y V
A 9867 2 9 10 3 8 17 21 2 6 4 2 6 2 22 35 32 0 2 18
R 1 9913 1 0 1 10 0 0 10 3 1 19 4 1 4 6 1 8 0 1
N 4 1 9822 36 0 4 6 6 21 3 1 13 0 1 2 20 9 1 4 1
D 6 0 42 9859 0 6 53 6 4 1 0 3 0 0 1 5 3 0 0 1
C 1 1 0 0 9973 0 0 0 1 1 0 0 0 0 1 5 1 0 3 2
Q 3 9 4 5 0 9876 27 1 23 1 3 6 4 0 6 2 2 0 0 1
E 10 0 7 56 0 35 9865 4 2 3 1 4 1 0 3 4 2 0 1 2
G 21 1 12 11 1 3 7 9935 1 0 1 2 1 1 3 21 3 0 0 5
H 1 8 18 3 1 20 1 0 9912 0 1 1 0 2 3 1 1 1 4 1
I 2 2 3 1 2 1 2 0 0 9872 9 2 12 7 0 1 7 0 1 33
L 3 1 3 0 0 6 1 1 4 22 9947 2 45 13 3 1 3 4 2 15
K 2 37 25 6 0 12 7 2 2 4 1 9926 20 0 3 8 11 0 1 1
M 1 1 0 0 0 2 0 0 0 5 8 4 9874 1 0 1 2 0 0 4
F 1 1 1 0 0 0 0 1 2 8 6 0 4 9946 0 2 1 3 28 0
P 13 5 2 1 1 8 3 2 5 1 2 2 1 1 9926 12 4 0 0 2
S 28 11 34 7 11 4 6 16 2 2 1 7 4 3 17 9840 38 5 2 2
T 22 2 13 4 1 3 2 2 1 11 2 8 6 1 5 32 9871 0 2 9
W 0 2 0 0 0 0 0 0 0 0 0 0 0 1 0 1 0 9976 1 0
Y 1 0 3 0 3 0 1 0 4 1 1 0 0 21 0 1 1 2 9945 1
V 13 2 1 1 3 2 2 3 3 57 11 1 17 1 3 2 10 0 2 9901

PAM250 Matrix

A R N D C Q E G H I L K M F P S T W Y V
A 13 6 9 9 5 8 9 12 6 8 6 7 7 4 11 11 11 2 4 9
R 3 17 4 3 2 5 3 2 6 3 2 9 4 1 4 4 3 7 2 2
N 4 4 6 7 2 5 6 4 6 3 2 5 3 2 4 5 4 2 3 3
D 5 4 8 11 1 7 10 5 6 3 2 5 3 1 4 5 5 1 2 3
C 2 1 1 1 52 1 1 2 2 2 1 1 1 1 2 3 2 1 4 2
Q 3 5 5 6 1 10 7 3 7 2 3 5 3 1 4 3 3 1 2 3
E 5 4 7 11 1 9 12 5 6 3 2 5 3 1 4 5 5 1 2 3
G 12 5 10 10 4 7 9 27 5 5 4 6 5 3 8 11 9 2 3 7
H 2 5 5 4 2 7 4 2 15 2 2 3 2 2 3 3 2 2 3 2
I 3 2 2 2 2 2 2 2 2 10 6 2 6 5 2 3 4 1 3 9
L 6 4 4 3 2 6 4 3 5 15 34 4 20 13 5 4 6 6 7 13
K 6 18 10 8 2 10 8 5 8 5 4 24 9 2 6 8 8 4 3 5
M 1 1 1 1 0 1 1 1 1 2 3 2 6 2 1 1 1 1 1 2
F 2 1 2 1 1 1 1 1 3 5 6 1 4 32 1 2 2 4 20 3
P 7 5 5 4 3 5 4 5 5 3 3 4 3 2 20 6 5 1 2 4
S 9 6 8 7 7 6 7 9 6 5 4 7 5 3 9 10 9 4 4 6
T 8 5 6 6 4 5 5 6 4 6 4 6 5 3 6 8 11 2 3 6
W 0 2 0 0 0 0 0 0 1 0 1 0 0 1 0 1 0 55 1 0
Y 1 1 2 1 3 1 1 1 3 2 2 1 2 15 1 2 2 3 31 2
V 7 4 4 4 4 4 4 4 5 4 15 10 4 10 5 5 5 72 4 17

PSSM

Position AA A R N D C Q E G H I L K M F P S T W Y V A R N D C Q E G H I L K M F P S T W Y V
1 M -3 -4 -5 -5 -3 -3 -4 -5 -4 0 5 -4 7 -1 -5 -4 -3 -3 -3 -1 0 0 0 0 0 0 0 0 0 0 66 0 34 0 0 0 0 0 0 0 1.13 0.65
2 S 4 -3 1 -3 -3 -3 -2 1 1 -4 -4 -3 -3 -5 -3 3 -1 -5 -4 -3 46 0 8 0 0 0 2 11 4 0 0 0 0 0 0 28 1 0 0 0 0.75 0.91
3 T 2 -3 2 -3 -4 -3 -3 2 2 -5 -5 -3 -4 -4 -2 4 1 3 -3 -4 19 0 9 0 0 0 0 13 6 0 0 0 0 0 1 39 9 5 0 0 0.68 1.04
4 A 2 -3 0 -1 -4 -3 -3 -1 -4 0 1 1 -2 -4 -4 2 -2 -5 -4 3 18 0 5 3 0 0 1 4 0 4 14 9 0 0 0 17 1 0 0 25 0.35 1.10
5 V -1 -5 -4 -5 3 -1 -3 -5 -5 5 0 -4 0 -3 -3 0 2 -5 -4 3 4 0 0 0 5 3 1 0 0 37 6 0 1 0 1 6 16 0 0 18 0.67 1.15
6 L 4 -1 -4 -2 -4 1 0 -2 -4 0 2 2 -2 -3 -4 -2 -3 -5 0 -1 33 3 0 2 0 7 6 2 0 5 20 13 0 1 0 1 0 0 3 4 0.39 1.19
7 E -2 -1 3 3 -6 0 5 -2 -3 -3 -5 0 -5 -6 -1 -1 -3 -6 -5 -5 3 3 17 17 0 2 42 2 0 2 0 5 0 0 2 4 1 0 0 0 0.86 1.21
8 N -3 1 4 4 -2 -3 -1 -1 0 -2 -5 1 -3 -5 0 2 -2 -6 -4 -5 0 9 24 24 1 0 2 4 2 3 0 7 1 0 5 15 1 0 0 0 0.65 1.26
9 P 1 -3 -1 -4 -4 -4 -4 -2 -1 4 -3 -1 -3 -2 5 0 -2 -5 1 -2 15 1 3 0 0 0 0 3 2 29 0 4 0 1 26 9 1 0 6 0 0.67 1.28
10 G 1 -2 1 -2 -5 0 3 2 0 -3 -1 -2 -4 -5 1 1 -1 -5 -3 -3 10 1 6 1 0 4 24 17 2 1 6 1 0 0 7 11 4 0 1 2 0.36 1.25
11 L -1 -4 2 4 -5 -3 0 -3 -4 -2 3 -3 -3 -2 -2 1 -2 -5 -1 -3 4 0 10 26 0 0 4 1 0 2 34 1 0 1 2 10 2 0 2 0 0.54 1.30
12 G 0 0 2 0 -5 0 1 2 1 -5 -4 0 -4 -5 -3 1 3 -5 -2 -3 8 5 11 6 0 4 11 13 3 0 1 6 0 0 1 10 19 0 1 1 0.35 1.31
13 R -2 3 0 -3 -5 2 3 -4 -3 -5 -3 2 -4 -5 4 1 1 -6 -5 -4 2 17 4 0 0 8 17 0 0 0 3 11 0 0 18 12 7 0 0 1 0.58 1.34
14 K -3 1 4 1 -4 1 2 -4 1 3 -3 2 -4 -2 -4 1 -2 -5 -2 -2 1 8 18 7 0 7 14 0 3 16 1 11 0 2 0 10 1 0 1 2 0.42 1.36
15 L -3 -3 4 0 -5 -1 3 -1 -2 1 1 -2 -3 4 -5 -2 -3 -4 -2 -3 1 1 19 3 0 2 23 6 0 10 14 2 0 16 0 2 0 0 1 0 0.49 1.33
16 S -3 -3 2 4 -5 -1 0 -4 -1 -1 -1 0 0 -1 -2 2 1 -5 -1 1 0 0 10 23 0 2 6 0 1 3 6 6 2 2 2 13 10 0 2 10 0.35 1.34
17 D -3 0 2 4 -5 -2 1 -1 0 0 -3 0 -1 -3 -4 -1 3 -5 -2 0 1 6 10 23 0 1 8 4 3 5 2 5 2 1 0 3 18 0 1 8 0.39 1.33
18 F -1 3 -4 -3 -3 -2 1 -1 1 -1 1 -1 -3 3 1 -1 -2 -4 0 -1 6 20 0 1 1 1 10 5 4 4 15 3 0 11 7 6 1 0 3 3 0.26 1.31
19 G -1 -3 3 1 -5 0 -3 3 0 -4 -2 -2 0 5 -5 -1 -2 -4 -3 -4 4 1 16 8 0 4 1 25 2 1 4 2 3 22 0 3 2 0 0 1 0.56 1.34
20 Q -3 2 5 0 -5 1 0 -2 -1 -1 2 2 -3 -1 -4 -3 -3 -5 -4 -2 1 10 28 5 0 5 5 2 1 4 18 13 0 3 1 0 0 0 0 3 0.48 1.37
21 E 0 -2 -1 1 -4 0 3 -3 -3 0 -3 1 -3 1 -4 1 1 -5 -1 1 6 1 3 7 0 3 21 2 0 6 1 10 0 6 0 10 10 0 2 11 0.27 1.35
22 T 1 -2 -1 -2 -3 -3 -2 1 -4 2 -1 -1 -2 -3 -3 1 4 -4 -3 0 11 1 3 2 0 0 2 11 0 15 4 3 1 1 1 11 26 0 1 7 0.36 1.30
23 S 0 3 -1 0 -4 -2 -2 1 -3 1 -2 -1 -3 -3 -2 3 -1 -4 -4 -1 8 16 3 5 0 1 1 12 0 8 4 4 0 1 2 28 2 0 0 4 0.35 1.28
24 Y -2 -1 -2 -2 -2 0 2 -3 0 1 -2 0 -2 5 -4 -1 -3 -2 5 -2 3 3 1 3 1 4 13 2 2 8 2 6 1 23 0 4 1 0 20 2 0.55 1.30
25 I -2 -1 -1 -2 -3 1 -1 -3 1 3 1 0 -1 -2 0 1 -1 -5 -3 2 3 3 4 3 1 6 3 2 4 17 15 6 1 1 5 10 4 0 1 14 0.19 1.31
26 E 0 -2 -1 1 -4 0 3 -3 -3 -3 -3 2 -1 1 1 0 -3 -2 -4 1 8 2 3 8 0 4 21 1 0 1 2 15 1 6 7 8 1 1 0 11 0.30 1.33
27 D -2 0 0 3 -2 -1 4 -3 -2 0 -3 -1 -3 -3 1 0 0 -5 -4 0 3 5 4 16 1 1 27 2 1 6 3 4 0 1 8 6 6 0 0 6 0.38 1.33
28 N 1 -3 3 2 -5 -1 3 2 1 -5 -4 0 -4 -5 1 0 -1 -5 -4 -2 12 1 12 10 0 2 18 17 4 0 2 5 0 0 7 5 3 0 0 3 0.39 1.33
29 C -1 1 0 -1 2 -1 2 -4 1 -1 -3 2 -3 0 4 0 -2 -2 -4 0 5 8 4 3 4 2 13 1 4 4 1 12 0 5 17 7 2 1 0 7 0.30 1.33
30 N -1 -2 3 3 -3 0 0 -3 0 -4 -4 0 -3 -4 -3 3 3 -5 -3 -3 5 2 12 16 0 4 6 1 3 0 1 5 1 1 1 26 16 0 1 1 0.51 1.33
31 Q -1 -2 0 -1 -4 0 1 5 -3 0 -4 -2 -3 -4 -1 0 -2 -2 0 -1 5 1 4 2 0 4 11 44 0 7 1 2 0 0 3 6 1 0 4 4 0.59 1.28
32 N 0 2 3 2 -1 -1 -1 -2 1 -2 -3 3 -2 -5 0 0 -2 -6 -4 0 6 12 15 13 1 2 2 3 3 2 1 19 1 0 5 6 1 0 0 7 0.36 1.33
33 G 1 -3 -1 5 -1 2 0 0 0 -1 -4 0 -2 -4 -4 -1 -2 -5 0 -2 13 1 2 36 1 9 4 8 2 4 0 6 1 0 0 3 1 0 4 3 0.54 1.28
34 A -2 3 0 -3 -1 0 0 -4 -3 -2 -1 5 -2 -5 -4 -1 0 -5 -4 -1 2 17 5 0 1 4 6 1 0 2 7 39 1 0 0 5 6 0 0 5 0.62 1.31
35 I 1 -4 -3 -4 -4 -1 -3 -4 -4 2 0 -2 1 0 -4 -1 6 -5 -4 0 10 0 1 0 0 3 1 0 0 11 10 2 3 3 0 1 50 0 0 5 0.76 1.33
36 S 2 -3 1 -1 2 -3 -2 -3 -4 -3 -5 -2 -4 -5 -3 5 2 -3 -4 -3 13 1 5 4 4 0 1 0 0 1 0 2 0 0 1 53 12 0 0 1 0.85 1.34
37 L -4 -5 -6 -6 -1 -5 -5 -6 -5 5 4 -5 1 0 -5 -5 -3 -5 -4 3 0 0 0 0 1 0 0 0 0 31 41 0 3 3 0 0 0 0 0 18 1.05 1.36
38 I -1 -2 -4 -5 -2 0 -2 -6 -5 4 3 -4 2 0 -5 -4 -3 -5 -4 3 4 2 1 0 1 4 2 0 0 28 23 0 5 4 0 0 1 0 0 24 0.70 1.36
39 F -3 -5 -6 -6 -1 -5 -6 -6 -5 2 1 -5 1 7 -6 -5 -3 -3 -1 2 1 0 0 0 1 0 0 0 0 10 14 0 3 54 0 0 1 0 0 15 1.28 1.36
40 S 0 1 -3 -3 -2 -2 -2 -2 2 0 -4 -2 -3 -2 -4 5 3 -5 -2 -3 8 6 0 0 1 1 2 2 5 6 0 2 0 1 0 49 15 0 1 1 0.71 1.36
41 L 0 -4 -4 -5 -2 -2 -5 -4 -5 1 4 -4 2 -2 1 -1 1 -5 -4 2 7 0 0 0 1 2 0 1 0 7 42 0 4 1 7 5 10 0 0 12 0.58 1.40
42 K -2 4 1 -1 -3 0 1 -4 2 -4 -4 4 -4 -5 2 0 -1 -6 -4 -3 3 21 8 3 1 3 7 0 5 1 1 25 0 0 9 7 3 0 0 2 0.58 1.39
43 E -3 -1 5 5 -6 -2 2 -4 2 -6 -6 -2 -5 -5 -4 -1 -2 -6 0 -4 1 3 31 36 0 0 11 0 5 0 0 1 0 0 1 3 2 0 4 1 1.06 1.39
44 E -3 3 0 -2 -6 2 3 1 -1 -5 -5 4 -3 -5 -2 -1 -3 -5 1 -3 1 16 4 1 0 9 20 10 1 0 0 24 0 0 2 4 1 0 5 2 0.59 1.40
45 V 1 -4 -5 -5 2 -3 -4 -5 -5 1 -2 -1 3 -2 5 -1 0 -1 -2 3 10 0 0 0 4 1 0 0 0 7 2 3 7 1 28 5 7 1 1 23 0.67 1.38
46 G -2 -4 1 -3 -5 -1 -2 6 -4 -4 -6 -3 -5 -6 0 0 -1 -5 -5 -5 1 0 7 1 0 3 3 69 0 1 0 0 0 0 5 5 4 0 0 0 1.29 1.36
47 A 4 -2 -1 -1 -1 -3 -1 1 -3 -2 -4 -3 -2 0 -1 3 0 -5 -4 -2 40 1 2 3 1 0 4 9 0 2 1 0 1 4 3 23 5 0 0 2 0.57 1.36
48 L -4 -5 -6 -6 -4 -5 -6 -6 -6 0 6 -5 2 0 -6 -5 -4 -4 -4 0 1 0 0 0 0 0 0 0 0 4 83 0 4 2 0 0 0 0 0 6 1.41 1.38
49 A 3 -1 -4 -4 1 -2 -2 -1 3 -2 -2 -1 -2 1 -2 2 -1 -4 4 1 21 3 0 0 3 1 2 3 8 1 3 4 1 5 2 19 2 0 14 9 0.39 1.38
50 K -2 4 2 2 -5 0 2 -4 2 -5 -5 3 1 -5 -4 0 -1 -6 -4 -5 2 24 9 10 0 4 13 0 5 0 0 18 3 0 0 7 3 0 0 0 0.63 1.38
51 V 3 -5 -4 -5 -1 -5 -5 -5 -5 4 2 -5 2 -2 -5 -2 0 -5 -2 2 25 0 1 0 1 0 0 0 0 27 19 0 4 1 0 2 5 0 2 14 0.66 1.39
52 L -2 -5 -6 -6 -1 -5 -6 -4 -6 1 6 -5 0 -1 -6 -5 -4 -4 -2 -1 3 0 0 0 1 0 0 1 0 6 84 0 1 2 0 0 0 0 1 2 1.36 1.39
53 R 1 2 0 0 -3 2 2 -1 -3 -5 -5 4 -2 -6 -4 1 -1 -6 -3 -3 12 9 5 4 0 7 12 3 0 0 0 31 1 0 0 9 2 0 1 2 0.52 1.39
54 L -1 -5 1 -4 -3 -4 -1 -5 -2 3 1 -3 -1 -3 4 -1 0 -3 -1 3 5 0 6 0 0 0 4 0 1 17 12 1 1 0 20 5 5 0 2 21 0.50 1.41
55 F -5 -5 -6 -6 -5 -6 -6 -6 -4 1 1 -5 1 8 -6 -5 -5 -2 1 -2 0 0 0 0 0 0 0 0 0 9 14 1 3 70 0 0 0 0 2 2 1.71 1.41
56 E 2 0 -2 0 -5 2 3 -3 1 -4 -5 3 -4 -4 -2 1 -1 -1 -2 -5 17 4 1 5 0 11 23 1 3 1 0 16 0 1 1 12 2 1 1 0 0.52 1.42
57 E -1 2 1 2 -5 0 3 -4 -3 -2 -3 2 -1 -6 -1 0 2 -6 -5 -4 4 11 7 13 0 3 19 0 0 2 2 14 2 0 3 7 13 0 0 0 0.45 1.41
58 N 0 2 2 -4 -2 -2 -1 -4 7 -5 -2 1 -3 3 -5 -2 -3 -1 3 -5 8 10 10 0 1 1 5 0 26 0 5 8 0 14 0 1 1 1 10 0 0.73 1.41
59 D -3 -1 2 2 -4 0 1 4 4 -6 -6 2 -5 -6 -4 -1 -4 -6 -3 -6 1 3 10 11 0 3 10 32 9 0 0 15 0 0 0 4 0 0 1 0 0.70 1.40
60 V 0 -5 -5 -6 -4 -5 -5 -1 -6 6 -1 -5 -2 -3 -5 -4 -1 -6 -4 4 8 0 0 0 0 0 0 6 0 43 3 0 0 0 0 0 3 0 0 35 1.03 1.41
61 N -3 -1 7 0 0 0 -1 -3 -1 -4 -6 1 -5 -6 -2 2 0 -6 -5 -5 1 3 51 4 2 4 2 1 1 1 0 9 0 0 2 16 4 0 0 0 1.04 1.44
62 L -4 -5 -6 -6 -4 -5 -6 -6 -6 3 5 -5 5 -3 -6 -5 -3 -5 -4 2 0 0 0 0 0 0 0 0 0 18 49 0 17 0 0 0 1 0 0 15 1.16 1.44
63 T -2 -2 -1 -4 3 0 -3 -4 2 0 1 -2 -1 -4 -5 2 5 -5 -2 0 1 1 3 0 6 3 1 1 6 4 13 2 1 0 0 15 36 0 1 6 0.58 1.49
64 H -4 3 -2 -1 -6 0 -1 -5 9 -2 -4 2 -2 -2 -5 -3 -4 -1 -1 -5 0 14 1 4 0 4 4 0 52 3 1 13 1 2 0 1 0 1 1 0 1.43 1.49
65 I -4 -6 -6 -6 -4 -6 -6 -7 -6 6 2 -6 0 1 -6 -5 -4 -5 -4 3 0 0 0 0 0 0 0 0 0 58 21 0 1 4 0 0 0 0 0 17 1.34 1.49
66 E -2 -1 -3 1 -6 0 7 -5 -3 -6 -6 -2 -5 -6 -4 1 -4 -6 -5 -5 3 2 0 5 0 3 79 0 0 0 0 0 0 0 0 8 0 0 0 0 1.62 1.53
67 S -2 -1 2 -3 -4 -3 -3 -4 -4 -3 -2 -2 -4 -5 -2 6 4 -6 -5 -4 0 3 8 0 0 0 0 0 0 1 5 1 0 0 2 58 22 0 0 0 1.06 1.56
68 R -4 8 -2 -4 -6 -2 -2 -5 -3 -2 -3 1 -1 -4 -5 -1 -4 -5 -4 -5 0 82 1 0 0 0 1 0 0 3 2 5 1 1 0 3 0 0 0 0 1.79 1.56
69 P -3 -2 -4 -2 -2 -2 -3 -3 -4 -4 0 2 -4 -5 7 -1 -2 -5 -5 -3 1 2 0 2 1 2 1 2 0 0 9 13 0 0 58 5 1 0 0 1 1.37 1.50
70 S 1 -1 0 -2 -1 -2 -2 -3 -4 -3 0 -3 -2 0 -2 5 -1 -5 -4 -2 12 3 5 1 1 1 1 1 0 1 9 0 1 4 1 52 3 0 0 3 0.69 1.50
71 R -1 4 2 -3 -5 2 0 -3 0 -5 -2 4 -4 -5 1 -2 -2 -5 -4 -3 4 27 10 1 0 8 6 2 2 0 5 24 0 0 7 2 2 0 0 1 0.64 1.49
72 L 0 4 0 -1 -3 0 -1 -2 -1 -2 -1 3 0 -1 -3 0 0 2 -1 -2 7 21 4 3 0 3 4 2 1 2 7 17 3 2 1 7 6 3 3 3 0.28 1.52
73 K -1 2 1 -1 -2 -1 1 2 0 -1 -2 2 0 0 -1 0 0 -5 -4 -2 5 9 6 3 1 2 11 16 2 3 4 13 3 4 3 8 5 0 0 2 0.19 1.50
74 K 0 0 2 1 0 -2 -3 1 -2 -3 -1 3 -2 -4 2 1 0 -5 -4 -3 8 6 11 8 2 1 1 10 1 1 7 16 1 1 10 9 7 0 0 1 0.27 1.50
75 D -2 -2 1 2 -5 -2 0 2 -2 -3 -3 1 -3 -2 -1 0 -2 8 0 0 2 2 8 10 0 1 6 14 1 1 2 8 1 1 3 7 2 20 4 8 0.59 1.50
76 E -1 -1 1 2 -3 3 4 -1 0 -5 -4 0 -2 -5 -3 1 0 -5 -3 -2 5 2 5 10 1 13 28 4 2 0 1 6 1 0 1 11 7 0 1 3 0.49 1.48
77 Y -1 -4 -3 -2 -5 0 -4 -5 3 -2 1 -4 1 3 -2 -1 -4 -2 7 -1 5 0 1 3 0 5 0 0 7 1 11 0 3 9 3 4 0 0 43 4 0.96 1.53
78 E -2 -1 1 3 1 -1 4 -4 -2 0 0 -2 -1 -2 -4 -2 -2 -5 -1 1 3 3 6 19 3 2 27 1 1 7 8 1 1 2 0 2 2 0 2 9 0.43 1.53
79 F -2 -2 -5 -5 1 -4 -5 -5 -4 2 -1 -4 1 7 -5 -4 -1 -3 2 2 3 3 0 0 3 0 0 0 0 11 4 0 3 45 0 0 4 0 5 16 0.97 1.33
80 F -4 -4 -5 -5 -4 -4 -5 -5 1 0 2 -4 3 6 -5 -2 0 3 4 -1 0 0 0 0 0 0 0 0 3 5 17 0 7 35 0 2 6 3 14 4 0.90 1.33
81 T -2 -2 -1 -5 -4 -4 -4 -5 -5 4 1 -4 1 0 -5 -4 0 -5 -3 5 3 2 4 0 0 0 0 0 0 23 11 0 3 3 0 0 5 0 0 43 0.79 1.33
82 H -2 1 0 5 -5 0 1 -1 0 -2 -5 1 -4 -1 -4 0 0 -5 -1 -2 2 8 4 36 0 3 10 4 2 2 1 10 0 3 0 5 5 0 2 2 0.57 1.33
83 L -2 -5 -5 -5 7 -4 -5 -5 -4 2 2 -5 1 3 -5 -2 -3 -4 -1 2 2 0 0 0 27 0 0 0 0 11 21 0 4 14 0 2 0 0 2 13 0.92 1.32
84 D -1 -1 -1 4 -5 0 5 -4 -2 0 -3 -1 -2 -3 -1 0 0 -5 -3 -3 4 3 2 21 0 2 37 0 1 5 2 2 1 1 3 6 6 0 1 2 0.61 1.33
85 K 0 -2 -1 -3 3 -2 -2 4 -4 -1 -2 1 2 1 1 -2 -2 -4 -4 1 7 1 3 1 7 2 2 29 0 3 2 8 5 7 7 2 2 0 0 10 0.37 1.31
86 R -2 1 2 1 -4 -1 2 -2 7 -2 -3 0 -4 -4 0 -1 1 -5 -3 -2 3 8 10 7 0 2 12 3 25 2 3 6 0 0 5 3 7 0 0 3 0.54 1.29
87 S -1 2 0 0 -1 0 3 1 1 -4 -4 1 -3 -5 -2 3 -1 -5 -4 -3 3 11 4 6 1 3 17 9 3 1 2 7 1 0 2 25 4 0 0 2 0.38 1.46
88 L -1 0 1 4 0 0 0 -2 -2 -1 0 1 -1 0 -4 0 0 -4 0 -1 4 6 5 21 2 3 6 2 1 4 11 8 2 4 1 7 5 0 3 5 0.18 1.36
89 P -1 -1 1 2 -4 2 3 0 0 -1 -4 0 -1 -4 2 0 -3 2 -1 -2 5 4 6 12 0 8 21 8 2 4 1 4 2 0 10 6 1 3 2 2 0.32 1.38
90 A 0 1 3 1 -4 1 2 -4 -1 -1 -2 2 -1 -3 0 -1 -1 -5 -4 0 8 7 15 7 0 6 12 1 1 5 4 14 1 1 4 3 4 0 0 6 0.26 1.43
91 L -3 -4 -2 -3 -2 -3 -5 -4 -5 2 4 -3 1 0 -5 -1 -2 -4 -1 3 2 1 2 2 1 1 0 1 0 11 40 1 3 4 0 6 2 0 2 21 0.62 1.59
92 T 0 0 2 1 -5 1 1 -1 1 1 0 2 1 -4 -2 0 -2 -5 -3 0 9 5 8 6 0 5 7 4 3 7 10 11 3 1 2 7 2 0 1 6 0.12 1.59
93 N 1 1 2 2 -2 3 2 -2 0 -4 -2 1 -3 -5 -3 0 -1 -5 -4 -4 11 6 9 10 1 16 15 2 2 1 4 10 1 0 1 7 4 0 0 1 0.38 1.59
94 I 3 -4 -3 -5 -2 -4 -2 -3 -2 2 2 -1 0 -2 -5 -1 -1 -5 -2 2 28 0 1 0 1 0 3 2 1 12 21 3 2 1 0 5 3 0 2 15 0.44 1.62
95 I -2 -4 -3 -5 0 -1 -2 -5 -5 4 3 -2 1 0 -5 -3 -1 -5 -2 1 4 1 2 0 2 2 3 1 0 26 33 3 3 3 0 1 4 0 1 10 0.60 1.62
96 K -1 1 -1 1 -1 1 3 -2 -1 -3 -1 3 -3 -3 -2 0 -1 -5 -3 -4 6 8 3 7 1 7 20 3 1 1 8 20 0 1 2 6 3 0 1 1 0.35 1.62
97 I 0 0 0 1 0 -1 2 -2 -1 -1 1 -1 2 -1 -4 2 -2 -5 -1 -2 9 6 5 7 2 2 15 3 1 3 15 4 4 2 0 15 2 0 2 2 0.19 1.59
98 L -2 -2 -3 -2 -4 -1 -3 -6 -2 1 5 -2 2 1 -5 -4 -2 -5 -4 1 3 3 1 2 0 3 1 0 1 6 56 3 4 5 0 0 2 0 0 9 0.76 1.62
99 R -1 4 -1 -1 -2 2 0 -1 -4 1 -1 3 0 -5 -4 0 -1 -5 -4 -1 4 20 2 3 1 10 5 5 0 7 5 21 2 0 0 6 4 0 0 5 0.39 1.60
100 H -1 2 2 1 -5 3 3 -1 2 -4 -4 1 -4 -5 -2 0 0 -5 -3 -4 4 12 8 7 0 12 21 4 5 1 1 7 0 0 1 7 6 0 1 1 0.44 1.58
101 D -3 2 1 2 0 2 2 -2 4 0 -2 1 -3 -3 -3 1 -1 -4 0 -3 1 11 7 10 2 8 12 3 9 6 4 8 0 1 1 9 4 0 4 1 0.28 1.53
102 I 1 -4 -2 -2 4 -3 -2 -3 1 1 0 -4 -3 0 -2 0 1 -2 -1 3 14 1 2 2 10 1 2 2 3 8 8 1 0 4 2 6 9 1 2 24 0.35 1.52
103 G 2 0 -1 0 1 1 -2 1 0 0 -2 0 -1 -4 -1 3 1 -4 -4 -2 15 6 3 4 3 6 1 10 2 5 5 6 1 0 3 20 7 0 0 3 0.20 1.52
104 A 1 -2 -1 -1 -4 -1 0 -2 -4 -2 -1 -2 2 4 -1 3 -1 -2 0 -1 11 2 2 4 0 2 5 3 0 2 6 2 5 20 4 21 4 1 3 4 0.31 1.56
105 T -2 -1 0 -2 -4 -2 -3 -1 0 0 0 -1 0 2 -1 0 2 -3 4 2 3 3 5 2 0 1 1 5 2 5 8 4 2 7 4 6 13 0 13 16 0.23 1.56
106 V -2 0 0 -1 2 -1 -2 -3 -4 0 0 3 -1 2 1 -2 -1 -2 -3 2 2 5 4 3 5 3 3 2 0 6 10 18 1 9 6 2 3 1 0 17 0.26 1.61
107 H -2 0 3 -1 -1 -1 -1 -3 3 0 -1 2 -1 -2 -2 0 -1 -5 -1 3 4 5 12 3 1 3 4 2 8 5 5 12 1 2 2 6 3 0 2 21 0.26 1.60
108 E -1 -4 -2 -1 -4 -2 2 -4 -3 3 3 -2 -2 0 -5 -2 -1 -5 -3 1 6 0 2 4 0 1 14 1 1 15 32 2 0 3 0 3 4 0 1 9 0.42 1.66
109 L -2 -3 -1 0 -4 -1 -2 3 -4 1 2 -1 -1 -1 -1 -1 0 3 -4 -1 3 1 3 5 0 3 2 21 0 7 23 5 1 3 3 3 7 4 0 5 0.27 1.67
110 S -1 -1 1 0 -5 0 -1 0 -4 0 -2 1 1 -5 1 2 1 -5 0 1 5 4 7 5 0 5 4 9 0 6 4 8 3 0 7 13 8 0 3 10 0.13 1.86
111 R -2 1 1 0 -5 1 1 -1 1 -1 -2 1 1 0 -1 0 0 3 2 -1 3 6 7 6 0 6 9 4 3 4 4 10 3 4 3 8 5 4 6 4 0.14 1.83
112 D -1 -4 3 2 -5 0 3 -2 1 -2 -2 0 -4 -1 1 0 0 -5 2 -2 5 0 12 11 0 3 17 3 3 3 4 5 0 2 8 7 7 0 6 3 0.27 1.78
113 K -1 0 1 0 3 1 0 -1 2 0 -1 0 2 1 0 0 0 -5 1 -4 6 6 5 6 5 5 6 6 5 6 6 6 5 5 6 6 6 0 5 0 0.11 1.89
114 K 0 0 0 2 1 0 0 1 -4 0 -2 3 1 -5 0 1 0 -5 -5 0 6 4 4 10 3 4 6 11 0 5 4 15 3 0 4 10 4 0 0 6 0.18 1.80
115 K 0 -4 1 0 -5 1 0 0 3 0 -1 0 2 1 -4 0 0 -4 2 0 6 0 6 6 0 6 6 6 6 6 6 6 6 6 0 6 6 0 6 6 0.13 1.67
116 D -1 0 1 0 3 1 0 -1 2 0 -4 0 -4 1 0 0 0 4 -4 0 6 6 6 6 6 6 6 6 6 6 1 6 0 6 6 6 6 6 0 6 0.17 1.78
117 T 0 0 1 0 3 1 0 0 -4 0 -1 0 2 -4 -4 0 0 -5 1 0 6 6 6 6 6 6 6 6 0 6 6 6 6 0 0 6 6 0 6 6 0.13 1.67
118 V 0 -4 0 0 -4 0 -1 -1 2 1 -1 -1 2 0 -4 -1 0 -5 -4 4 6 0 4 6 0 4 4 6 5 9 4 4 5 4 0 6 5 0 0 27 0.28 1.63
119 P 1 -1 -2 -2 -3 -1 2 -1 1 0 -2 -2 -3 -3 6 -1 -1 -4 -3 -1 11 3 1 1 0 2 15 4 4 7 3 1 0 1 39 3 3 0 0 3 0.69 0.70
120 W -3 -3 -3 -1 -3 -3 -3 -3 -3 0 -3 -3 -2 -1 -3 0 2 11 0 -3 1 1 1 4 0 1 1 1 0 8 1 1 0 1 1 10 14 54 0 1 1.66 0.71
121 F 1 1 -3 -3 -3 -3 -3 -3 -2 -1 -2 -3 -2 6 -3 0 0 -1 3 -2 14 8 1 1 0 1 1 1 0 3 1 1 0 48 1 6 6 0 7 1 0.73 0.71
122 P -2 -2 -3 -3 -4 -2 -2 -3 -3 -4 -4 2 -3 -4 8 -2 -2 -4 -4 -3 1 1 1 1 0 1 1 1 0 1 1 14 0 1 75 1 1 0 0 1 1.81 0.71
123 R -3 1 1 -3 4 2 1 0 3 -4 0 1 3 -5 1 -3 1 -5 -4 -4 0 8 8 0 8 8 8 8 8 0 8 8 8 0 8 0 8 0 0 0 0.37 1.22
124 T -3 2 0 2 -1 0 0 -4 5 -5 -4 4 1 -5 -4 2 -1 -5 -2 -3 0 10 4 10 2 2 4 0 14 0 0 29 5 0 0 15 4 0 1 1 0.58 1.04
125 I 0 -2 -4 1 -4 -4 -1 -5 -5 6 0 -4 -2 -3 0 -2 -3 -5 -4 2 9 3 0 9 0 0 3 0 0 51 5 0 0 0 4 3 0 0 0 12 0.72 1.04
126 Q 1 2 1 -3 -2 0 1 -1 1 -4 -4 0 -4 2 -4 3 -1 -4 0 -4 10 10 8 0 1 5 8 5 3 0 0 6 0 12 0 29 3 0 2 0 0.39 1.04
127 E -4 0 -1 6 -6 1 4 0 4 -6 -6 -2 -5 -5 -4 -2 -3 -6 -4 -5 0 5 0 49 0 5 25 6 10 0 0 0 0 0 0 0 0 0 0 0 1.13 0.98
128 L -1 -4 -5 -5 -3 -4 -5 -5 -5 0 5 -4 -1 1 -5 -1 1 2 -3 0 4 0 0 0 0 0 0 0 0 4 68 0 0 4 0 5 8 3 0 5 0.87 0.98
129 D -3 -3 0 7 -5 3 1 -4 -3 -5 -6 1 -5 -6 -4 0 -3 -6 -5 -5 0 0 3 64 0 14 4 0 0 0 0 7 0 0 0 8 0 0 0 0 1.29 0.98
130 R -3 3 0 -1 -4 1 0 -3 1 -2 -1 3 -3 -1 0 0 0 -4 2 0 0 14 3 2 0 7 4 1 4 1 7 24 0 2 5 6 5 0 7 8 0.29 0.96
131 F -3 -4 -4 -4 7 -4 -4 -4 -4 2 1 -4 -2 2 -4 1 0 -3 1 0 1 0 0 0 29 0 0 1 0 14 12 0 0 11 0 12 6 0 6 7 0.77 1.03
132 A 0 1 1 1 4 1 -3 0 3 -4 -4 -3 -3 -3 -4 0 1 -4 2 0 8 8 8 8 8 8 0 8 8 0 1 0 0 0 0 8 8 0 8 8 0.30 1.23
133 N -2 -1 4 1 -2 2 0 1 7 -6 -5 -1 -1 -5 1 -1 -3 -5 -3 -5 2 3 18 8 1 12 5 11 25 0 0 4 1 0 6 3 1 0 0 0 0.72 1.21
134 Q -3 2 -1 -1 2 2 2 -5 3 -3 2 -1 -2 -4 -4 -1 0 -5 -4 1 0 13 2 3 4 11 16 0 8 0 23 3 0 0 0 3 5 0 0 9 0.38 1.15
135 I 0 -4 -1 -5 0 -4 -4 -5 2 4 2 -2 2 -3 -5 -3 1 -5 -4 4 8 0 4 0 2 0 0 0 5 21 16 2 6 0 0 0 7 0 0 29 0.57 1.13
136 L -3 1 -4 -1 -4 -3 -2 -1 -4 0 3 -3 5 -3 -5 -1 3 -5 -4 -1 0 7 0 5 0 0 3 6 0 3 30 0 18 0 0 3 23 0 0 3 0.58 1.19
137 S 0 0 0 0 -5 0 1 -2 2 -1 -2 3 4 -5 -4 2 -1 -5 -4 -1 7 5 5 4 0 4 11 2 5 4 3 22 11 0 0 13 2 0 0 3 0.34 1.26
138 Y 0 1 0 -4 -4 -3 -4 -5 2 0 -1 -3 2 3 -5 0 0 -3 4 2 7 9 4 0 0 0 0 0 4 4 4 0 6 14 0 9 5 0 13 19 0.39 1.11
139 G -3 -3 2 2 -4 2 1 1 -3 1 -4 1 -3 -5 -4 1 1 -5 -4 1 0 0 10 10 0 10 10 10 0 10 0 10 0 0 0 10 10 0 0 10 0.30 1.00
140 A 2 -2 -2 -2 -4 -3 1 0 -4 -1 -4 -2 -4 -5 5 1 -1 -6 -5 -1 22 1 1 2 0 0 9 7 0 5 0 2 0 0 32 13 2 0 0 4 0.71 1.18
141 E 1 -3 1 4 -5 1 4 -3 4 -5 -5 -3 -4 -5 -4 -1 1 -6 -4 -3 14 0 5 21 0 5 28 2 11 0 0 0 0 0 0 3 10 0 0 2 0.70 1.17
142 L -1 -4 1 -4 -4 0 -4 -5 -4 -2 3 -2 0 0 4 -2 2 -5 -4 -3 4 0 7 0 0 4 0 0 0 0 36 1 2 4 19 3 13 0 0 0 0.49 1.17
143 D 0 2 1 4 2 2 -1 -4 -3 -5 -5 -2 -1 -5 -4 2 0 -5 -5 -4 6 11 7 29 4 9 3 0 0 0 0 0 2 0 0 14 7 0 0 0 0.50 1.22
144 A 1 -2 -3 1 1 0 2 -4 1 0 0 0 3 -4 0 0 0 -5 -4 -2 12 2 0 7 3 5 12 0 3 7 9 6 8 0 5 7 4 0 0 1 0.11 1.22
145 D 1 2 -1 3 -4 1 -1 -2 -3 1 0 -1 -3 0 -4 -1 -3 -4 -1 -3 12 13 3 19 0 8 3 2 0 9 8 4 0 4 0 3 0 0 2 0 0.19 1.11
146 H -3 2 -3 2 -4 0 -2 -4 5 -4 -1 -2 -3 2 3 1 -3 -3 3 -4 0 11 0 11 0 5 0 0 13 0 5 0 0 8 14 12 0 0 11 0 0.39 0.94
147 P 1 -3 -3 -3 -4 2 1 1 -3 -2 0 -3 -2 -4 2 -2 1 -4 -4 1 11 0 0 0 0 11 11 11 0 0 11 0 0 0 11 0 11 0 0 11 0.19 0.89
148 G 1 -3 -2 0 0 -1 1 6 -3 -5 -4 -1 -4 -5 -3 -2 0 -4 -4 -4 9 0 0 5 2 3 9 56 0 0 1 4 0 0 0 1 6 0 0 1 0.88 1.01
149 F 0 -1 -4 -4 -4 -3 -2 -4 0 -1 -1 -1 5 6 -4 -3 -3 -2 3 -1 7 3 0 0 0 0 3 1 2 2 4 4 19 41 0 1 0 0 8 4 0.86 1.04
150 K 1 -1 0 -2 -4 -1 -2 0 3 -4 -3 3 -3 -4 3 2 2 -4 -3 -3 11 2 3 2 0 3 0 6 7 0 2 17 0 0 15 14 16 0 0 0 0.42 1.04
151 D 0 -4 0 6 -4 -3 0 1 -3 -4 -3 -3 -4 -5 0 -2 1 -5 -4 -4 6 0 3 57 0 0 3 11 0 0 2 0 0 0 4 0 11 0 0 0 1.00 1.04
152 P 0 -1 0 1 -4 1 1 -1 -2 0 -1 1 -1 -4 2 -1 2 -5 -4 1 7 2 5 7 0 7 9 4 1 4 5 8 1 0 12 2 13 0 0 13 0.20 1.04
153 V 1 -4 -1 -2 -4 -2 2 -4 -4 0 -1 -2 0 -2 -4 0 0 -5 -4 4 15 0 3 2 0 1 13 0 0 4 4 1 2 1 0 7 6 0 0 41 0.48 1.05
154 Y -3 -3 -3 -4 -4 2 -3 -4 -2 -4 -3 -3 -3 3 -4 1 3 -1 7 -3 0 0 0 0 0 13 0 0 0 0 0 0 0 10 0 11 22 0 44 0 1.07 1.02
155 R 1 5 -2 -1 -5 0 -3 -2 -3 -1 -4 0 -1 -5 2 -3 1 4 -4 -2 14 37 2 3 0 3 0 3 0 4 0 5 2 0 9 0 11 6 0 2 0.63 1.18
156 A 1 0 -2 -1 3 2 2 -4 -3 -3 -3 5 0 -5 2 -1 -2 -5 -4 -2 11 4 1 2 6 7 13 0 0 1 2 36 2 0 8 2 2 0 0 2 0.56 1.18
157 R -3 6 2 -3 -5 1 -2 -4 -3 -4 1 2 -3 -5 2 -1 -3 -5 -4 -4 0 45 11 0 0 5 0 0 0 0 14 9 0 0 11 5 0 0 0 0 0.82 1.00
158 R -3 6 -3 0 -4 1 -2 -4 -3 -3 -1 1 2 -4 -4 -3 0 -4 -3 0 1 50 0 6 0 6 1 1 0 0 7 7 6 0 0 1 6 0 0 7 0.80 1.06
159 K 0 1 1 1 -4 1 1 0 -3 -4 -4 1 3 -4 -4 0 1 -4 2 0 8 8 7 8 0 7 8 8 0 0 1 8 7 0 0 8 8 0 7 8 0.22 1.34
160 Q -2 0 -3 2 -5 3 2 -4 2 0 -2 -1 1 0 -4 0 -2 1 3 -1 4 4 0 14 0 13 14 1 5 6 2 3 4 4 0 8 1 2 12 3 0.36 1.46
161 F -4 -5 0 -5 -4 -4 -5 -2 0 4 0 -4 -2 5 1 -4 -4 3 4 -1 0 0 6 0 0 0 0 3 3 29 8 0 0 21 8 0 0 3 13 3 0.75 1.45
162 A 4 -4 -1 0 0 1 -2 -2 -4 -4 -2 -3 -1 -1 -2 2 1 -5 -4 0 42 0 3 5 2 6 2 3 0 0 3 0 1 3 2 14 7 0 0 6 0.54 1.56
163 D 0 2 0 3 -5 2 2 -2 5 -5 -3 0 0 -5 0 -1 -1 -5 -4 -3 6 10 3 18 0 9 15 3 13 0 3 5 2 0 4 3 4 0 0 2 0.45 1.60
164 I 0 -1 -4 -2 1 0 -4 -5 -5 3 2 -1 1 -1 -1 -1 3 -5 -4 1 8 4 0 3 3 4 0 0 0 14 20 4 3 3 3 4 18 0 0 9 0.33 1.61
165 A 4 1 0 0 -4 0 -1 0 1 -5 -2 0 -4 -5 1 0 0 -5 -4 -4 36 8 5 5 0 5 4 6 4 0 4 4 0 0 7 7 5 0 0 0 0.43 1.64
166 Y -1 0 1 0 -5 1 0 -1 2 0 -1 0 2 1 0 0 0 -5 1 0 6 6 5 6 0 5 6 6 5 6 6 6 5 5 6 6 6 0 5 6 0.08 1.89
167 N -1 0 2 2 -5 1 -1 -1 3 -2 0 1 -4 2 -1 -1 -1 -5 -1 0 5 6 9 13 0 5 3 4 7 2 11 9 0 8 3 4 4 0 2 6 0.18 1.75
168 Y 1 -2 -4 -5 0 -1 -4 -5 4 -4 -2 -1 -4 1 0 -1 -4 4 6 1 12 2 0 0 2 3 0 0 10 0 3 4 0 6 6 4 0 6 30 10 0.76 1.75
169 R -2 4 0 -1 -5 0 -3 -2 2 -1 -2 3 1 -5 -1 -1 2 -5 0 -1 4 19 3 4 0 4 0 4 6 4 5 17 3 0 4 4 12 0 3 4 0.34 1.89
170 H -1 0 0 0 2 0 0 -1 2 0 -1 0 2 1 0 -1 0 4 1 -1 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 0.09 2.12
171 G 0 -3 1 1 -4 1 0 0 3 0 -4 0 2 -4 1 0 0 4 -4 0 7 0 7 7 0 7 7 7 6 7 1 7 6 0 7 7 7 6 0 7 0.23 1.56
172 Q -3 -1 1 5 0 4 1 -2 -1 -2 -3 0 -1 -5 -4 0 -1 -5 -5 0 2 3 5 28 2 21 7 2 1 2 2 5 1 0 0 7 3 0 0 7 0.58 1.60
173 P 0 -1 -2 1 -5 1 1 -2 0 -2 -3 0 -4 -5 6 0 -1 -5 -5 -3 9 3 2 6 0 7 10 3 3 2 2 5 0 0 39 5 3 0 0 2 0.77 1.58
174 I -3 -1 0 0 -4 4 -1 -2 1 4 0 -1 1 -4 0 -2 -1 -5 -4 0 1 3 4 5 0 21 4 3 3 22 9 3 4 0 4 3 3 0 0 7 0.39 1.56
175 P -1 -2 0 0 -5 -1 -1 4 2 -5 -5 -1 -4 -1 5 -3 -2 -5 -4 -2 5 3 4 4 0 3 4 28 4 0 1 3 0 3 29 0 3 0 0 3 0.70 1.60
176 R -4 0 1 0 3 1 0 -5 2 0 -1 0 2 1 -5 0 0 4 2 0 0 6 6 6 6 6 6 0 6 6 6 6 6 6 0 6 6 6 6 6 0.23 1.78
177 V -1 -2 -2 0 -3 -2 0 -4 -1 4 -1 -3 -1 -3 -2 -2 -1 -4 -1 4 5 2 2 6 0 2 7 1 1 27 3 1 1 0 2 2 3 0 2 31 0.54 1.30
178 E 0 -1 0 2 -4 0 4 -2 2 -2 -2 -1 -3 -4 -1 -1 0 -4 -3 -2 7 3 4 13 0 4 34 3 6 2 4 3 0 1 3 3 7 0 0 3 0.45 1.12
179 Y -4 -3 -4 -4 -4 -3 -4 -4 3 -3 -3 -4 -3 3 -4 -3 -3 8 8 -3 1 1 1 1 0 0 1 1 7 1 1 1 0 9 1 1 1 18 56 1 1.70 1.05
180 M -1 -4 0 0 2 -3 -3 0 -4 -4 -2 -1 1 0 1 3 4 -5 -4 -3 5 0 4 5 4 0 0 8 0 0 5 4 4 4 6 21 29 0 0 0 0.47 1.45
181 E 0 -1 0 2 -5 1 3 -1 1 -1 -2 0 -4 -4 2 -1 -1 -5 0 -2 7 4 3 10 0 7 23 4 3 3 4 7 0 0 9 5 4 0 3 3 0.29 1.45
182 E 1 -1 -1 1 -1 2 5 -2 -1 -1 -4 -2 -3 -4 -2 0 0 -1 -4 0 11 3 2 7 1 10 35 2 1 5 1 1 0 0 2 6 6 1 0 6 0.46 1.17
183 E -3 -2 1 3 -5 1 6 -3 -2 -4 -4 -2 -4 -4 -3 -2 -3 -4 -4 -4 1 1 8 18 0 4 61 1 0 1 1 1 0 0 1 1 1 0 0 1 1.15 1.04
184 K -3 -1 2 0 -4 2 -1 -3 7 1 -2 0 -3 -1 -3 -2 0 -4 -2 -1 1 2 10 4 0 8 3 1 35 9 3 6 0 2 1 1 7 0 0 5 0.71 1.04
185 K 3 0 0 2 -1 0 2 -1 -1 -3 -3 1 -1 -4 -3 -1 -1 4 -3 -2 25 4 5 10 1 4 15 3 2 2 2 10 2 0 1 3 2 5 0 2 0.34 1.18
186 T -1 -1 -3 -4 -3 -3 -3 -4 -4 3 1 -3 1 -3 -4 -2 5 -4 -3 2 4 4 0 1 0 0 1 1 0 17 10 1 4 0 1 1 39 0 0 17 0.68 1.18
187 W -4 0 -5 -5 -4 -4 -4 -4 -4 -4 -3 -4 -3 1 -5 -4 -4 12 2 -4 1 5 0 1 0 0 1 1 0 1 1 1 0 5 1 1 1 76 6 1 2.92 1.18
188 G -1 3 0 1 -5 1 -1 2 3 -1 -4 1 1 -4 -4 0 -1 -5 0 -4 5 18 4 7 0 7 4 19 6 4 1 8 4 0 0 6 4 0 4 0 0.37 1.62
189 T 0 3 -1 1 2 1 1 -4 1 0 -1 -1 1 0 -4 -1 2 -5 0 0 6 14 3 7 4 5 8 0 4 6 6 4 3 3 0 3 14 0 4 6 0.19 1.62
190 V -1 -5 -5 -5 2 -4 -5 -5 -5 2 3 -5 -2 -3 -2 -4 -3 -5 -4 5 4 0 0 0 5 0 0 0 0 8 29 0 0 0 2 0 0 0 0 47 0.91 1.36
191 F -2 -4 -5 -5 0 -4 -5 -5 1 0 0 -5 4 5 -5 -2 -2 4 6 0 2 0 0 0 2 0 0 0 4 4 7 0 11 24 0 3 3 5 27 6 0.94 1.48
192 K 0 4 1 1 -5 0 2 -1 0 -3 -3 0 -4 -5 -1 0 1 -5 -4 -2 8 25 7 7 0 4 12 5 2 1 3 5 0 0 3 6 10 0 0 3 0.37 1.48
193 T -2 5 0 -2 -1 2 2 -4 -1 -2 -2 2 -1 -5 -4 0 1 -5 -4 -3 2 28 5 2 1 7 14 0 2 3 5 13 1 0 0 6 9 0 0 2 0.52 1.48
194 L -4 1 1 -4 -5 5 -3 -5 1 0 3 -3 2 -4 -5 -1 -1 -5 -4 -1 0 8 8 0 0 26 0 0 4 4 33 0 4 0 0 3 3 0 0 5 0.68 1.56
195 K 0 0 -1 -4 0 1 -1 -3 3 -1 0 2 3 -1 -5 0 1 1 -1 1 7 5 3 0 2 5 3 2 7 2 11 14 6 2 0 6 8 2 2 12 0.20 1.56
196 S -1 0 1 0 3 1 0 -1 2 0 -1 0 2 -5 1 0 0 -6 -5 0 6 6 6 6 6 6 6 6 6 6 6 6 6 0 6 6 6 0 0 6 0.14 1.78
197 L -1 -1 0 -6 1 -1 -5 -3 0 0 4 0 2 0 -6 -4 -2 -5 1 1 4 3 4 0 3 3 0 2 2 4 45 6 5 3 0 0 2 0 4 9 0.54 1.61
198 Y -1 -5 -2 -6 -5 -4 -5 -3 3 1 3 -3 1 0 -6 -2 -2 3 5 0 5 0 2 0 0 0 0 2 8 9 31 2 4 2 0 3 2 3 22 6 0.67 1.61
199 K 0 2 0 -1 -5 1 1 -2 1 -3 -3 1 1 -6 4 0 -1 -6 -5 -2 6 10 5 2 0 7 9 2 4 2 2 9 3 0 24 7 4 0 0 3 0.45 1.61
200 T -1 0 -1 2 -5 0 -1 3 -1 -4 -3 2 -4 -5 -1 0 3 -6 -3 -3 4 5 2 12 0 4 2 20 2 1 3 16 0 0 2 5 20 0 1 1 0.42 1.51
201 H -3 4 -1 -2 -1 -3 -4 -5 7 -2 0 0 -1 -1 -5 -3 -1 -4 3 1 1 20 2 2 2 0 0 0 28 1 9 4 2 3 0 1 3 0 11 11 0.78 1.51
202 A 6 -5 -5 -5 2 -4 -4 -3 -5 -4 -1 -4 0 -2 -4 -1 -1 -5 -4 -1 77 0 0 0 4 0 0 0 0 0 5 0 2 2 0 3 4 0 0 3 1.25 1.51
203 C 0 -5 -2 -5 10 -5 -5 -5 4 -2 -4 -5 -4 0 -1 0 -1 -5 -2 -1 9 0 1 0 55 0 0 0 10 2 0 0 0 4 3 7 3 0 1 4 1.65 1.48
204 Y -1 0 1 0 -5 1 0 -1 2 0 -1 0 2 -4 0 0 0 -5 1 0 6 6 6 6 0 6 6 6 6 6 6 6 6 0 6 6 6 0 6 6 0.10 1.78
205 E 0 0 -3 0 1 1 5 -2 1 -4 -2 -1 -4 0 0 0 -3 -5 -4 -1 8 4 0 4 4 6 36 4 4 0 4 4 0 4 4 7 0 0 0 5 0.48 1.62
206 Y -3 -4 -4 -5 -5 -1 -4 -5 4 -2 -2 -4 -3 5 -5 -4 -4 -1 7 -2 2 0 0 0 0 2 0 0 11 2 3 0 0 27 0 0 0 0 47 3 1.46 1.32
207 N -3 -1 3 -1 0 0 -4 -5 -2 2 4 -2 3 -1 -5 -2 -3 -5 -4 0 1 4 14 3 2 4 0 0 1 10 40 3 6 2 0 3 0 0 0 6 0.53 1.36
208 H 0 2 1 3 0 2 3 -3 3 -4 -5 0 -1 -3 -2 -2 -2 -5 1 -3 7 10 5 15 2 10 22 1 7 1 0 5 2 1 1 2 2 0 5 1 0.46 1.46
209 I 2 -5 2 -1 2 -4 -4 5 0 -1 -3 -4 0 -3 -5 -1 -2 -5 -2 0 18 0 12 3 4 0 0 38 2 3 2 0 2 1 0 4 1 0 2 7 0.64 1.46
210 F -2 -5 -5 -6 -4 -5 -5 -6 -5 1 4 -2 1 5 -3 -5 -2 4 0 0 2 0 0 0 0 0 0 0 0 8 39 3 3 28 2 0 2 5 2 6 0.89 1.42
211 P 0 0 -1 1 -2 1 2 -1 1 -3 -3 1 0 -5 4 -1 -2 -5 -4 -3 8 4 3 7 1 6 14 6 3 1 3 10 3 0 21 4 2 0 0 2 0.37 1.36
212 L -2 1 -3 0 -4 1 -1 -2 0 0 4 3 0 -3 -4 -2 -2 -4 -4 -2 3 9 0 6 0 6 3 3 2 5 36 16 2 0 0 2 3 0 0 2 0.40 1.34
213 L -1 -4 -4 -4 -3 -4 -4 -1 -4 1 5 -4 2 2 -4 -4 -3 -3 -3 -1 5 1 1 1 0 1 1 5 0 7 58 1 4 9 1 1 1 0 0 3 0.81 1.27
214 E -1 -1 -1 1 -1 3 3 -1 -2 0 -1 0 -1 -3 -1 1 -1 -3 -3 0 4 3 2 8 1 12 23 4 1 5 6 6 2 1 3 9 4 0 1 6 0.25 1.14
215 K -1 1 -1 2 -3 0 2 -1 -1 -1 -1 3 -1 -2 -2 -1 -1 -3 -2 -2 4 8 3 13 1 4 16 5 1 3 6 18 1 2 2 3 3 0 1 4 0.26 1.02
216 Y 1 -1 2 0 -1 -1 2 -2 3 -2 -1 -1 -2 0 -2 -1 0 -2 3 -2 13 3 10 4 2 2 12 3 8 2 6 4 1 4 2 5 6 0 9 3 0.20 1.02
217 C -1 0 -1 -1 7 -1 -2 0 -3 -1 1 -1 0 -2 -2 0 0 -3 -3 -1 5 5 2 3 26 2 2 7 1 4 17 4 2 1 2 6 6 0 1 3 0.51 1.10
218 G 0 0 1 -1 -4 -3 -3 5 0 1 -2 -2 -3 -4 -3 -2 -3 -4 -4 -1 7 5 6 3 0 1 2 49 2 8 4 2 0 1 2 2 1 0 0 5 0.71 1.34
219 F -2 -2 -5 -5 -1 -4 -5 -4 -3 1 3 -4 3 4 -5 -3 -4 -2 6 -1 3 3 0 0 1 0 0 1 0 9 27 0 6 16 0 1 0 0 27 2 0.85 1.46
220 H 0 3 0 -1 0 -1 0 0 -1 -4 -2 -1 -4 -3 3 2 0 -5 -4 -1 6 17 5 3 2 2 5 8 1 0 4 3 0 1 14 19 5 0 0 4 0.32 1.46
221 E 1 2 -2 0 -3 0 4 -1 -1 0 -2 1 -4 -5 3 -1 -1 -5 -5 -2 11 9 1 5 1 3 25 5 2 5 4 7 0 0 12 3 3 0 0 2 0.36 1.52
222 D -3 -2 1 5 -4 0 3 0 1 -4 -4 -1 -3 -1 0 0 1 -4 -1 -4 1 2 6 32 0 4 16 7 3 1 1 2 0 3 4 6 8 0 2 1 0.52 0.98
223 N -1 4 2 -1 -1 1 0 1 3 -3 -4 1 -1 -1 -3 0 -1 -4 -1 -3 4 23 9 4 1 6 6 12 6 2 1 7 1 2 1 7 3 0 2 2 0.32 0.99
224 I -1 -4 -4 -4 -3 -4 -4 -4 -4 6 1 -4 2 -2 -4 -3 -1 -4 -3 3 6 1 0 1 0 0 1 1 0 53 9 1 4 0 1 1 3 0 0 18 0.90 1.01
225 P -1 -4 -4 -3 -4 -3 -1 -4 -4 0 -4 -3 -4 -4 8 -3 -3 -5 -4 -3 4 1 0 1 0 0 5 1 0 5 1 1 0 0 78 1 1 0 0 1 1.97 1.01
226 Q -3 1 1 3 -1 6 0 -3 0 -4 -4 1 -3 -5 -3 0 -2 -4 -4 -2 1 6 7 19 2 41 3 1 2 0 1 7 0 0 0 6 2 0 0 3 0.78 1.05
227 L -3 -4 -4 -5 -4 -2 -4 -5 1 1 4 -2 2 5 -2 -4 -3 -3 0 0 1 0 0 0 0 2 0 1 5 8 39 2 6 25 3 1 0 0 2 4 0.72 1.05
228 E 0 1 -1 3 -4 3 3 -1 -1 -4 -3 -1 -1 -4 0 1 -2 -4 0 -2 7 8 3 15 0 12 23 4 1 0 2 3 1 0 4 8 2 0 3 3 0.38 1.19
229 D 0 0 -1 5 -5 1 3 -1 1 -3 -3 -1 -4 -3 -4 -2 0 -5 -4 -2 7 5 1 36 0 5 20 4 3 1 3 2 0 1 0 1 6 0 0 3 0.62 1.19
230 V -1 -4 -4 -4 -3 -4 -4 -4 -4 3 1 -4 3 -3 -4 -1 0 -4 -3 5 5 0 0 0 0 0 1 1 0 19 13 1 8 0 0 5 6 0 0 38 0.71 1.21
231 S -1 -3 4 0 1 -3 -3 -1 1 -2 -4 -3 -4 -4 -1 4 0 -4 0 -4 4 0 23 5 3 0 0 3 3 3 1 0 0 0 3 39 6 0 4 0 0.66 1.24
232 Q -1 0 1 0 3 1 0 -1 2 0 -1 0 2 -5 0 0 0 4 -4 0 6 6 5 6 5 5 6 6 5 6 6 6 5 0 6 6 6 5 0 6 0.14 1.89
233 F -2 0 -1 -5 1 -1 -1 -2 1 -1 -2 0 -4 6 0 -2 -1 2 2 1 4 5 4 0 3 3 3 3 3 4 3 5 0 29 6 3 4 3 6 9 0.45 1.89
234 L -4 -5 -5 -5 -4 -4 -5 -5 -5 1 6 -5 2 1 -1 -5 -4 -4 -3 0 1 0 0 0 0 0 0 0 0 5 72 0 4 5 4 0 0 0 0 4 1.20 1.53
235 Q 0 1 -1 -1 -5 2 0 -1 2 -3 -2 4 2 -2 -4 1 -1 -5 -1 -3 6 6 2 3 0 9 6 4 4 2 4 30 6 2 0 10 2 0 2 2 0.41 1.56
236 T 2 1 -2 1 0 0 3 -2 -3 -4 -2 2 -3 -5 1 0 0 -5 -4 -3 17 9 1 7 2 4 19 2 0 0 5 12 0 0 8 7 5 0 0 2 0.34 1.17
237 C 1 3 -2 -3 2 0 1 -4 1 0 0 1 0 -3 -4 0 1 -4 -3 -2 12 19 1 0 5 3 11 1 4 5 10 9 3 1 0 5 9 0 0 2 0.27 1.15
238 T -2 -3 -2 -3 -3 -2 -3 -1 -3 -3 -2 -3 -3 -4 -3 2 7 -4 -3 -2 2 1 1 1 0 1 1 4 0 1 2 1 0 0 1 12 71 0 0 2 1.18 1.11
239 G -2 -2 1 -1 -4 0 -3 6 -1 -5 -5 -3 -4 -5 -4 -1 -3 -4 -4 -5 1 2 5 3 0 4 0 75 2 0 1 0 0 0 0 4 0 0 0 0 1.35 1.03
240 F -4 -4 -5 -5 -4 -4 -4 -4 -4 -3 -2 -4 2 6 -5 -4 -4 10 1 -3 1 0 0 0 0 0 0 1 0 0 2 0 6 37 0 1 0 47 2 0 2.09 1.03
241 R 0 3 -1 -2 -2 3 1 -1 1 -3 -3 0 -1 -4 -3 1 3 -4 -3 -3 9 15 2 1 1 14 10 5 3 1 2 5 1 0 1 8 22 0 0 1 0.39 1.00
242 L 0 -4 -4 -4 1 -4 -4 -4 -4 3 4 -4 0 -1 -4 -2 0 -3 0 3 8 1 0 1 3 0 1 1 0 16 36 1 1 2 1 2 4 0 4 19 0.54 1.00
243 R 0 4 -3 -3 0 1 -1 -3 -3 -1 -2 0 -2 -3 -3 -1 -1 -4 0 3 8 29 0 1 2 6 4 2 0 2 3 4 0 0 1 3 3 0 4 28 0.47 1.00
244 P 2 -2 -2 -1 -2 -2 -2 -1 -3 -3 -4 -1 -2 -4 7 -1 -1 -2 -4 -2 18 2 1 4 1 1 1 4 0 1 1 4 1 0 50 2 3 1 0 3 1.05 1.00
245 V 2 -4 -4 -4 0 -3 -4 -2 -4 0 -1 -4 -2 -3 -4 -3 0 -4 -3 6 15 1 0 1 2 0 1 3 0 2 3 1 0 0 1 1 4 0 0 64 0.89 1.00
246 A 2 -2 -3 1 -4 1 0 0 1 -4 -4 -1 -3 -2 5 0 -1 -4 -3 -2 22 2 0 7 0 6 7 6 4 1 1 3 0 2 30 5 2 0 0 2 0.58 0.96
247 G 1 -4 0 0 -4 -3 -1 6 -3 -4 -4 -3 0 -4 -3 -2 -3 -4 -4 -4 11 1 3 5 0 0 3 67 0 1 1 1 3 0 1 1 1 0 0 1 1.15 0.96
248 L -2 -4 -4 -4 -3 -1 -4 -2 -3 0 4 -4 1 3 -4 -3 -3 1 3 -1 4 1 0 1 0 3 1 3 0 5 50 1 3 11 1 1 1 2 11 2 0.65 0.96
249 L -3 -4 -4 -4 2 -4 -4 -5 -4 4 4 -4 2 -2 -4 -4 -3 -4 -3 3 1 1 0 1 4 0 1 1 0 30 38 1 5 0 1 1 1 0 0 16 0.79 0.96
250 S -1 1 1 0 -4 -2 -2 -2 1 -3 -4 -1 -3 -4 6 3 0 -4 -4 -3 2 7 5 5 0 0 1 3 4 2 1 2 0 0 37 23 6 0 0 1 0.80 0.96
251 S 1 -3 0 2 -4 1 0 -1 -1 -3 -2 -3 -3 2 4 0 -3 -3 0 -2 12 1 4 14 0 7 5 5 1 1 3 1 0 11 23 6 1 0 3 2 0.43 0.96
252 R 0 5 0 2 -4 0 0 -2 3 -4 -2 0 -3 -2 -1 -1 0 -4 -3 -2 8 34 3 12 0 3 6 3 6 1 3 3 0 2 3 3 6 0 0 4 0.47 1.08
253 D 0 1 0 4 -4 0 2 -4 1 -1 -1 -1 -3 -4 0 -2 0 -4 -4 1 7 9 3 23 0 4 14 1 4 3 5 2 0 0 4 2 6 0 0 12 0.32 1.08
254 F -4 -4 -4 -4 -4 -4 -4 -4 -3 -2 -2 -4 -2 8 -4 -4 -4 2 3 -3 1 1 0 1 0 0 1 1 0 1 1 1 0 80 1 1 1 3 7 1 1.77 0.97
255 L -3 -4 -4 -4 0 -4 -4 -4 -3 0 3 -4 3 6 -4 -4 -2 -2 3 -2 1 1 0 1 2 0 1 1 0 3 27 1 8 42 1 1 3 0 8 1 0.94 0.97
256 G 2 -1 1 2 -4 0 4 0 -3 -4 -4 -1 -3 0 -3 1 -1 2 -2 -3 18 2 6 11 0 3 27 8 0 1 1 3 0 4 1 8 3 3 1 1 0.40 0.97
257 G -1 -3 -3 -3 0 -2 -1 2 5 -2 2 -3 2 2 -4 1 -3 -3 0 -2 4 1 0 1 2 1 4 14 16 1 24 1 6 8 1 10 1 0 3 1 0.38 0.97
258 L -3 -3 -4 -4 -3 2 -3 -4 -4 1 5 -3 1 -1 -4 -4 -3 -1 -3 -1 1 1 0 1 0 12 1 1 0 5 71 1 2 1 1 1 1 1 0 1 0.94 0.97
259 A 6 -1 -2 -3 -3 -1 -2 0 -3 -3 -2 -2 -3 -4 -3 1 -2 -4 -1 -2 68 3 1 1 0 2 2 5 0 1 3 1 0 0 1 10 1 0 2 1 0.87 0.97
260 F -2 -1 4 1 -4 1 0 -2 2 -3 -2 -1 -1 4 -4 -1 -2 -3 2 -3 3 3 25 9 0 6 6 3 6 1 3 2 1 19 1 2 1 0 8 1 0.49 0.97
261 R -2 6 0 -3 -1 0 -2 0 0 -4 -4 3 -3 -4 -2 -1 -3 -4 -3 -4 2 47 5 1 2 3 1 8 2 1 1 22 0 0 2 3 1 0 0 1 0.87 0.94
262 V -2 3 -2 -3 -3 1 -1 -3 -1 0 0 1 -1 -2 -3 -2 -1 -4 -1 4 2 19 2 1 0 6 4 2 1 3 8 7 1 1 1 2 4 0 3 35 0.41 0.95
263 F -4 -4 -4 -2 -4 -4 -5 -5 0 -2 1 -5 -2 8 -5 -4 -4 -1 2 -3 0 0 0 2 0 0 0 0 2 0 16 0 0 71 0 0 0 0 4 0 1.51 1.00
264 H -2 -2 -2 -3 0 1 -3 -4 5 -3 -4 -3 -3 -2 7 -3 -3 -5 -1 1 3 2 2 0 2 6 0 0 15 0 0 0 0 2 52 0 0 0 2 12 1.24 1.00
265 C 1 -4 -3 -4 6 -3 -4 -4 2 3 -1 -4 -2 -3 -4 2 0 -4 -3 3 13 0 0 0 17 0 0 0 5 20 3 0 0 0 0 17 5 0 0 18 0.60 1.00
266 T 4 0 -3 -4 -3 -3 -3 0 -4 -4 -4 -3 -3 -4 -3 0 5 -4 1 -3 40 4 0 0 0 0 0 6 0 0 0 0 0 0 0 5 40 0 5 0 0.83 1.06
267 Q -1 0 0 0 2 2 -3 -4 -4 1 0 -3 1 -4 -4 2 3 4 -4 -1 5 6 4 5 4 11 0 0 0 8 9 0 4 0 0 15 18 6 0 4 0.34 1.22
268 Y -4 0 0 2 -5 0 0 -5 2 -4 -4 -4 -4 5 -5 -4 0 7 3 -1 0 5 5 13 0 5 7 0 5 0 0 0 0 23 0 0 6 16 11 5 0.81 1.22
269 I -3 -5 -5 -2 -4 -4 -5 -6 -5 6 2 -5 5 -3 -5 -4 -1 -5 -4 2 0 0 0 3 0 0 0 0 0 51 14 0 16 0 0 0 3 0 0 13 1.06 1.11
270 R -4 8 -3 -4 -6 -1 -3 -5 -3 -6 -5 0 -4 -6 -5 -3 -4 -5 -4 -5 0 100 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2.22 1.22
271 H -2 1 -1 -1 0 1 -1 -2 8 -5 -5 1 -4 -4 -1 0 1 -5 0 -2 2 8 3 3 2 5 3 3 41 0 0 7 0 0 3 7 8 0 2 2 0.89 1.22
272 G 0 2 -2 -2 0 -1 1 0 2 -1 -1 -1 0 -2 3 0 -2 1 -1 -1 6 14 2 2 2 2 8 8 6 3 5 4 2 2 17 8 2 2 2 5 0.23 1.22
273 S 0 -1 1 2 -5 0 4 -1 2 -5 -5 -1 -4 -2 -2 4 0 -6 -4 -5 5 2 6 12 0 2 24 3 4 0 0 3 0 2 2 29 5 0 0 0 0.59 1.31
274 K -1 -1 0 3 -1 3 3 -4 3 -5 -5 0 -1 -5 -4 2 -1 0 -2 -2 4 3 4 17 1 12 22 0 6 0 0 6 2 0 0 14 4 1 2 2 0.52 1.31
275 P -3 -4 -4 2 -4 -4 -2 -5 -4 2 1 -4 1 2 5 -3 -2 -4 -3 2 0 0 0 12 0 0 2 0 0 13 13 0 3 9 29 0 2 0 0 17 0.64 0.83
276 M -3 -1 2 5 -5 -1 2 0 0 -3 0 -2 3 0 -2 -1 -2 -4 -1 -4 1 4 8 33 0 1 13 7 2 0 10 1 9 4 1 2 1 0 2 0 0.47 0.83
277 Y -4 -4 -1 -5 -4 -3 -4 -5 5 -3 -2 -4 3 4 -5 -4 -4 -1 8 -3 0 0 3 0 0 0 0 0 14 0 0 0 10 18 0 0 0 0 55 0 1.40 0.83
278 T -1 -3 -1 -3 -3 -2 1 -3 -3 0 1 -3 -2 -4 -3 3 4 -5 -4 -1 4 0 2 0 0 0 10 0 0 7 14 0 0 0 0 28 33 0 0 3 0.52 0.83
279 P 0 0 -3 2 -4 2 0 -4 -3 -1 -2 -1 -3 -5 6 -2 -1 -5 -4 -1 7 5 0 13 0 12 6 0 0 4 4 3 0 0 38 0 3 0 0 4 0.77 0.83
280 E 0 -2 -2 0 -5 -1 6 -4 -2 -4 -1 0 -3 0 -3 -2 -1 -4 -3 -4 7 0 0 2 0 0 70 0 0 0 9 3 0 4 0 0 4 0 0 0 0.99 0.83
281 P -3 -4 -4 -3 -5 -3 0 -4 -3 -5 -5 -3 -4 -4 8 -3 -3 -4 2 -4 0 0 0 0 0 0 6 0 0 0 0 0 0 0 84 0 0 0 10 0 2.19 0.83
282 D 0 -3 3 7 -5 -2 -1 -3 -3 -5 -5 -2 -5 -5 2 -2 -3 -6 -5 -5 8 0 16 65 0 0 0 0 0 0 0 0 0 0 11 0 0 0 0 0 1.26 0.78
283 I -1 -4 -3 2 4 -3 -3 -2 -4 2 -1 -3 1 0 2 -1 2 -4 -1 1 3 0 0 16 10 0 0 3 0 15 5 0 4 4 11 3 13 0 3 12 0.34 0.78
284 C 1 -5 -5 -5 7 -4 -5 -4 -4 2 0 -4 -2 5 0 -3 -3 -3 -1 1 16 0 0 0 24 0 0 0 0 16 5 0 0 27 5 0 0 0 0 7 0.79 0.78
285 H -3 -2 -1 -3 -4 -1 -2 -4 9 -5 -4 -2 -3 -3 -4 1 2 -4 -1 -4 0 0 0 0 0 0 0 0 72 0 0 0 0 0 0 14 13 0 0 0 1.61 0.75
286 E -3 -3 -2 4 -5 -1 5 2 -3 -4 0 -1 -3 -4 -3 -2 -3 -5 -4 -4 0 0 0 23 0 0 47 14 0 0 13 1 0 0 0 0 0 0 0 0 0.80 0.75
287 L -1 -2 -3 -3 0 -2 -3 -2 -3 2 3 2 0 -1 -3 -1 -2 -3 -1 2 5 1 1 1 2 1 1 3 0 10 33 14 1 2 1 5 2 0 2 15 0.29 0.65
288 L 0 -3 -3 -4 -3 -3 -3 -3 -3 2 2 -3 0 6 -3 -2 -2 -2 1 0 9 1 1 1 0 1 1 1 0 10 23 1 2 39 1 2 1 0 2 4 0.62 0.65
289 G -1 -3 -2 -2 0 -2 -3 6 4 -4 -4 -3 -3 -3 -3 -2 -3 -3 -3 -4 3 1 1 1 3 1 1 69 14 1 1 1 0 1 1 1 1 0 0 1 1.15 0.65
290 H -3 -2 -1 -3 -3 -1 -2 -3 9 -3 1 -2 -2 -2 -3 -2 -3 -3 0 -3 1 1 1 1 0 1 1 1 72 1 15 1 0 1 1 1 1 0 0 1 1.48 0.65
291 V 1 -3 -3 -3 4 -3 -3 -1 -3 1 2 -3 3 -2 -3 -2 -1 -3 -3 4 14 1 1 1 9 1 1 5 0 4 17 1 7 1 1 2 3 0 0 33 0.39 0.65
292 P -1 -2 0 -3 5 -3 -3 2 -4 -2 -4 -3 -4 -5 7 -1 -3 -5 -5 -4 5 2 4 0 13 0 0 14 0 2 0 0 0 0 56 2 0 0 0 0 1.35 0.75
293 L -2 -4 -5 -5 3 -1 -4 -5 -4 2 3 -4 6 1 2 -4 -1 3 0 -1 3 0 0 0 6 3 0 0 0 10 29 0 22 5 10 0 3 4 3 3 0.64 1.00
294 F -3 -4 -5 -5 -4 -4 -5 -5 2 2 4 -4 2 2 -5 0 -3 -4 -2 1 0 0 0 0 0 0 0 0 5 11 53 0 5 10 0 10 0 0 0 6 0.76 1.00
295 S 3 -4 -4 -1 -3 -3 -4 -1 -4 0 1 -3 4 0 -4 0 1 -4 0 1 33 0 0 3 0 0 0 3 0 4 11 0 14 3 0 6 9 0 3 9 0.43 1.00
296 D -3 -3 5 5 -5 0 0 -3 4 -1 -5 -3 -4 -5 -4 1 -1 -5 -4 -4 0 0 30 34 0 3 5 0 9 4 0 0 0 0 0 10 2 0 0 0 0.94 1.12
297 R -1 1 -4 0 -6 1 -1 -1 -5 -1 -2 0 -4 -6 6 -1 -4 -6 -5 -1 5 8 0 5 0 6 4 5 0 4 4 6 0 0 44 5 0 0 0 4 0.89 1.61
298 S -1 1 1 2 -5 -1 1 -2 0 -2 -1 -1 0 -1 -1 2 0 2 0 -1 5 8 7 11 0 3 8 3 3 3 7 3 3 3 3 15 7 3 3 4 0.14 1.61
299 F -4 1 -5 -6 -5 -5 -5 -6 -3 0 -1 -4 1 7 -6 -4 -1 -2 5 -1 0 7 0 0 0 0 0 0 0 4 4 0 3 57 0 0 3 0 17 4 1.36 1.19
300 A 6 -4 -1 -4 2 -3 -4 -1 -4 -3 0 -3 1 -4 -4 0 -3 -5 -4 0 69 0 4 0 4 0 0 3 0 0 7 0 3 0 0 5 0 0 0 5 0.96 1.19
301 Q 0 1 2 1 -5 2 1 0 3 -5 -1 1 -4 -5 -4 1 1 -5 -4 -4 8 8 8 8 0 8 8 8 8 0 8 8 0 0 0 8 8 0 0 0 0.29 1.22
302 F -3 -5 -5 -6 -5 -5 -5 -6 0 0 0 -5 0 7 -1 -5 -2 -2 5 -1 2 0 0 0 0 0 0 0 2 4 8 0 2 54 4 0 3 0 18 4 1.32 1.36
303 S -1 -1 -1 -5 1 -4 -4 -5 -4 -1 1 -2 3 2 -2 2 3 -5 0 2 5 3 3 0 3 0 0 0 0 3 14 3 7 9 2 17 16 0 4 12 0.34 1.52
304 Q -1 2 -3 -4 0 5 1 -5 5 -2 -5 0 -4 -1 -5 -1 -1 2 0 -2 6 11 0 0 2 33 9 0 13 3 0 4 0 3 0 5 3 3 3 3 0.73 1.52
305 E -1 1 1 0 -5 1 0 -5 3 0 -1 0 2 1 -5 0 0 -5 2 0 6 6 6 6 0 6 6 0 6 6 6 6 6 6 0 6 6 0 6 6 0.18 1.67
306 I -2 -5 -5 -6 0 -5 -5 -1 -3 3 1 -5 1 4 -5 -3 -4 -2 6 -1 4 0 0 0 2 0 0 5 0 21 10 0 4 16 0 2 0 0 34 2 0.92 1.25
307 G 0 -5 -3 -4 3 -4 -1 7 -5 -6 -6 -4 -5 -6 -5 -1 -4 -5 -6 -5 6 0 0 0 6 0 5 79 0 0 0 0 0 0 0 5 0 0 0 0 1.60 1.25
308 L 0 2 -2 -2 2 2 2 -2 -4 -2 2 2 -1 -2 -2 -2 -3 -5 -4 -2 7 11 1 2 5 10 14 2 0 1 25 12 1 1 2 2 0 0 0 3 0.33 1.25
309 A 3 -4 -2 -5 1 -4 -4 0 -5 2 2 -1 0 -4 -4 -1 -1 -5 -4 1 31 0 1 0 2 0 0 6 0 11 22 5 2 0 0 5 3 0 0 11 0.45 1.25
310 S 2 0 -2 -4 -1 -4 -4 4 -4 -1 -3 -3 -4 0 -2 3 -3 -5 0 -1 15 6 1 0 1 0 0 36 0 4 2 0 0 4 1 21 0 0 3 5 0.58 1.25
311 L 0 1 -4 -5 1 -1 -3 -5 -4 0 4 -2 1 1 -4 -1 -2 0 -1 1 9 9 0 0 3 3 1 0 0 5 40 3 2 6 0 4 2 1 2 8 0.42 1.20
312 G 2 2 -1 -1 -2 0 -1 3 -1 -2 -4 3 -1 -5 -4 -1 1 -5 -4 -4 16 12 2 4 1 4 2 20 1 3 0 21 2 0 0 4 7 0 0 0 0.42 1.27
313 A 5 -4 -2 0 0 -1 0 -2 3 -2 -2 -3 -4 0 -4 -1 -1 -5 -2 -1 54 0 2 7 2 2 5 2 7 1 3 0 0 4 0 3 2 0 1 5 0.66 1.32
314 P -1 0 -1 1 1 0 2 -2 1 1 -2 -1 1 -1 0 1 1 2 -4 -2 5 4 3 8 3 4 14 3 4 7 4 3 4 3 5 13 7 3 0 3 0.15 1.67
315 D 0 1 0 3 -6 1 2 0 2 -6 -2 2 -5 -6 2 0 0 -6 -5 -5 6 7 4 15 0 5 14 8 4 0 4 12 0 0 10 5 5 0 0 0 0.38 1.67
316 E -1 -1 1 2 -5 0 4 2 -3 -5 -5 1 -5 -5 -3 1 -3 -6 -1 -2 4 3 5 12 0 4 27 18 0 0 1 8 0 0 1 12 0 0 2 3 0.53 1.43
317 Y 2 1 -2 4 -5 1 3 -3 -2 -1 -4 -2 0 -2 -4 -2 -2 -1 1 -1 19 6 1 22 0 6 20 2 1 3 1 1 3 1 0 2 1 1 5 6 0.45 1.43
318 I -3 2 -5 -5 0 -1 -5 -4 -4 4 3 -2 3 1 -5 -2 -2 1 -1 1 2 11 0 0 2 3 0 1 0 23 27 1 7 6 0 3 2 2 2 8 0.50 1.32
319 E 0 -1 -2 1 -5 2 3 -3 -1 -2 -2 2 -2 -5 0 1 -2 3 -4 -1 9 3 1 8 0 8 20 1 1 2 5 11 1 0 4 13 2 5 0 6 0.31 1.33
320 K 0 2 0 -4 -5 1 -1 -4 2 -4 1 3 1 2 -4 0 -2 3 1 -4 8 12 4 0 0 8 4 0 6 0 12 17 3 11 0 5 2 4 4 0 0.34 1.17
321 L -1 -4 -5 -6 -4 -4 -5 -5 -5 3 5 -1 2 1 -5 -4 -3 -4 -3 1 7 0 0 0 0 0 0 0 0 17 53 5 5 6 0 0 0 0 0 8 0.81 1.07
322 A 3 1 -4 -4 -4 1 -1 1 -4 -1 -1 -1 1 0 -1 1 0 -5 -4 -1 28 8 0 0 0 6 4 10 0 4 6 4 4 4 4 10 5 0 0 5 0.27 1.28
323 T -1 5 2 0 -5 2 -3 -1 2 -5 -5 1 -4 -5 -4 0 1 -5 -4 -1 5 38 8 5 0 8 0 5 5 0 0 6 0 0 0 6 10 0 0 5 0.65 1.28
324 I -3 -4 -5 -5 4 -4 -5 -5 -4 2 3 -4 3 3 1 -4 -1 -4 -2 2 0 0 0 0 11 0 0 0 0 9 31 0 9 12 8 0 4 0 0 15 0.61 0.81
325 Y 1 -3 0 -4 -4 -3 -3 -4 5 -3 -1 -3 -3 3 -4 -1 -3 4 7 -3 12 0 5 0 0 0 0 0 13 0 4 0 0 14 0 5 0 6 40 0 0.96 0.81
326 W -2 -4 -5 -5 1 1 -4 -4 -4 -3 -1 -4 1 2 1 -4 -4 11 0 -1 4 0 0 0 4 7 0 0 0 0 5 0 4 8 8 0 0 55 0 6 1.76 0.81
327 F -4 1 -4 -5 -4 -4 -4 -5 1 -2 0 -3 0 6 -5 -2 -3 5 5 -3 0 9 0 0 0 0 0 0 3 0 7 0 3 48 0 4 0 9 17 0 1.07 0.76
328 T 1 -3 -2 -3 1 -3 -3 -3 -4 -1 -3 -3 -2 -4 -3 2 6 -4 -3 1 11 0 0 0 3 0 0 0 0 3 0 0 0 0 0 13 61 0 0 9 0.84 0.76
329 V -1 -4 -4 -5 -3 0 -4 -5 -4 3 1 -4 2 0 -4 -3 -1 5 -2 5 4 0 0 0 0 5 0 0 0 15 9 0 6 3 0 0 2 8 0 48 0.69 0.71
330 E -2 -2 -2 0 -4 1 6 -3 -2 -4 -4 -1 -3 -4 -3 2 -2 -4 -3 -4 0 0 0 0 0 4 75 0 0 0 0 0 0 0 0 16 0 0 0 0 1.15 0.68
331 F -3 -4 -2 -4 1 -4 -4 -4 -2 -2 -2 -4 -2 7 -4 -2 -1 -1 4 -1 0 0 2 0 4 0 0 0 0 0 1 0 0 68 0 2 4 0 13 3 1.24 0.68
332 G -1 -3 -2 -2 -3 -3 -3 7 -3 -4 -4 -3 -4 -4 -3 -2 -3 -3 -4 -4 1 1 0 1 0 0 1 90 0 1 1 1 0 0 1 1 1 0 0 1 1.51 0.58
333 L 1 -3 -3 -3 -2 -2 -3 -3 -3 2 2 -3 4 -2 -3 -2 2 -3 -2 2 15 1 1 1 0 1 1 1 0 15 16 1 15 1 1 1 15 0 0 15 0.36 0.57
334 C -3 -4 -4 -4 7 -4 -4 -4 -4 3 1 -4 3 -3 -4 -1 0 -4 1 3 1 1 0 1 26 0 1 1 0 14 12 1 9 0 1 5 5 0 5 18 0.77 1.06
335 K 0 3 0 -1 0 1 -1 0 0 -2 -2 4 0 -3 -3 -1 -1 1 1 -2 7 15 4 4 2 7 4 7 2 3 3 26 2 0 1 3 3 2 5 3 0.31 1.06
336 Q -2 -1 0 0 -5 4 4 -2 0 -5 -5 1 -4 -6 -4 -1 3 -5 -4 -5 2 2 4 4 0 22 32 3 2 0 0 10 0 0 0 3 17 0 0 0 0.77 1.32
337 G -1 -1 3 3 -5 0 0 2 1 -2 -3 -1 -4 -5 2 -2 -2 -6 -5 -2 5 3 17 19 0 3 6 15 3 2 3 4 0 0 11 2 2 0 0 3 0.44 1.32
338 D -1 -4 2 2 -5 0 2 5 -1 -6 -6 -1 -5 -5 -2 -2 -2 4 -5 -5 4 0 10 12 0 4 12 43 1 0 0 3 0 0 2 2 1 6 0 0 0.82 1.32
339 S -1 0 1 0 -5 1 0 -1 2 0 -1 0 2 1 1 0 0 -6 -4 0 6 6 6 6 0 6 6 6 6 6 6 6 6 6 6 6 6 0 0 6 0.10 1.78
340 I -4 1 1 -4 3 1 -4 -5 -4 1 0 0 3 1 1 0 0 -4 2 0 0 7 7 0 7 7 0 0 0 7 7 7 7 7 7 7 7 0 7 7 0.27 1.44
341 K -2 5 -2 -2 1 0 2 -4 -2 -4 -4 5 -2 -5 -3 -2 -2 -5 -4 -3 1 30 1 0 3 2 12 0 0 0 0 47 1 0 0 1 1 0 0 1 0.92 0.77
342 A 4 -4 -4 -4 0 -3 -4 1 -4 4 -1 -3 0 -3 -4 -1 -2 -4 -4 1 44 0 0 0 2 0 0 13 0 26 3 0 2 0 0 1 0 0 0 10 0.60 0.77
343 Y -4 -4 2 -4 -1 -3 -4 -5 0 -2 -2 -4 -3 3 -5 -3 -3 0 8 -3 0 0 11 0 2 0 0 0 0 2 3 0 0 9 0 0 0 0 74 0 1.53 0.77
344 G -2 1 -2 -3 -5 -3 -4 7 -4 -6 -5 -3 -4 -5 -4 -2 -3 -4 -5 -5 0 11 0 0 0 0 0 89 0 0 0 0 0 0 0 0 0 0 0 0 1.64 0.77
345 A 5 2 -3 -3 -3 -2 -3 1 -3 -3 -4 -2 -3 -4 -3 2 -2 -5 -4 -1 58 15 0 0 0 0 0 11 0 0 0 0 0 0 0 13 0 0 0 3 0.74 0.75
346 G 0 -4 -2 2 -4 -3 -3 6 3 -5 -5 -3 -4 -5 -4 -1 -2 -5 -4 -3 6 0 0 13 0 0 0 66 8 0 0 0 0 0 0 2 2 0 0 2 1.11 0.75
347 L -1 -4 -5 -5 5 -4 -5 -5 -5 5 3 -4 3 -2 -5 -4 -3 -4 -3 1 3 0 0 0 13 0 0 0 0 38 32 0 8 0 0 0 0 0 0 6 0.84 0.75
348 L -1 -4 -4 -4 5 -3 -4 -4 -4 3 4 -4 1 -2 -4 -3 -2 -3 -3 2 4 0 0 0 13 0 1 1 0 22 41 0 2 0 0 1 0 0 0 11 0.68 0.68
349 S -1 -2 -1 -2 -3 -2 -2 0 4 -4 -4 -2 -3 -3 -2 5 1 -4 -2 -3 1 0 0 0 0 0 1 5 13 0 1 0 0 0 0 67 8 0 0 1 0.87 0.68
350 S 0 2 -1 -2 3 -2 -2 -1 -2 -4 -4 -1 -3 -4 -2 5 -1 -4 -3 -3 4 14 0 0 6 0 1 3 0 0 1 0 0 0 0 68 0 0 0 1 0.82 0.68
351 F -1 1 -2 -1 -1 -2 -2 -3 1 2 -2 -1 -2 1 3 1 -1 -3 3 -1 3 9 1 4 1 1 1 2 3 13 2 4 0 6 15 15 3 0 14 4 0.27 0.68
352 G -1 -1 1 0 -4 0 2 5 -1 -4 -4 1 -3 -4 -3 0 0 -4 -4 -4 5 2 7 4 0 3 15 42 1 1 1 9 0 0 1 5 4 0 0 1 0.58 0.71
353 E -2 -2 -2 -1 -4 1 6 -3 -2 -4 -4 -1 -3 0 -3 1 -2 -4 -3 -3 1 1 0 1 0 4 71 1 0 1 1 1 0 5 1 12 1 0 0 1 1.04 0.71
354 L 1 -3 -3 -3 6 -3 -3 -2 -3 -1 3 -3 0 -2 -3 1 1 -3 -3 -1 11 1 0 1 17 0 1 2 0 3 32 1 1 0 1 14 11 0 0 3 0.47 0.71
355 Q -2 3 -2 0 -2 1 1 -3 -1 -1 0 1 -1 -4 -2 0 2 -5 -4 1 2 16 1 5 1 6 11 1 1 3 11 10 1 0 1 8 13 0 0 9 0.23 0.88
356 Y -3 -3 -1 -2 -2 -1 0 -4 8 -5 -5 -4 -4 2 -5 -2 -4 2 7 -5 1 1 3 2 1 3 5 1 35 0 0 0 0 6 0 3 0 3 36 0 1.43 1.48
357 C 4 -5 -4 -5 6 -4 -4 -3 -5 -2 -3 -4 0 3 -4 2 -1 -5 -4 0 40 0 0 0 17 0 0 1 0 2 1 0 3 12 0 16 2 0 0 7 0.87 1.48
358 L -2 0 -5 -5 1 -3 -5 -6 0 1 4 -2 4 1 -5 -3 -1 -4 -1 1 2 6 0 0 3 1 0 0 2 6 42 2 10 7 0 2 4 0 2 10 0.62 1.44
359 S -1 -2 2 -1 -2 0 1 -2 -1 -4 -5 -1 -4 -5 -2 5 2 -5 -4 -3 2 1 9 3 1 3 8 2 1 1 1 4 0 0 1 50 11 0 0 1 0.73 1.40
360 E 1 -2 1 5 -5 0 0 3 -4 -5 -5 -2 -1 -5 2 -1 -2 -6 -5 -3 10 2 5 32 0 4 4 19 0 0 0 2 2 0 10 3 3 0 0 1 0.65 1.43
361 K 0 -1 1 1 -1 -1 2 -1 -1 0 -3 4 -2 -5 -1 0 0 -6 -5 -2 7 1 6 6 1 2 16 4 2 5 2 28 1 0 3 6 7 0 0 3 0.38 1.46
362 P 2 -5 -3 -2 2 -3 -1 -4 -5 -1 -3 -4 0 -5 6 -1 -2 -6 -5 2 21 0 1 2 4 1 4 0 0 2 2 0 2 0 41 3 1 0 0 16 0.96 1.45
363 K -3 1 3 -1 -1 1 4 -5 -1 -1 -2 3 -2 -2 0 -3 -2 -5 -4 -1 1 6 15 2 1 5 28 0 1 4 3 17 1 2 6 0 2 0 0 5 0.50 1.45
364 L -4 4 -4 -5 -2 -2 -4 -6 3 3 0 2 -1 1 -5 -4 -2 -5 2 2 0 22 0 0 1 1 0 0 7 20 7 13 1 6 0 0 3 0 6 14 0.59 1.48
365 L -3 4 -3 -3 -5 0 1 -4 0 2 1 2 0 0 -5 -2 -2 -5 0 0 1 24 1 1 0 4 9 1 2 12 12 15 2 4 0 3 1 0 3 7 0.43 1.48
366 P 0 1 -2 1 -6 -1 1 -1 -3 -4 -5 0 -2 -6 6 -2 -3 -1 -2 -4 7 7 1 8 0 2 8 5 1 1 1 6 1 0 46 2 1 1 1 1 0.99 1.48
367 L -5 -5 -6 -6 -5 -5 -6 -6 -1 -1 2 -6 0 8 -6 -4 -5 4 3 -3 0 0 0 0 0 0 0 0 1 2 18 0 2 61 0 1 0 6 8 0 1.63 1.48
368 E -3 -2 2 6 -6 -1 2 -3 -2 -4 -6 -1 -5 -6 -4 1 -1 -6 -5 -3 1 2 8 53 0 2 12 1 1 1 0 3 0 0 0 11 3 0 0 2 1.09 1.48
369 L -2 -5 -5 -5 -5 -5 -5 -6 -5 3 2 -5 1 -2 6 -4 -1 -6 -5 1 3 0 0 0 0 0 0 0 0 14 23 0 3 2 42 0 4 0 0 10 1.13 1.49
370 E 0 -2 -1 1 -2 1 4 -4 1 -1 -1 0 1 1 -3 0 -2 -5 -4 -1 8 2 3 8 1 5 30 1 3 4 7 5 3 7 1 5 1 0 0 5 0.34 1.43
371 K 1 2 -2 3 -5 0 0 -4 1 1 -2 1 -2 -4 -3 -1 1 -1 -4 1 13 13 1 16 0 4 6 0 3 7 3 8 1 1 1 4 9 1 0 10 0.27 1.46
372 T 3 -5 -4 -3 2 -4 -4 -5 0 2 -2 -3 2 -4 -1 -3 3 -6 -4 4 22 0 0 1 4 0 0 0 2 10 2 1 6 0 2 0 22 0 0 27 0.65 1.47
373 A 3 -1 -5 -5 5 -2 -5 0 -5 1 2 -4 5 -1 -5 -1 -2 -5 -4 -1 24 3 0 0 11 2 0 7 0 9 18 0 15 2 0 4 1 0 0 3 0.57 1.46
374 I -3 4 2 2 -2 1 0 -3 -1 -3 -2 1 -3 -3 -1 -3 0 -6 -2 0 1 26 8 12 1 6 6 1 1 1 5 9 1 1 4 1 6 0 2 8 0.40 1.47
375 Q -3 2 -3 -4 -5 5 1 -5 -1 -2 -3 0 0 -5 -4 -2 5 -5 -2 -2 1 9 0 0 0 30 7 0 1 2 2 4 2 0 0 1 39 0 1 2 0.91 1.47
376 N -2 0 -1 1 -6 -2 3 -4 0 -5 -4 2 1 -6 5 -1 -1 -6 -5 -2 3 5 3 8 0 1 21 1 2 0 1 11 4 0 30 4 4 0 0 3 0.73 1.47
377 Y -2 -5 -5 -6 5 -4 -5 -4 -1 -2 -4 -5 -4 3 -4 -2 -4 -1 8 -2 2 0 0 0 13 1 0 1 1 2 0 0 0 11 1 3 0 0 64 2 1.76 1.47
378 T -3 4 0 4 -6 1 0 -4 -1 0 -2 -1 -3 -5 3 -1 -3 -3 0 -2 2 22 3 21 0 7 4 0 2 7 4 3 0 0 14 3 1 0 4 2 0.51 1.48
379 V -3 -5 -5 2 -4 -5 -5 -6 -6 7 -1 0 -2 -3 -1 -4 -1 -6 -3 1 1 0 0 11 0 0 0 0 0 63 3 6 0 1 3 0 4 0 1 8 1.12 1.48
380 T -3 -4 0 5 -3 2 -1 -3 -3 -5 -4 -3 -4 -4 -4 0 5 -2 -1 -3 0 0 3 32 0 10 2 2 0 0 1 0 0 1 0 4 40 1 2 1 0.96 1.48
381 E -1 0 -1 0 -2 0 1 0 2 2 -4 2 -2 -5 -4 1 3 -6 -4 -3 5 4 3 6 1 4 10 7 6 13 0 12 1 0 0 9 18 0 0 1 0.32 1.48
382 F -4 -5 -1 -6 -5 -3 -4 -6 -3 -1 0 -4 5 5 0 -4 -3 -2 6 -1 0 0 3 0 0 0 1 0 0 3 8 1 17 23 5 0 1 0 34 3 1.13 1.43
383 Q -3 -2 -2 -3 -5 8 -1 -4 4 -5 -5 -1 -3 -5 2 -3 -3 -5 -3 -5 0 0 0 0 0 76 0 0 12 0 0 0 0 0 12 0 0 0 0 0 1.62 1.04
384 P -1 -1 1 1 -5 1 4 -4 1 -5 -3 1 -4 -5 4 -1 -1 -5 -4 -4 3 3 7 5 0 6 32 0 3 0 3 8 0 0 23 4 3 0 0 0 0.70 1.04
385 L 0 -1 3 -1 0 0 -1 0 3 0 -2 -1 0 -4 -4 -1 3 -5 -4 1 10 3 14 2 2 4 3 7 8 5 3 3 2 0 0 3 20 0 0 12 0.27 1.04
386 Y -4 -4 -5 -5 -4 -4 -4 -5 -1 -2 2 -4 -2 3 -5 -4 -4 0 8 -3 0 0 0 0 0 0 0 0 0 0 22 0 0 10 0 0 0 0 67 0 1.52 0.83
387 Y -4 -4 -5 -5 1 -5 -5 -5 -2 -2 -1 -5 1 7 -5 -4 -4 4 5 -3 0 0 0 0 3 0 0 0 0 0 3 0 4 67 0 0 0 5 18 0 1.49 0.78
388 V 0 -3 -5 -5 0 -4 -2 -5 -4 2 -1 -4 0 -2 -5 -2 -1 -4 4 5 6 1 0 0 2 0 3 0 0 9 3 0 2 0 0 2 3 0 15 56 0.86 1.10
389 A 2 -4 -4 -4 2 -4 -4 -4 -4 4 1 -4 -2 0 -4 1 2 -4 -3 0 18 0 0 0 4 0 0 0 0 27 15 0 0 4 0 10 16 0 0 4 0.50 1.06
390 E -3 0 1 5 -5 -1 4 -3 -1 -5 -5 0 -4 -5 2 -1 -2 -5 -4 -5 1 6 7 32 0 2 28 1 1 0 0 3 0 0 11 4 2 0 0 0 0.80 1.06
391 S -1 -3 1 3 -4 -1 -1 -1 0 -5 -5 -1 -4 -5 -3 6 0 -5 -4 -4 1 0 5 15 0 1 2 4 3 0 0 2 0 0 0 63 3 0 0 0 0.93 1.06
392 F -4 -5 -5 -5 0 -5 -5 -5 -4 2 2 -5 0 7 -5 -4 -3 -2 2 -1 0 0 0 0 2 0 0 0 0 10 20 0 2 52 0 0 1 0 6 4 1.16 1.06
393 N 0 -1 -1 3 -2 1 4 -2 -1 -4 -3 1 -4 -3 -2 1 -1 -5 -4 -3 8 2 2 18 1 6 34 2 1 0 2 9 0 1 1 10 2 0 0 1 0.56 1.05
394 D -2 -1 -1 4 -5 3 3 -4 4 -3 -4 0 -2 -1 -3 -1 -1 -4 0 -4 3 3 1 21 0 16 23 0 10 1 0 5 1 3 0 5 3 0 3 1 0.60 1.05
395 A 3 -4 -4 -5 2 -4 -4 -3 -4 0 4 -4 3 -3 -4 -2 -3 -4 -3 0 27 0 0 0 4 0 0 2 0 3 50 0 6 0 0 1 0 0 0 4 0.74 1.05
396 K -2 0 -2 0 -4 0 0 -4 -2 0 0 3 0 3 -4 0 -1 -3 2 -2 3 5 1 6 0 3 6 1 1 6 10 23 3 14 0 6 4 0 8 2 0.29 1.08
397 E -1 0 0 4 -3 3 5 -3 -1 -3 -3 0 -4 -5 -4 0 -2 -5 -3 -3 4 6 3 23 0 11 35 1 1 1 2 3 0 0 0 7 1 0 1 1 0.72 1.13
398 K 0 0 -2 -1 -4 1 -1 -4 -4 3 1 4 -1 -4 -2 -1 -2 -5 -4 2 6 4 1 4 0 5 4 1 0 17 12 25 1 0 1 3 1 0 0 14 0.35 1.12
399 V 1 -4 -4 -4 0 -3 -3 -4 -4 0 3 -4 5 2 -4 -1 0 -4 -3 1 12 0 0 0 1 0 2 1 0 4 33 0 16 7 0 6 6 0 0 10 0.52 1.10
400 R -1 5 -1 1 -5 1 2 -1 1 -1 -4 2 -2 -4 -2 -2 -3 -4 0 -2 4 33 2 9 0 6 12 5 3 5 1 9 1 0 1 2 1 0 4 2 0.50 1.12
401 N 0 0 0 1 -2 2 3 -1 -3 -1 -2 2 3 -4 -3 0 1 -1 -2 -1 9 5 3 7 1 8 18 4 0 3 4 11 7 0 0 7 7 1 1 3 0.23 1.14
402 F -3 -4 -3 3 -4 -3 -3 -4 -3 0 0 -4 0 6 -4 -3 -3 4 4 -3 2 1 0 19 0 0 1 1 0 4 8 1 2 36 1 1 1 5 17 1 0.90 1.09
403 A 4 -3 -3 -3 0 -2 -1 0 -2 2 1 -3 0 0 -3 -1 -1 2 -3 0 34 1 0 1 2 2 4 6 1 13 12 1 2 4 1 4 4 3 0 6 0.35 1.10
404 A 2 0 2 1 -2 1 1 -1 -2 -3 -2 1 5 -4 -3 0 -2 -4 -4 -3 21 4 8 7 1 5 11 4 1 1 2 10 15 0 0 8 1 0 0 1 0.36 1.14
405 T 1 0 -1 -2 -4 2 -2 -1 1 -3 0 1 -2 -3 -2 2 4 -2 -3 -3 12 6 3 2 0 8 2 5 3 0 9 7 1 1 1 14 25 1 0 0 0.32 1.17
406 I 0 -3 -4 -5 -1 -2 -3 -1 -4 4 2 -3 6 0 -4 -3 -1 -4 -1 0 7 1 0 0 1 1 1 4 0 27 21 1 19 3 0 2 3 0 2 5 0.59 1.17
407 P -1 -1 -2 0 0 3 0 -2 1 -2 -1 2 -3 -3 3 -1 -2 -5 -2 1 5 3 2 6 2 15 6 3 3 2 5 13 0 1 13 4 2 0 1 13 0.26 1.21
408 R 0 6 -3 0 -4 -1 -1 -2 0 -1 -1 3 -3 -4 -1 -3 -1 -5 -4 -3 7 40 0 4 0 2 2 2 2 5 7 18 0 0 3 0 4 0 0 2 0.65 1.20
409 P -3 -1 -2 4 -5 1 2 -4 -4 -4 -3 -1 -4 -6 6 -2 -3 -6 -5 -5 1 3 1 23 0 5 12 1 0 1 3 3 0 0 45 3 0 0 0 0 1.19 1.24
410 F -3 -5 -3 -3 -5 -5 -4 -5 2 -3 0 -5 0 8 -4 -2 -2 -2 0 -3 1 0 1 2 0 0 1 0 6 0 6 0 2 73 1 3 3 0 1 1 1.55 1.22
411 S 3 -3 -2 -1 -4 -1 1 2 -1 0 -3 -1 -2 -3 0 2 0 -5 -3 -2 25 1 1 4 0 2 11 15 1 6 1 3 1 1 5 13 6 0 1 2 0.31 1.27
412 V -1 -3 -5 -3 -1 -4 -4 -4 -5 0 0 -4 -3 -3 6 -3 0 -5 -4 4 5 1 0 1 1 0 0 1 0 4 11 1 0 1 37 1 5 0 0 30 0.93 1.27
413 R -1 5 -2 -2 0 -3 -3 -5 1 0 1 2 -1 -3 -4 -3 -1 1 1 -1 5 31 1 2 2 0 0 0 3 5 17 13 1 0 0 1 4 2 5 5 0.48 1.27
414 Y -4 -4 -3 -3 -5 -4 -3 -2 1 -3 -3 -4 -3 5 -5 -4 -4 -1 8 -4 0 0 1 1 0 0 1 3 3 0 1 0 0 26 0 0 0 0 61 0 1.72 1.23
415 D 0 -2 4 5 -5 1 2 -4 -3 -5 -5 -2 -4 -5 2 -2 -1 -6 -5 -5 8 1 25 30 0 7 12 0 0 0 1 1 0 0 12 0 3 0 0 0 0.85 1.23
416 P 0 0 -1 -3 -5 -2 -2 -4 -2 -4 -4 -2 -4 0 7 -1 -3 -6 -4 -2 9 6 3 0 0 1 2 0 1 1 1 1 0 5 63 4 0 0 0 2 1.50 1.24
417 Y 0 -2 -2 -2 -5 -2 0 -4 1 -1 0 3 -2 1 -4 -3 -2 -2 6 -2 8 1 2 2 0 1 7 1 3 4 11 18 0 6 1 1 2 0 33 1 0.62 1.24
418 T 0 -2 -2 -2 -4 -2 0 -4 1 -2 -3 -2 -3 -1 -2 0 6 -4 3 -2 9 2 1 2 0 1 5 0 3 1 2 1 0 2 2 5 50 0 11 1 0.72 1.25
419 Q 1 1 -2 0 -1 5 2 0 -1 -5 -2 2 -2 -5 -2 -1 -3 -5 -4 -4 12 6 1 4 1 31 13 6 1 0 5 14 1 0 2 3 0 0 0 0 0.56 1.25
420 R 3 1 -1 -1 -1 0 -1 -2 -4 -3 -4 -2 -3 -5 -2 4 3 -5 -4 -3 25 7 2 2 1 5 3 1 0 1 1 1 0 0 2 31 16 0 0 1 0.56 1.24
421 I 0 -4 -2 -2 -4 -4 -4 2 -5 4 0 -3 -2 -3 -2 -2 -1 -5 -4 4 7 0 2 2 0 0 0 16 0 24 6 1 0 0 2 3 3 0 0 32 0.55 1.16
422 E 1 -3 -1 4 -3 1 5 -4 3 -3 -4 -1 -4 -5 -3 -2 -2 -5 -4 -3 12 0 1 21 1 5 42 0 6 2 1 2 0 0 0 2 2 0 0 1 0.80 1.12
423 V 0 -4 -5 -5 -3 -3 -4 -3 -5 4 0 -3 1 -3 -3 -3 -2 -5 -3 6 6 0 0 0 0 1 0 2 0 20 5 2 2 0 1 0 2 0 0 58 0.93 1.10
424 L -1 -4 -5 -5 -4 -2 -5 -5 -5 2 5 -3 0 -1 -5 -2 -2 -4 -3 0 4 0 0 0 0 2 0 0 0 10 70 2 1 2 0 4 2 0 0 3 0.96 1.15
425 D -2 -2 0 6 -5 -2 1 -3 -4 -5 -5 1 -2 -6 3 0 0 -6 -4 -5 3 2 4 42 0 1 6 1 0 0 0 10 1 0 17 5 6 0 1 0 0.86 1.19
426 N -1 -2 2 2 -2 -1 0 2 -1 -5 -5 -1 -4 -3 -2 3 2 -5 -3 -2 3 2 12 12 1 2 6 13 2 0 0 3 0 1 2 26 14 0 1 3 0.44 1.19
427 T -2 -2 -2 5 -5 -1 -1 -4 -4 0 -2 1 -1 -2 2 -2 2 -6 -5 0 3 2 1 37 0 2 3 0 0 5 3 9 1 2 10 2 11 0 0 9 0.56 1.20
428 Q -1 5 -1 1 -4 3 0 -2 2 -4 -3 1 -4 -3 0 -1 -2 -5 -2 -2 5 32 2 7 0 11 6 3 6 1 3 9 0 1 5 5 1 0 1 2 0.50 1.20
429 Q 1 0 -2 -1 -3 2 -3 -3 -2 0 -3 2 0 -4 -4 1 -2 -5 -4 4 12 5 1 3 0 10 0 1 1 4 0 16 2 0 0 13 1 0 0 31 0.44 1.19
430 L -3 -2 -2 -5 -4 -4 -3 -3 -5 5 3 -3 1 0 -5 -4 -3 -4 -1 2 1 2 2 0 0 0 2 2 0 34 32 1 2 4 0 0 0 0 2 15 0.75 1.19
431 K 0 0 2 -2 0 3 1 -4 2 -2 -3 2 -1 -5 -1 -1 3 -5 -4 -2 9 4 9 2 2 13 9 0 6 3 2 11 2 0 3 2 24 0 0 2 0.39 1.20
432 I 0 5 2 0 -3 -1 0 -2 1 -2 -1 -1 -2 -2 -4 0 1 -5 -4 -1 6 32 12 6 0 1 5 2 3 2 6 2 1 1 0 6 8 0 0 5 0.41 1.20
433 L 0 -5 -4 -5 -2 -4 -4 4 1 -2 3 -4 -1 -2 -5 0 -3 -5 -4 1 9 0 0 0 1 0 1 36 4 1 28 0 1 1 0 7 1 0 0 12 0.63 1.20
434 A 1 -4 -2 -3 -2 -4 -3 -3 -5 0 2 -4 1 -1 -1 0 4 -5 -3 2 10 0 1 1 1 0 1 1 0 5 19 0 3 2 3 6 31 0 1 17 0.48 1.20
435 D -1 3 2 0 -3 3 1 3 1 -5 -5 0 -4 -5 -4 1 -2 -2 -3 -5 3 14 11 5 1 15 10 20 3 1 0 5 0 0 0 10 1 1 1 0 0.50 1.19
436 S -3 0 2 3 -2 2 5 -2 1 -5 -5 0 -4 -5 -4 0 -1 -3 -4 -3 1 4 10 17 1 9 36 3 4 0 0 3 0 0 0 8 4 0 0 1 0.69 1.13
437 I -3 -4 -5 -5 -3 -4 -5 -6 -4 4 3 -4 3 0 -5 -4 0 -4 2 3 0 0 0 0 0 0 0 0 0 24 34 0 6 2 0 0 5 0 7 22 0.76 0.93
438 N -3 4 3 -1 -5 3 -1 -3 2 -5 -5 4 -4 -5 -4 1 -2 -5 -4 -5 0 22 17 3 0 16 1 0 5 0 0 24 0 0 0 11 0 0 0 0 0.77 0.92
439 S -1 -3 1 2 -3 0 2 2 4 -4 -1 -3 -3 -2 -4 2 0 -5 -2 -3 3 0 7 11 0 4 12 18 11 1 6 0 0 2 0 17 6 0 1 1 0.37 0.91
440 E -1 -3 0 4 -5 1 5 -1 -2 -5 -5 -2 1 -5 -3 -2 -3 -5 -3 -4 5 0 3 27 0 5 50 5 0 0 0 0 4 0 0 0 0 0 1 0 0.98 0.89
441 I -1 -4 -5 -5 -3 -4 -5 -5 -5 2 4 -4 4 1 -5 -3 -2 -4 -3 2 5 0 0 0 0 0 0 0 0 13 49 0 13 7 0 1 1 0 0 12 0.80 0.89
442 G -2 -2 3 2 1 2 0 0 2 -4 -2 0 -3 -5 -4 2 0 -5 -4 -2 2 1 16 14 4 12 3 8 4 0 4 6 0 0 0 18 5 0 0 3 0.37 0.89
443 I 0 -4 0 -4 -3 0 -3 -4 4 4 0 -2 -1 -3 -4 0 2 -5 -3 1 9 0 4 0 0 4 0 0 11 32 7 1 1 0 0 7 15 0 0 9 0.47 0.89
444 L -3 -4 -5 -5 -3 -4 -1 -6 -5 2 5 -4 1 0 -5 -4 0 -4 -3 2 0 0 0 0 0 0 4 0 0 10 61 0 2 3 0 0 5 0 0 14 0.83 0.89
445 C 0 -2 1 0 5 1 -1 0 -1 -2 -3 -1 1 -3 -4 2 3 -5 -4 -1 7 1 7 4 13 5 4 7 2 1 1 4 3 1 0 14 23 0 0 3 0.37 0.89
446 S -2 -3 4 4 0 -1 1 -2 3 -4 -3 -1 -4 -3 -4 1 2 -5 -1 -3 2 0 21 26 2 2 7 2 7 0 2 3 0 1 0 10 12 0 2 1 0.56 0.89
447 A 6 -4 -3 -4 -3 -3 -3 -2 -4 -3 -1 -3 -3 1 -3 1 -1 -4 -3 -1 77 0 0 0 0 0 0 0 0 0 4 0 0 6 0 8 2 0 0 2 0.97 0.85
448 L 0 -4 -5 -5 -3 -4 -5 -5 -5 1 5 -4 2 0 -5 -4 -3 -4 -3 1 9 0 0 0 0 0 0 0 0 6 71 0 5 2 0 0 0 0 0 7 0.94 0.85
449 Q 0 1 3 1 -2 0 2 0 0 -5 -3 2 -4 -5 -3 2 -2 -5 -4 -3 6 9 18 8 1 3 15 8 2 0 2 12 0 0 0 15 1 0 0 1 0.39 0.85
450 K 0 3 -1 -3 -5 0 -1 -4 -3 -4 -4 6 -2 -5 -3 -1 -1 -5 -1 -1 6 12 2 0 0 1 2 0 0 0 0 66 1 0 0 2 2 0 2 5 0.95 0.83
451 I -3 -4 -5 -4 -1 -4 -5 -5 -5 4 4 -4 6 -1 -5 -4 -3 -4 -3 1 0 0 0 1 1 0 0 0 0 32 39 0 23 1 0 0 0 0 0 4 0.95 0.83
452 K -2 2 -2 -2 -5 4 2 -3 -2 -4 -4 5 -3 -5 -3 -2 -2 -4 -3 -4 0 11 0 0 0 24 10 0 0 0 0 55 0 0 0 0 0 0 0 0 0.91 0.53

MSA with all mammalian homologous

I65T

R71H

R158Q

R261Q

T266A

P275S

T278N

P281L

G312D

R408W

Mutations and secondary structure

Predicted secondary structure

We took the secondary structure prediction from Task 3:

Reference MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAK
1PHZ ------------------GQETSYIEDNSNQNGAISLIFSLKEEVGALAK
DSSP --------------------------------------------------
PSIPRED CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCHHHHH
JPred --HHHH--HHHHHHHHHH---------------EEEEEEEE----HHHHH
Reference VLRLFEENDVNLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRH
1PHZ VLRLFEENDINLTHIESRPSRLNKDEYEFFTYLDKRTKPVLGSIIKSLRN
DSSP --------------------------------------------------
PSIPRED HHHHHHHCCCCEEEEECCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHCC
JPred HHHHHHH---EEEEEE----------EEEEEEEE---HHHHHHHHHHHHH
Reference DIGATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPGFK
1PHZ DIGATVHELSRDKEKNTVPWFPRTIQELDRFANQI------LDADHPGFK
DSSP -----------------.....SBGGGGGGTT.S.------..TTSTTTT
PSIPRED CCEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCC
JPred H-----EEE----------------HHHHHH---EEE-------------
Reference DPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKT
1PHZ DPVYRARRKQFADIAYNYRHGQPIPRVEYTEEEKQTWGTVFRTLKALYKT
DSSP .HHHHHHHHHHHHHHHH..TTS........HHHHHHHHHHHHHHHHHHHH
PSIPRED CHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCC
JPred -HHHHHHHHHHHH-----------------HHHHHHHHHHHHHHHHH---
Reference HACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLS
1PHZ HACYEHNHIFPLLEKYCGFREDNIPQLEDVSQFLQTCTGFRLRPVAGLLS
DSSP HB.HHHHHHHHHHHHHS..BTTB...HHHHHHHHHHHT..EEEE.SS...
PSIPRED CHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCEEEECCCCCC
JPred --HHHHHHHHHHHHHH----------HHHHHHHHHHH---EEEE------
Reference SRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFA
1PHZ SRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFA
DSSP HHHHHHHHTTTEEEE......TT.TT..SS..HHHHHTTTTTTTTSHHHH
PSIPRED HHHHHHHCCCCEECCCEEEECCCCCCCCCCCCHHHHHHCCCCCCCCCHHH
JPred HHHHHHHH----EEEEEEE-----------HHHHHHHH--------HHHH
Reference QFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSS
1PHZ QFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKEGDSIKAYGAGLLSS
DSSP HHHHHHHHHHTT..HHHHHHHHHHHHTTTTT.EEEETTEEEE..HHHHT.
PSIPRED HHHHHHHHHCCCCCHHHHHHHHHHEEEEEEEEEECCCCCEEEECCCCCCC
JPred HHHHHHHHHHH---HHHHHHHHH-HHHEEEEEEEEE---EEEEE------
Reference FGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVR
1PHZ FGELQYCLSDKPKLLPLELEKTACQEYSVTEFQPLYYVAESFSDAKEKVR
DSSP HHHHHHTTSSSS..EE..HHHHTT....SSS..S..EEES.HHHHHHHHH
PSIPRED HHHHHHHHCCCCCCCCCCHHHHHCCCCCCCCCCEEEEEECCHHHHHHHHH
JPred HHHHHHHH-----EE---HHHHH-----------EEEE---HHHHHHHHH
Reference NFAATIPRPFSVRYDPYTQRIEVLDNTQQLKILADSINSEIGILCSALQK
1PHZ TFAATIPRPFSVRYDPYTQRVEVLDNT-----------------------
DSSP HHHHTS..SSEEEEETTTTEEEEE.HHHHHHHHHHHHHHHHHHHHHHHHH
PSIPRED HHHHHCCCCCEEEECCCCCEEEECCCHHHHHHHHHHHHHHHHHHHHHHHH
JPred HHHHHH------------EEEEE---HHHHHHHHHHHHHHHHHHHHHHHH
Reference IK
1PHZ --
DSSP T.
PSIPRED HC
JPred --


I65T

R71H

R158Q

R261Q

T266A

P275S

T278N

P281L

G312D

R408W

Predicting the effect of mutations with SNAP, SIFT and Polyphen2

SNAP

SIFT

Execution

To run our predictions with SIFT we used the webservice. We had the following input (See also figure):

SIFT input
  • Sequence: Fasta sequence from the Uniprot entry P00439.
  • Substitutions: our ten selected substitutions
  • Database to search: UniRef90_2011_Apr
  • Median conservation of sequences: 3.00
  • Removed sequences: If sequence identity is greater than 90%

Results

Polyphen2

Execution

To run our predictions with Polyphen2 we used the webservice. We had the following input (See also figure):

Polyphen2 input
  • Sequence: Fasta sequence from the Uniprot entry P00439.
  • Substitutions: our ten selected substitutions
  • Classifier model: HumDiv
  • Genome assembly: GRCh37/hg19
  • Transcripts: canonical
  • Annotations: missense

Results

I65T

R71H

R158Q

R261Q

T266A

P275S

T278N

P281L

G312D

R408W

Discussion