User contributions

From Bioinformatikpedia

For Wagnerr (talk | block log | uploads | logs)

Search for contributions

 Show contributions of new accounts only
 IP address or username:

Namespace:  all (Main) Talk User User talk Bioinformatikpedia Bioinformatikpedia talk File File talk MediaWiki MediaWiki talk Template Template talk Help Help talk Category Category talk   Invert selection  Associated namespace 

Tag filter: 

 Only show edits that are latest revisions Only show edits that are page creations Hide minor edits

From date:

To date:

• 16:14, 3 December 2012 (diff | hist) . . (0)‎ . . Task 5: Researching SNPs ‎ (current)
• 16:13, 3 December 2012 (diff | hist) . . (0)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (current)
• 16:12, 3 December 2012 (diff | hist) . . (0)‎ . . Maple Syrup Urine Disease 2012 ‎ (→‎Tasks)
• 16:12, 3 December 2012 (diff | hist) . . (0)‎ . . m Task 3: odba human Sequence-based predictions ‎ (moved Task 3: obda human Sequence-based predictions to Task 3: odba human Sequence-based predictions) (current)
• 16:12, 3 December 2012 (diff | hist) . . (0)‎ . . m Talk:Task 3: odba human Sequence-based predictions ‎ (moved Talk:Task 3: obda human Sequence-based predictions to Talk:Task 3: odba human Sequence-based predictions) (current)
• 16:12, 3 December 2012 (diff | hist) . . (+59)‎ . . N Task 3: obda human Sequence-based predictions ‎ (moved Task 3: obda human Sequence-based predictions to Task 3: odba human Sequence-based predictions) (current)
• 16:12, 3 December 2012 (diff | hist) . . (+64)‎ . . N Talk:Task 3: obda human Sequence-based predictions ‎ (moved Talk:Task 3: obda human Sequence-based predictions to Talk:Task 3: odba human Sequence-based predictions) (current)
• 18:10, 17 November 2012 (diff | hist) . . (0)‎ . . m Task 8: MSUD - Molecular Dynamics Simulations ‎ (moved Task 8: MSUP - Molecular Dynamics Simulations to Task 8: MSUD - Molecular Dynamics Simulations) (current)
• 18:10, 17 November 2012 (diff | hist) . . (+59)‎ . . N Task 8: MSUP - Molecular Dynamics Simulations ‎ (moved Task 8: MSUP - Molecular Dynamics Simulations to Task 8: MSUD - Molecular Dynamics Simulations) (current)
• 18:10, 17 November 2012 (diff | hist) . . (0)‎ . . Maple Syrup Urine Disease 2012 ‎ (→‎Tasks)
• 18:09, 17 November 2012 (diff | hist) . . (0)‎ . . m Task 7: MSUD - Structure-based mutation analysis ‎ (moved Task 7: MSUP - Structure-based mutation analysis to Task 7: MSUD - Structure-based mutation analysis)
• 18:09, 17 November 2012 (diff | hist) . . (0)‎ . . m Talk:Task 7: MSUD - Structure-based mutation analysis ‎ (moved Talk:Task 7: MSUP - Structure-based mutation analysis to Talk:Task 7: MSUD - Structure-based mutation analysis) (current)
• 18:09, 17 November 2012 (diff | hist) . . (+62)‎ . . N Task 7: MSUP - Structure-based mutation analysis ‎ (moved Task 7: MSUP - Structure-based mutation analysis to Task 7: MSUD - Structure-based mutation analysis) (current)
• 18:09, 17 November 2012 (diff | hist) . . (+67)‎ . . N Talk:Task 7: MSUP - Structure-based mutation analysis ‎ (moved Talk:Task 7: MSUP - Structure-based mutation analysis to Talk:Task 7: MSUD - Structure-based mutation analysis) (current)
• 18:08, 17 November 2012 (diff | hist) . . (0)‎ . . Maple Syrup Urine Disease 2012 ‎ (→‎Tasks)
• 18:08, 17 November 2012 (diff | hist) . . (0)‎ . . m Talk:Task 6: MSUD - Sequence-based mutation analysis ‎ (moved Talk:Task 6: MSUP - Sequence-based mutation analysis to Talk:Task 6: MSUD - Sequence-based mutation analysis) (current)
• 18:08, 17 November 2012 (diff | hist) . . (+66)‎ . . N Talk:Task 6: MSUP - Sequence-based mutation analysis ‎ (moved Talk:Task 6: MSUP - Sequence-based mutation analysis to Talk:Task 6: MSUD - Sequence-based mutation analysis) (current)
• 18:08, 17 November 2012 (diff | hist) . . (0)‎ . . m Task 6: MSUD - Sequence-based mutation analysis ‎ (moved Task 6: MSUP - Sequence-based mutation analysis to Task 6: MSUD - Sequence-based mutation analysis) (current)
• 18:08, 17 November 2012 (diff | hist) . . (+61)‎ . . N Task 6: MSUP - Sequence-based mutation analysis ‎ (moved Task 6: MSUP - Sequence-based mutation analysis to Task 6: MSUD - Sequence-based mutation analysis) (current)
• 16:39, 15 August 2012 (diff | hist) . . (+55)‎ . . Maple Syrup Urine Disease 2012 ‎ (→‎Final Report)
• 16:38, 15 August 2012 (diff | hist) . . (+21)‎ . . Maple Syrup Urine Disease 2012 ‎
• 21:12, 9 July 2012 (diff | hist) . . (+170)‎ . . MSUD Task 9 Protocoll ‎ (→‎JMol Script) (current)
• 21:02, 9 July 2012 (diff | hist) . . (+296)‎ . . N MSUD Task 9 Protocoll ‎ (Created page with "= JMol Script = i = 0; name = "frame0000.gif"; thisFrame = 0; width = 500; height = 500; while( i < 17) { frame next; refresh; thisFrame = thisFrame + 1; fil…")
• 21:02, 9 July 2012 (diff | hist) . . (-50)‎ . . Task 9: MSUD - Normal Mode Analysis ‎ (→‎Mode Visualization) (current)
• 21:01, 9 July 2012 (diff | hist) . . (+158)‎ . . Task 9: MSUD - Normal Mode Analysis ‎ (→‎Mode Visualization)
• 20:54, 9 July 2012 (diff | hist) . . (0)‎ . . N File:NMAmode12.gif ‎ (current)
• 20:53, 9 July 2012 (diff | hist) . . (0)‎ . . N File:NMAmode11.gif ‎ (current)
• 20:53, 9 July 2012 (diff | hist) . . (0)‎ . . N File:NMAmode10.gif ‎ (current)
• 20:52, 9 July 2012 (diff | hist) . . (+33)‎ . . Task 9: MSUD - Normal Mode Analysis ‎ (→‎Mode Visualization)
• 20:21, 9 July 2012 (diff | hist) . . (0)‎ . . N File:NMAmode9.gif ‎ (current)
• 20:21, 9 July 2012 (diff | hist) . . (0)‎ . . Task 9: MSUD - Normal Mode Analysis ‎ (→‎Mode Visualization)
• 20:21, 9 July 2012 (diff | hist) . . (-157)‎ . . Task 9: MSUD - Normal Mode Analysis ‎ (→‎Mode Visualization)
• 20:02, 9 July 2012 (diff | hist) . . (0)‎ . . N File:NMAmode8.gif ‎ (current)
• 20:02, 9 July 2012 (diff | hist) . . (-155)‎ . . Task 9: MSUD - Normal Mode Analysis ‎ (→‎Mode Visualization)
• 19:51, 9 July 2012 (diff | hist) . . (0)‎ . . N File:NMAmode7.gif ‎ (current)
• 19:51, 9 July 2012 (diff | hist) . . (-80)‎ . . Task 9: MSUD - Normal Mode Analysis ‎ (→‎Mode Visualization)
• 19:50, 9 July 2012 (diff | hist) . . (+924)‎ . . Task 9: MSUD - Normal Mode Analysis ‎ (→‎Mode Visualization)
• 21:24, 4 July 2012 (diff | hist) . . (+77)‎ . . Task 9: MSUD - Normal Mode Analysis ‎ (→‎WEBnm@)
• 21:20, 4 July 2012 (diff | hist) . . (+1)‎ . . Task 9: MSUD - Normal Mode Analysis ‎ (→‎Correlation Matrix)
• 21:19, 4 July 2012 (diff | hist) . . (0)‎ . . N File:1U5B correlation matrix.png ‎ (current)
• 21:19, 4 July 2012 (diff | hist) . . (+5)‎ . . Task 9: MSUD - Normal Mode Analysis ‎ (→‎Correlation Matrix)
• 21:19, 4 July 2012 (diff | hist) . . (+328)‎ . . Task 9: MSUD - Normal Mode Analysis ‎ (→‎Correlation Matrix)
• 21:12, 4 July 2012 (diff | hist) . . (+609)‎ . . Task 9: MSUD - Normal Mode Analysis ‎ (→‎WEBnm@)
• 20:40, 4 July 2012 (diff | hist) . . (-1)‎ . . Task 9: MSUD - Normal Mode Analysis ‎ (→‎Deformation Energies)
• 20:40, 4 July 2012 (diff | hist) . . (0)‎ . . N File:MSUD 9 Eigenvalue.png ‎ (current)
• 20:36, 4 July 2012 (diff | hist) . . (-2)‎ . . Task 9: MSUD - Normal Mode Analysis ‎ (→‎Atomic Displacement)
• 20:35, 4 July 2012 (diff | hist) . . (+7)‎ . . Task 9: MSUD - Normal Mode Analysis ‎ (→‎Atomic Displacement)
• 20:35, 4 July 2012 (diff | hist) . . (0)‎ . . N File:1U5B.pdb.mode7to12plot.png ‎ (current)
• 20:35, 4 July 2012 (diff | hist) . . (+1)‎ . . Task 9: MSUD - Normal Mode Analysis ‎ (→‎Atomic Displacement)
• 20:35, 4 July 2012 (diff | hist) . . (-767)‎ . . Task 9: MSUD - Normal Mode Analysis ‎ (→‎Atomic Displacement)
• 20:31, 4 July 2012 (diff | hist) . . (+38)‎ . . Task 9: MSUD - Normal Mode Analysis ‎ (→‎Atomic Displacement)
• 20:30, 4 July 2012 (diff | hist) . . (0)‎ . . N File:1U5B.pdb.mode7plot.png ‎ (current)
• 20:30, 4 July 2012 (diff | hist) . . (0)‎ . . Task 9: MSUD - Normal Mode Analysis ‎ (→‎WEBnm@)
• 20:29, 4 July 2012 (diff | hist) . . (+825)‎ . . Task 9: MSUD - Normal Mode Analysis ‎ (→‎WEBnm@)
• 20:05, 4 July 2012 (diff | hist) . . (+99)‎ . . Task 9: MSUD - Normal Mode Analysis ‎ (→‎WEBnm@)
• 20:02, 4 July 2012 (diff | hist) . . (+1,313)‎ . . Task 9: MSUD - Normal Mode Analysis ‎ (→‎WEBnm@)
• 19:27, 4 July 2012 (diff | hist) . . (+57)‎ . . N Task 9: MSUD - Normal Mode Analysis ‎ (Created page with "= WEBnm@ = insert text here = ElNemo = insert text here")
• 19:26, 4 July 2012 (diff | hist) . . (0)‎ . . Maple Syrup Urine Disease 2012 ‎ (→‎Tasks)
• 19:25, 4 July 2012 (diff | hist) . . (+41)‎ . . Maple Syrup Urine Disease 2012 ‎ (→‎Tasks)
• 08:49, 3 July 2012 (diff | hist) . . (+119)‎ . . Talk:Molecular Dynamics Simulations TSD ‎ (current)
• 08:48, 3 July 2012 (diff | hist) . . (+73)‎ . . N Talk:Molecular Dynamics Simulations TSD ‎ (Created page with "Well really not much to discuss, we're still waiting for the results too.")
• 14:52, 2 July 2012 (diff | hist) . . (+17)‎ . . Task 8: MSUD - Molecular Dynamics Simulations ‎ (→‎Results)
• 14:51, 2 July 2012 (diff | hist) . . (+13)‎ . . Task 8: MSUD - Molecular Dynamics Simulations ‎
• 16:16, 1 July 2012 (diff | hist) . . (+9)‎ . . Task 8: MSUD - Molecular Dynamics Simulations ‎ (→‎Task description)
• 16:15, 1 July 2012 (diff | hist) . . (+2,016)‎ . . Task 8: MSUD - Molecular Dynamics Simulations ‎
• 08:04, 26 June 2012 (diff | hist) . . (0)‎ . . Talk:Canavan Task 7 - Structure-based mutation analysis ‎ (current)
• 08:04, 26 June 2012 (diff | hist) . . (+540)‎ . . N Talk:Canavan Task 7 - Structure-based mutation analysis ‎ (Created page with "Hi, I what i liked most about your page is that it is really well layed out and thereby easy to read. you don't spam tables (like we do :P) but instead use images and diagrams wh…")
• 21:32, 25 June 2012 (diff | hist) . . (+59)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎Minimise)
• 21:13, 25 June 2012 (diff | hist) . . (-2)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎foldX)
• 21:12, 25 June 2012 (diff | hist) . . (+35)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎foldX)
• 21:11, 25 June 2012 (diff | hist) . . (+84)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎foldX)
• 21:09, 25 June 2012 (diff | hist) . . (+145)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎foldX)
• 21:07, 25 June 2012 (diff | hist) . . (-172)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎foldX)
• 21:02, 25 June 2012 (diff | hist) . . (-81)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎foldX)
• 20:57, 25 June 2012 (diff | hist) . . (-85)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎foldX)
• 20:55, 25 June 2012 (diff | hist) . . (-82)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎foldX)
• 20:54, 25 June 2012 (diff | hist) . . (-90)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎foldX)
• 20:53, 25 June 2012 (diff | hist) . . (-95)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎foldX)
• 20:51, 25 June 2012 (diff | hist) . . (-88)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎foldX)
• 20:46, 25 June 2012 (diff | hist) . . (+64)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎Task description)
• 20:45, 25 June 2012 (diff | hist) . . (+2,154)‎ . . MSUP-task7-journal ‎ (→‎FoldX) (current)
• 20:25, 25 June 2012 (diff | hist) . . (+344)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎Conclusion Table)
• 19:17, 25 June 2012 (diff | hist) . . (+70)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎Conclusion Table)
• 19:14, 25 June 2012 (diff | hist) . . (+3)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎Minimise)
• 19:13, 25 June 2012 (diff | hist) . . (+177)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎Minimise)
• 19:01, 25 June 2012 (diff | hist) . . (+50)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎Minimise)
• 18:58, 25 June 2012 (diff | hist) . . (+315)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎Minimise)
• 18:39, 25 June 2012 (diff | hist) . . (-105)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎foldX)
• 18:36, 25 June 2012 (diff | hist) . . (+184)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎Minimise)
• 18:29, 25 June 2012 (diff | hist) . . (0)‎ . . N File:MSUD minimise.png ‎ (current)
• 18:28, 25 June 2012 (diff | hist) . . (+392)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎Minimise)
• 18:18, 25 June 2012 (diff | hist) . . (+193)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎Minimise)
• 18:15, 25 June 2012 (diff | hist) . . (+134)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎Minimise)
• 18:09, 25 June 2012 (diff | hist) . . (-54)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎Minimise)
• 17:55, 25 June 2012 (diff | hist) . . (+219)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎Minimise)
• 17:41, 25 June 2012 (diff | hist) . . (+1,899)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎Minimise)
• 16:09, 25 June 2012 (diff | hist) . . (-13)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎Minimise)
• 16:05, 25 June 2012 (diff | hist) . . (-9)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎Minimise)
• 16:03, 25 June 2012 (diff | hist) . . (-14)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎Minimise)
• 15:59, 25 June 2012 (diff | hist) . . (-28)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎Minimise)
• 15:57, 25 June 2012 (diff | hist) . . (+6)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎Minimise)
• 15:55, 25 June 2012 (diff | hist) . . (+2,043)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎Minimise)
• 13:04, 25 June 2012 (diff | hist) . . (0)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎foldX)
• 13:03, 25 June 2012 (diff | hist) . . (+1,105)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎foldX)
• 12:26, 25 June 2012 (diff | hist) . . (+37)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎foldX)
• 12:22, 25 June 2012 (diff | hist) . . (+1)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎foldX)
• 12:21, 25 June 2012 (diff | hist) . . (+2)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎foldX)
• 12:20, 25 June 2012 (diff | hist) . . (+86)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎foldX)
• 12:07, 25 June 2012 (diff | hist) . . (+36)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎foldX)
• 12:01, 25 June 2012 (diff | hist) . . (+2,136)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎foldX)
• 18:10, 24 June 2012 (diff | hist) . . (+213)‎ . . MSUP-task7-journal ‎
• 18:06, 24 June 2012 (diff | hist) . . (+1)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎gromacs)
• 18:05, 24 June 2012 (diff | hist) . . (0)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎ (→‎minimize)
• 18:05, 24 June 2012 (diff | hist) . . (+147)‎ . . Task 7: MSUD - Structure-based mutation analysis ‎
• 22:09, 18 June 2012 (diff | hist) . . (+7)‎ . . Talk:Sequence-based mutation analysis Gaucher Disease ‎ (current)
• 22:08, 18 June 2012 (diff | hist) . . (+792)‎ . . N Talk:Sequence-based mutation analysis Gaucher Disease ‎ (Created page with "Hi, I just read your page and found some typos: in the introduction above the index - we ''assigend'' a disease score Structual Analysis, last sentence - of ''disulide'' bonds. D…")
• 20:26, 18 June 2012 (diff | hist) . . (+448)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Discussion)
• 20:14, 18 June 2012 (diff | hist) . . (+120)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Discussion)
• 12:23, 17 June 2012 (diff | hist) . . (+294)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Discussion)
• 12:03, 17 June 2012 (diff | hist) . . (+127)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Discussion)
• 12:01, 17 June 2012 (diff | hist) . . (+35)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Discussion)
• 12:00, 17 June 2012 (diff | hist) . . (+1)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Discussion)
• 11:53, 17 June 2012 (diff | hist) . . (0)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Discussion)
• 11:52, 17 June 2012 (diff | hist) . . (0)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎PSI-BLAST - PSSM)
• 11:49, 17 June 2012 (diff | hist) . . (+40)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Discussion)
• 20:15, 16 June 2012 (diff | hist) . . (+157)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Discussion)
• 20:09, 16 June 2012 (diff | hist) . . (+35)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Discussion)
• 20:08, 16 June 2012 (diff | hist) . . (+9)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Discussion)
• 20:08, 16 June 2012 (diff | hist) . . (+7)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Discussion)
• 20:08, 16 June 2012 (diff | hist) . . (-18)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Discussion)
• 20:05, 16 June 2012 (diff | hist) . . (+129)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Discussion)
• 20:01, 16 June 2012 (diff | hist) . . (+73)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Discussion)
• 19:57, 16 June 2012 (diff | hist) . . (+104)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Discussion)
• 19:55, 16 June 2012 (diff | hist) . . (+1)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Discussion)
• 19:52, 16 June 2012 (diff | hist) . . (0)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Discussion)
• 19:51, 16 June 2012 (diff | hist) . . (+24)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Discussion)
• 19:50, 16 June 2012 (diff | hist) . . (-75)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Discussion)
• 19:49, 16 June 2012 (diff | hist) . . (+595)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Discussion)
• 19:46, 16 June 2012 (diff | hist) . . (+159)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Discussion)
• 19:43, 16 June 2012 (diff | hist) . . (+303)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Discussion)
• 19:33, 16 June 2012 (diff | hist) . . (+153)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Discussion)
• 19:28, 16 June 2012 (diff | hist) . . (+1)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Discussion)
• 19:27, 16 June 2012 (diff | hist) . . (+88)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Discussion)
• 19:22, 16 June 2012 (diff | hist) . . (-10)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎PSI-BLAST - PSSM)
• 19:22, 16 June 2012 (diff | hist) . . (+142)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎3D-Structure)
• 19:18, 16 June 2012 (diff | hist) . . (-631)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Tools)
• 19:17, 16 June 2012 (diff | hist) . . (+50)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Discussion)
• 19:16, 16 June 2012 (diff | hist) . . (+66)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Discussion)
• 19:13, 16 June 2012 (diff | hist) . . (+17)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎
• 19:13, 16 June 2012 (diff | hist) . . (+41)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎
• 18:01, 16 June 2012 (diff | hist) . . (0)‎ . . File:M82I.gif ‎ (uploaded a new version of "File:M82I.gif") (current)
• 17:50, 16 June 2012 (diff | hist) . . (0)‎ . . N File:R429H.gif ‎ (current)
• 17:49, 16 June 2012 (diff | hist) . . (+332)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎3D-Structure)
• 17:40, 16 June 2012 (diff | hist) . . (+34)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎3D-Structure)
• 17:39, 16 June 2012 (diff | hist) . . (+28)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎3D-Structure)
• 17:34, 16 June 2012 (diff | hist) . . (0)‎ . . N File:N404S.gif ‎ (current)
• 17:33, 16 June 2012 (diff | hist) . . (+24)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎3D-Structure)
• 17:21, 16 June 2012 (diff | hist) . . (0)‎ . . N File:I361V.gif ‎ (current)
• 17:20, 16 June 2012 (diff | hist) . . (+19)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎3D-Structure)
• 16:56, 16 June 2012 (diff | hist) . . (0)‎ . . N File:A328T.gif ‎ (current)
• 16:55, 16 June 2012 (diff | hist) . . (+17)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎3D-Structure)
• 16:39, 16 June 2012 (diff | hist) . . (0)‎ . . N File:T310R.gif ‎ (current)
• 16:36, 16 June 2012 (diff | hist) . . (+28)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎3D-Structure)
• 16:15, 16 June 2012 (diff | hist) . . (+1)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎3D-Structure)
• 16:13, 16 June 2012 (diff | hist) . . (+81)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎3D-Structure)
• 16:11, 16 June 2012 (diff | hist) . . (+242)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎3D-Structure)
• 16:06, 16 June 2012 (diff | hist) . . (0)‎ . . N File:C258Y.gif ‎ (current)
• 16:01, 16 June 2012 (diff | hist) . . (+28)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎3D-Structure)
• 15:47, 16 June 2012 (diff | hist) . . (-29)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎3D-Structure)
• 15:46, 16 June 2012 (diff | hist) . . (0)‎ . . N File:I213T.gif ‎ (current)
• 15:45, 16 June 2012 (diff | hist) . . (-19)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎3D-Structure)
• 15:45, 16 June 2012 (diff | hist) . . (+27)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎3D-Structure)
• 15:31, 16 June 2012 (diff | hist) . . (0)‎ . . N File:Q125E.gif ‎ (current)
• 15:31, 16 June 2012 (diff | hist) . . (+19)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎3D-Structure)
• 15:00, 16 June 2012 (diff | hist) . . (+5)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎3D-Structure)
• 14:59, 16 June 2012 (diff | hist) . . (0)‎ . . N File:M82I.gif ‎
• 14:58, 16 June 2012 (diff | hist) . . (+223)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎3D-Structure)
• 13:42, 16 June 2012 (diff | hist) . . (0)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎task description)
• 13:42, 16 June 2012 (diff | hist) . . (+6)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Comparison)
• 13:41, 16 June 2012 (diff | hist) . . (-8)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Polyphen2)
• 13:41, 16 June 2012 (diff | hist) . . (+1)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Tools)
• 13:36, 16 June 2012 (diff | hist) . . (+163)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Comparison)
• 13:30, 16 June 2012 (diff | hist) . . (0)‎ . . N File:PolyPhen SIFT SNAP Reprof VennDiagram.png ‎ (current)
• 13:30, 16 June 2012 (diff | hist) . . (+399)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Comparison)
• 13:26, 16 June 2012 (diff | hist) . . (+63)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Comparison)
• 13:18, 16 June 2012 (diff | hist) . . (-1)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Comparison)
• 13:18, 16 June 2012 (diff | hist) . . (+27)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Comparison)
• 13:16, 16 June 2012 (diff | hist) . . (0)‎ . . File:PolyPhen SIFT SNAP VennDiagram.png ‎ (uploaded a new version of "File:PolyPhen SIFT SNAP VennDiagram.png") (current)
• 13:15, 16 June 2012 (diff | hist) . . (+52)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Comparison)
• 13:12, 16 June 2012 (diff | hist) . . (+22)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Comparison)
• 13:11, 16 June 2012 (diff | hist) . . (+85)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Comparison)
• 13:09, 16 June 2012 (diff | hist) . . (+69)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Comparison)
• 13:06, 16 June 2012 (diff | hist) . . (+12)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Comparison)
• 13:06, 16 June 2012 (diff | hist) . . (+64)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Comparison)
• 13:05, 16 June 2012 (diff | hist) . . (+585)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Comparison)
• 12:52, 16 June 2012 (diff | hist) . . (+1)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Comparison)
• 12:52, 16 June 2012 (diff | hist) . . (+133)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Comparison)
• 12:50, 16 June 2012 (diff | hist) . . (0)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎ (→‎Comparison)
• 12:50, 16 June 2012 (diff | hist) . . (0)‎ . . N File:PolyPhen SIFT SNAP VennDiagram.png ‎
• 12:49, 16 June 2012 (diff | hist) . . (+70)‎ . . Task 6: MSUD - Sequence-based mutation analysis ‎
• 18:34, 12 June 2012 (diff | hist) . . (+11)‎ . . Task 5: Researching SNPs ‎ (→‎OMIM)
• 18:34, 12 June 2012 (diff | hist) . . (-846)‎ . . Task 5: Researching SNPs ‎ (→‎OMIM)
• 18:23, 12 June 2012 (diff | hist) . . (+4,994)‎ . . Task 5: Researching SNPs ‎ (→‎OMIM)
• 20:51, 11 June 2012 (diff | hist) . . (+1)‎ . . Talk:Researching And Mapping Point Mutations Hemochromatosis ‎ (current)
• 20:50, 11 June 2012 (diff | hist) . . (+62)‎ . . Talk:Researching And Mapping Point Mutations Hemochromatosis ‎
• 20:49, 11 June 2012 (diff | hist) . . (-6)‎ . . Talk:Researching And Mapping Point Mutations Hemochromatosis ‎
• 20:48, 11 June 2012 (diff | hist) . . (+53)‎ . . Talk:Researching And Mapping Point Mutations Hemochromatosis ‎
• 20:48, 11 June 2012 (diff | hist) . . (+128)‎ . . Talk:Researching And Mapping Point Mutations Hemochromatosis ‎
• 19:22, 11 June 2012 (diff | hist) . . (-228)‎ . . Resource software ‎ (→‎SNAP)
• 17:08, 11 June 2012 (diff | hist) . . (+63)‎ . . Resource software ‎ (→‎SNAP)
• 16:48, 11 June 2012 (diff | hist) . . (+1)‎ . . Resource software ‎ (→‎SNAP)
• 16:48, 11 June 2012 (diff | hist) . . (+2)‎ . . Resource software ‎ (→‎SNAP)
• 16:48, 11 June 2012 (diff | hist) . . (+28)‎ . . Resource software ‎ (→‎SNAP)
• 16:44, 11 June 2012 (diff | hist) . . (+45)‎ . . Build mutation Script ‎ (current)
• 16:43, 11 June 2012 (diff | hist) . . (+145)‎ . . Build mutation Script ‎
• 16:42, 11 June 2012 (diff | hist) . . (+1,124)‎ . . N Build mutation Script ‎ (Created page with " #! /usr/bin/env python import sys sequence_fasta = sys.argv[1] mutation_file = sys.argv[2] f = open (sequence_fasta, 'r') sequence = "" sequence = f.read() sequ…")
• 16:41, 11 June 2012 (diff | hist) . . (+38)‎ . . Resource software ‎ (→‎SNAP)
• 16:40, 11 June 2012 (diff | hist) . . (+95)‎ . . Resource software ‎ (→‎SNAP)
• 12:42, 11 June 2012 (diff | hist) . . (0)‎ . . Task 5: Researching SNPs ‎ (→‎mutationmap)
• 12:38, 11 June 2012 (diff | hist) . . (+94)‎ . . Talk:Task 5: Researching SNPs ‎ (→‎Still missing) (current)
• 12:37, 11 June 2012 (diff | hist) . . (+50)‎ . . Task 5: Researching SNPs ‎ (→‎mutationmap)
• 12:35, 11 June 2012 (diff | hist) . . (+1)‎ . . Task 5: Researching SNPs ‎ (→‎mutationmap)
• 12:34, 11 June 2012 (diff | hist) . . (+145)‎ . . Task 5: Researching SNPs ‎ (→‎mutationmap)
• 12:29, 11 June 2012 (diff | hist) . . (0)‎ . . N File:1dtw py2.png ‎ (current)
• 12:29, 11 June 2012 (diff | hist) . . (+3)‎ . . Task 5: Researching SNPs ‎ (→‎mutationmap)
• 12:27, 11 June 2012 (diff | hist) . . (0)‎ . . N File:1dtw py1.png ‎ (current)
• 12:27, 11 June 2012 (diff | hist) . . (+668)‎ . . Task 5: Researching SNPs ‎ (→‎mutationmap)
• 10:58, 11 June 2012 (diff | hist) . . (+365)‎ . . Task 5: Researching SNPs ‎ (→‎SNPedia)
• 10:54, 11 June 2012 (diff | hist) . . (+73)‎ . . Task 5: Researching SNPs ‎ (→‎dbSNP)
• 10:53, 11 June 2012 (diff | hist) . . (0)‎ . . N File:Insertion.jpg ‎ (current)
• 10:53, 11 June 2012 (diff | hist) . . (+24)‎ . . Task 5: Researching SNPs ‎ (→‎dbSNP)
• 10:52, 11 June 2012 (diff | hist) . . (+518)‎ . . Task 5: Researching SNPs ‎ (→‎dbSNP)
• 10:38, 11 June 2012 (diff | hist) . . (+6)‎ . . Talk:Task 5: Researching SNPs ‎
• 10:38, 11 June 2012 (diff | hist) . . (+190)‎ . . Talk:Task 5: Researching SNPs ‎
• 10:36, 11 June 2012 (diff | hist) . . (+24)‎ . . Task 5: Researching SNPs ‎ (→‎dbSNP)
• 10:36, 11 June 2012 (diff | hist) . . (+122)‎ . . Task 5: Researching SNPs ‎ (→‎dbSNP)
• 15:14, 9 June 2012 (diff | hist) . . (+6)‎ . . Task 6 - Sequence-based mutation analysis ‎ (→‎References)
• 15:13, 9 June 2012 (diff | hist) . . (0)‎ . . N File:PolyPhen2 paper.pdf ‎ (current)
• 15:13, 9 June 2012 (diff | hist) . . (0)‎ . . N File:SIFT paper.pdf ‎ (current)
• 15:11, 9 June 2012 (diff | hist) . . (+18)‎ . . Task 6 - Sequence-based mutation analysis ‎ (→‎References)
• 15:10, 9 June 2012 (diff | hist) . . (+59)‎ . . Task 6 - Sequence-based mutation analysis ‎ (→‎References)
• 18:55, 6 June 2012 (diff | hist) . . (+2,487)‎ . . Task 5: Researching SNPs ‎ (→‎dbSNP)
• 18:11, 6 June 2012 (diff | hist) . . (+7)‎ . . Task 5: Researching SNPs ‎ (→‎mutationmap)
• 18:09, 6 June 2012 (diff | hist) . . (+250)‎ . . Task 5: Researching SNPs ‎ (→‎mutationmap)
• 18:02, 6 June 2012 (diff | hist) . . (0)‎ . . File:Test2.png ‎ (uploaded a new version of "File:Test2.png") (current)
• 18:01, 6 June 2012 (diff | hist) . . (0)‎ . . N File:Test2.png ‎
• 18:00, 6 June 2012 (diff | hist) . . (+21)‎ . . Task 5: Researching SNPs ‎ (→‎mutationmap)
• 11:51, 6 June 2012 (diff | hist) . . (+364)‎ . . Protocol-msud-task5 protocol ‎
• 11:44, 6 June 2012 (diff | hist) . . (+13)‎ . . Protocol-msud-task5 protocol ‎
• 11:36, 6 June 2012 (diff | hist) . . (-252)‎ . . Protocol-msud-task5 protocol ‎ (→‎dbSNP)
• 11:34, 6 June 2012 (diff | hist) . . (-1)‎ . . Protocol-msud-task5 protocol ‎ (→‎dbSNP)
• 11:32, 6 June 2012 (diff | hist) . . (+4,776)‎ . . Protocol-msud-task5 protocol ‎ (→‎dbSNP)
• 11:32, 6 June 2012 (diff | hist) . . (+11)‎ . . Protocol-msud-task5 protocol ‎
• 07:32, 5 June 2012 (diff | hist) . . (+80)‎ . . Talk:Canavan Task 4 - Homology based structure predictions ‎ (current)
• 07:29, 5 June 2012 (diff | hist) . . (+448)‎ . . N Talk:Canavan Task 4 - Homology based structure predictions ‎ (Created page with "I really liked your page. The texts are well structured. The information was easy to read and understand. The pictures look nice :) Not much else to say, we have the same time pr…")
• 19:27, 4 June 2012 (diff | hist) . . (+2)‎ . . Task 4: Homology-based structure prediction ‎ (→‎1qs0)
• 19:25, 4 June 2012 (diff | hist) . . (+203)‎ . . Task 4: Homology-based structure prediction ‎ (→‎Modeler)
• 19:21, 4 June 2012 (diff | hist) . . (+210)‎ . . Task 4: Homology-based structure prediction ‎ (→‎Modeler)
• 20:40, 3 June 2012 (diff | hist) . . (+224)‎ . . Task 4: Homology-based structure prediction ‎ (→‎Model Creation and Evaluation)
• 20:30, 3 June 2012 (diff | hist) . . (-24)‎ . . Task 4: Homology-based structure prediction ‎
• 20:29, 3 June 2012 (diff | hist) . . (+15)‎ . . Task 4: Homology-based structure prediction ‎ (→‎Model Creation)
• 20:29, 3 June 2012 (diff | hist) . . (+166)‎ . . Task 4: Homology-based structure prediction ‎ (→‎Modeler)
• 16:53, 3 June 2012 (diff | hist) . . (+166)‎ . . Task 4 Protocol ‎ (→‎Datasets) (current)
• 16:30, 3 June 2012 (diff | hist) . . (0)‎ . . Task 4: Homology-based structure prediction ‎ (→‎1qs0_A)
• 16:01, 3 June 2012 (diff | hist) . . (+29)‎ . . Task 4: Homology-based structure prediction ‎ (→‎HHpred)
• 15:38, 3 June 2012 (diff | hist) . . (+50)‎ . . Task 4 Protocol ‎ (→‎Datasets)
• 15:37, 3 June 2012 (diff | hist) . . (+1)‎ . . Task 4 Protocol ‎ (→‎Datasets)
• 15:37, 3 June 2012 (diff | hist) . . (+241)‎ . . Task 4 Protocol ‎ (→‎Datasets)
• 15:30, 3 June 2012 (diff | hist) . . (+18)‎ . . Reference Sequence (pdb) ‎ (current)
• 15:29, 3 June 2012 (diff | hist) . . (+433)‎ . . N Reference Sequence (pdb) ‎ (Created page with ">1DTW:A|PDBID|CHAIN|SEQUENCE SSLDDKPQFPGASAEFIDKLEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQ GRISFYMTNYGEEGTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPV…")
• 15:29, 3 June 2012 (diff | hist) . . (+1)‎ . . Maple Syrup Urine Disease 2012 ‎ (→‎Reference sequence)
• 15:29, 3 June 2012 (diff | hist) . . (+30)‎ . . Maple Syrup Urine Disease 2012 ‎ (→‎Reference sequence)
• 14:21, 3 June 2012 (diff | hist) . . (-1)‎ . . Task 4: Homology-based structure prediction ‎ (→‎1qs0_A)
• 14:20, 3 June 2012 (diff | hist) . . (0)‎ . . N File:39 gromos.png ‎ (current)
• 14:20, 3 June 2012 (diff | hist) . . (+325)‎ . . Task 4: Homology-based structure prediction ‎ (→‎1qs0_A)
• 18:35, 2 June 2012 (diff | hist) . . (+134)‎ . . Task 4: Homology-based structure prediction ‎ (→‎Model Creation)
• 16:47, 1 June 2012 (diff | hist) . . (+251)‎ . . Task 4: Homology-based structure prediction ‎ (→‎1qs0_A)
• 16:28, 1 June 2012 (diff | hist) . . (+8)‎ . . Task 4: Homology-based structure prediction ‎ (→‎1qs0_A)
• 16:28, 1 June 2012 (diff | hist) . . (+273)‎ . . Task 4: Homology-based structure prediction ‎ (→‎1qs0_A)
• 16:21, 1 June 2012 (diff | hist) . . (+144)‎ . . Task 4: Homology-based structure prediction ‎ (→‎1qs0_A)
• 16:19, 1 June 2012 (diff | hist) . . (+24)‎ . . Task 4: Homology-based structure prediction ‎
• 16:17, 1 June 2012 (diff | hist) . . (+5)‎ . . Task 4: Homology-based structure prediction ‎ (→‎1qs0_A)
• 16:16, 1 June 2012 (diff | hist) . . (0)‎ . . Task 4: Homology-based structure prediction ‎ (→‎1qs0_A)
• 16:15, 1 June 2012 (diff | hist) . . (+66)‎ . . Task 4: Homology-based structure prediction ‎ (→‎Swiss-Model)
• 16:11, 1 June 2012 (diff | hist) . . (+2)‎ . . Task 4: Homology-based structure prediction ‎ (→‎1qs0_A)
• 16:10, 1 June 2012 (diff | hist) . . (+60)‎ . . Task 4: Homology-based structure prediction ‎ (→‎Swiss-Model)
• 16:09, 1 June 2012 (diff | hist) . . (0)‎ . . Task 4: Homology-based structure prediction ‎ (→‎Swiss-Model)
• 16:08, 1 June 2012 (diff | hist) . . (0)‎ . . N File:39 anolea.png ‎ (current)
• 16:07, 1 June 2012 (diff | hist) . . (+2)‎ . . Task 4: Homology-based structure prediction ‎ (→‎Swiss-Model)
• 16:04, 1 June 2012 (diff | hist) . . (+21)‎ . . Task 4: Homology-based structure prediction ‎ (→‎Swiss-Model)
• 16:39, 30 May 2012 (diff | hist) . . (+173)‎ . . Task 4: Homology-based structure prediction ‎ (→‎Swiss-Model)
• 16:08, 30 May 2012 (diff | hist) . . (+56)‎ . . Task 4: Homology-based structure prediction ‎ (→‎Model Creation)
• 16:07, 30 May 2012 (diff | hist) . . (+23)‎ . . Task 4: Homology-based structure prediction ‎
• 15:12, 30 May 2012 (diff | hist) . . (+100)‎ . . Task 4: Homology-based structure prediction ‎ (→‎COMA)
• 15:10, 30 May 2012 (diff | hist) . . (+373)‎ . . Task 4: Homology-based structure prediction ‎ (→‎HHpred)
• 14:53, 30 May 2012 (diff | hist) . . (+10)‎ . . Task 4: Homology-based structure prediction ‎ (→‎HHpred)
• 14:52, 30 May 2012 (diff | hist) . . (+345)‎ . . Task 4: Homology-based structure prediction ‎ (→‎HHpred)
• 14:42, 30 May 2012 (diff | hist) . . (+11)‎ . . Task 4: Homology-based structure prediction ‎ (→‎COMA)
• 14:42, 30 May 2012 (diff | hist) . . (+143)‎ . . Task 4: Homology-based structure prediction ‎ (→‎COMA)
• 14:39, 30 May 2012 (diff | hist) . . (0)‎ . . Task 4 Protocol ‎ (→‎Datasets)
• 14:39, 30 May 2012 (diff | hist) . . (-147)‎ . . Task 4: Homology-based structure prediction ‎ (→‎COMA)
• 14:38, 30 May 2012 (diff | hist) . . (-27)‎ . . Task 4: Homology-based structure prediction ‎ (→‎HHpred)
• 14:37, 30 May 2012 (diff | hist) . . (+25)‎ . . Task 4: Homology-based structure prediction ‎ (→‎HHpred)
• 14:26, 30 May 2012 (diff | hist) . . (+325)‎ . . Task 4: Homology-based structure prediction ‎ (→‎HHpred)
• 14:11, 30 May 2012 (diff | hist) . . (-71)‎ . . Task 4: Homology-based structure prediction ‎ (→‎HHpred)
• 14:09, 30 May 2012 (diff | hist) . . (+70)‎ . . Task 4 Protocol ‎ (→‎Datasets)
• 14:05, 30 May 2012 (diff | hist) . . (-344)‎ . . Task 4: Homology-based structure prediction ‎ (→‎COMA)
• 14:04, 30 May 2012 (diff | hist) . . (+464)‎ . . Task 4: Homology-based structure prediction ‎ (→‎COMA)
• 13:54, 30 May 2012 (diff | hist) . . (+473)‎ . . Task 4: Homology-based structure prediction ‎ (→‎COMA)
• 13:44, 30 May 2012 (diff | hist) . . (-2)‎ . . Task 4 Protocol ‎ (→‎Datasets)
• 13:37, 30 May 2012 (diff | hist) . . (+168)‎ . . Task 4: Homology-based structure prediction ‎ (→‎HHpred)
• 13:27, 30 May 2012 (diff | hist) . . (-64)‎ . . Task 4: Homology-based structure prediction ‎ (→‎HHpred)
• 13:26, 30 May 2012 (diff | hist) . . (+219)‎ . . Task 4: Homology-based structure prediction ‎ (→‎HHpred)
• 13:19, 30 May 2012 (diff | hist) . . (-6)‎ . . Task 4: Homology-based structure prediction ‎ (→‎HHpred)
• 13:10, 30 May 2012 (diff | hist) . . (-263)‎ . . Task 4: Homology-based structure prediction ‎ (→‎HHpred)
• 12:57, 30 May 2012 (diff | hist) . . (+545)‎ . . Task 4: Homology-based structure prediction ‎ (→‎HHpred)
• 12:56, 30 May 2012 (diff | hist) . . (+2)‎ . . Task 4: Homology-based structure prediction ‎ (→‎HHpred)
• 12:56, 30 May 2012 (diff | hist) . . (+23)‎ . . Task 4: Homology-based structure prediction ‎ (→‎HHpred)
• 12:47, 30 May 2012 (diff | hist) . . (+10)‎ . . Task 4 Protocol ‎ (→‎Datasets)
• 12:46, 30 May 2012 (diff | hist) . . (+2)‎ . . Task 4 Protocol ‎ (→‎Datasets)
• 12:46, 30 May 2012 (diff | hist) . . (+432)‎ . . N Task 4 Protocol ‎ (Created page with "== Datasets == In order to generate the datasets to build the models from we used both the HHpred and COMA webserver. Both tools were applied with default settings. As input sequ…")
• 12:42, 30 May 2012 (diff | hist) . . (+242)‎ . . Task 4: Homology-based structure prediction ‎
• 12:39, 30 May 2012 (diff | hist) . . (+103)‎ . . Task 4: Homology-based structure prediction ‎
• 12:37, 30 May 2012 (diff | hist) . . (+20)‎ . . Task 4: Homology-based structure prediction ‎ (→‎Datasets)
• 12:16, 30 May 2012 (diff | hist) . . (+28)‎ . . N Task 4: Homology-based structure prediction ‎ (Created page with "==Datasets== ===Coma=== blah")
• 12:15, 30 May 2012 (diff | hist) . . (+49)‎ . . Maple Syrup Urine Disease 2012 ‎ (→‎Tasks)
• 07:06, 22 May 2012 (diff | hist) . . (+174)‎ . . Talk:Sequence-based predictions TSD ‎
• 06:53, 22 May 2012 (diff | hist) . . (+199)‎ . . Talk:Sequence-based predictions TSD ‎
• 06:49, 22 May 2012 (diff | hist) . . (+247)‎ . . N Talk:Sequence-based predictions TSD ‎ (Created page with "Hi, just ckecking out your page. In "DSSP and handling of differing sequences" your refer to "both these tools" to me it looks like you only refer to SIFTS, so i dont quite under…")
• 23:36, 21 May 2012 (diff | hist) . . (+224)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎GO terms)
• 20:38, 21 May 2012 (diff | hist) . . (+2)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎GO terms)
• 20:38, 21 May 2012 (diff | hist) . . (+879)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎GO terms)
• 19:57, 21 May 2012 (diff | hist) . . (+491)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Signal peptides)
• 19:30, 21 May 2012 (diff | hist) . . (+214)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎GO terms)
• 15:10, 18 May 2012 (diff | hist) . . (+880)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Signal peptides)
• 14:49, 18 May 2012 (diff | hist) . . (+473)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Signal peptides)
• 14:27, 18 May 2012 (diff | hist) . . (-1)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Signal peptides)
• 14:26, 18 May 2012 (diff | hist) . . (+20)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Signal peptides)
• 14:21, 18 May 2012 (diff | hist) . . (+23)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Signal peptides)
• 14:13, 18 May 2012 (diff | hist) . . (-193)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Signal peptides)
• 14:10, 18 May 2012 (diff | hist) . . (+414)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Signal peptides)
• 13:45, 18 May 2012 (diff | hist) . . (+540)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Signal peptides)
• 22:37, 15 May 2012 (diff | hist) . . (+637)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Transmembrane helices)
• 22:00, 15 May 2012 (diff | hist) . . (-163)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Transmembrane helices)
• 21:59, 15 May 2012 (diff | hist) . . (+67)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Transmembrane helices)
• 21:59, 15 May 2012 (diff | hist) . . (+984)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Transmembrane helices)
• 21:32, 15 May 2012 (diff | hist) . . (+47)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Transmembrane helices)
• 21:28, 15 May 2012 (diff | hist) . . (+111)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Transmembrane helices)
• 21:23, 15 May 2012 (diff | hist) . . (0)‎ . . N File:2d57.png ‎ (current)
• 21:23, 15 May 2012 (diff | hist) . . (+738)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Transmembrane helices)
• 21:17, 15 May 2012 (diff | hist) . . (+13)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Transmembrane helices)
• 20:46, 15 May 2012 (diff | hist) . . (+479)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Transmembrane helices)
• 20:31, 15 May 2012 (diff | hist) . . (+20)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Transmembrane helices)
• 20:28, 15 May 2012 (diff | hist) . . (+18)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Transmembrane helices)
• 20:25, 15 May 2012 (diff | hist) . . (+40)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Transmembrane helices)
• 20:18, 15 May 2012 (diff | hist) . . (+528)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Transmembrane helices)
• 20:04, 15 May 2012 (diff | hist) . . (0)‎ . . N File:1orq.png ‎ (current)
• 20:04, 15 May 2012 (diff | hist) . . (+85)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Transmembrane helices)
• 20:02, 15 May 2012 (diff | hist) . . (+63)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Transmembrane helices)
• 20:01, 15 May 2012 (diff | hist) . . (0)‎ . . N File:3pbl.png ‎ (current)
• 20:00, 15 May 2012 (diff | hist) . . (-45)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Transmembrane helices)
• 19:59, 15 May 2012 (diff | hist) . . (+42)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Transmembrane helices)
• 19:57, 15 May 2012 (diff | hist) . . (+54)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Transmembrane helices)
• 19:11, 14 May 2012 (diff | hist) . . (+164)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Transmembrane helices)
• 19:08, 14 May 2012 (diff | hist) . . (+45)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Transmembrane helices)
• 18:59, 14 May 2012 (diff | hist) . . (+361)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Transmembrane helices)
• 18:01, 14 May 2012 (diff | hist) . . (+211)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Transmembrane helices)
• 17:49, 14 May 2012 (diff | hist) . . (0)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Transmembrane helices)
• 17:49, 14 May 2012 (diff | hist) . . (+1,064)‎ . . Task 3: odba human Sequence-based predictions ‎ (→‎Transmembrane helices)
• 21:35, 7 May 2012 (diff | hist) . . (+261)‎ . . Talk:Sequence Alignments TSD ‎
• 21:17, 7 May 2012 (diff | hist) . . (+569)‎ . . Talk:Sequence Alignments TSD ‎
• 20:54, 7 May 2012 (diff | hist) . . (+162)‎ . . Talk:Sequence Alignments TSD ‎
• 22:53, 6 May 2012 (diff | hist) . . (+283)‎ . . N Talk:Sequence Alignments TSD ‎ (Created page with "Hi, I just started reading your Sequence Alignments page. First thing I like: You didn't litter the page with your shell commands and used an extra protocol page for that. This i…")
• 22:31, 6 May 2012 (diff | hist) . . (+2)‎ . . Task 2: Multiple Sequence Alignment ‎
• 22:31, 6 May 2012 (diff | hist) . . (+89)‎ . . Task 2: Multiple Sequence Alignment ‎
• 22:11, 6 May 2012 (diff | hist) . . (+64)‎ . . Task 2: Multiple Sequence Alignment ‎ (→‎Blast)
• 22:08, 6 May 2012 (diff | hist) . . (+65)‎ . . Task 2: Multiple Sequence Alignment ‎ (→‎Blast)
• 20:52, 6 May 2012 (diff | hist) . . (+1)‎ . . Task 2: Multiple Sequence Alignment ‎ (→‎Blast)
• 20:50, 6 May 2012 (diff | hist) . . (+90)‎ . . Task 2: Multiple Sequence Alignment ‎ (→‎Blast)
• 20:49, 6 May 2012 (diff | hist) . . (-90)‎ . . File:Blast SeqSim.png ‎ (Blanked the page) (current)
• 20:48, 6 May 2012 (diff | hist) . . (+90)‎ . . File:Blast SeqSim.png ‎
• 20:47, 6 May 2012 (diff | hist) . . (-1)‎ . . Task 2: Multiple Sequence Alignment ‎ (→‎Blast)
• 20:46, 6 May 2012 (diff | hist) . . (+12)‎ . . Task 2: Multiple Sequence Alignment ‎
• 20:45, 6 May 2012 (diff | hist) . . (+11)‎ . . Task 2: Multiple Sequence Alignment ‎
• 20:42, 6 May 2012 (diff | hist) . . (0)‎ . . N File:Blast SeqSim.png ‎
• 20:39, 6 May 2012 (diff | hist) . . (+301)‎ . . Task 2: Multiple Sequence Alignment ‎
• 20:10, 6 May 2012 (diff | hist) . . (+169)‎ . . Task 2: Multiple Sequence Alignment ‎
• 20:05, 6 May 2012 (diff | hist) . . (+744)‎ . . N Task 2: Multiple Sequence Alignment ‎ (Created page with "We researched the protein sequence of the branched-chain alpha-keto acid dehydrogenase complex subunit alpha (BCKDHA) with the following original sequence: * BCKDHA >sp|P12694|O…")
• 19:58, 6 May 2012 (diff | hist) . . (+36)‎ . . Maple Syrup Urine Disease 2012 ‎ (→‎Tasks)
• 19:57, 6 May 2012 (diff | hist) . . (+20)‎ . . Maple Syrup Urine Disease 2012 ‎
• 22:44, 23 April 2012 (diff | hist) . . (+647)‎ . . Talk:Fabry Disease 2012 ‎
• 19:16, 23 April 2012 (diff | hist) . . (+643)‎ . . Maple Syrup Urine Disease 2012 ‎
• 18:57, 23 April 2012 (diff | hist) . . (+1)‎ . . Maple Syrup Urine Disease 2012 ‎
• 18:56, 23 April 2012 (diff | hist) . . (+1)‎ . . Maple Syrup Urine Disease 2012 ‎ (→‎Summary)
• 18:55, 23 April 2012 (diff | hist) . . (0)‎ . . Maple Syrup Urine Disease 2012 ‎ (→‎Summary)
• 18:55, 23 April 2012 (diff | hist) . . (0)‎ . . Maple Syrup Urine Disease 2012 ‎
• 21:01, 22 April 2012 (diff | hist) . . (+915)‎ . . Maple Syrup Urine Disease 2012 ‎ (→‎Phenotype)
• 16:41, 22 April 2012 (diff | hist) . . (+47)‎ . . Maple Syrup Urine Disease 2012 ‎ (→‎Phenotype)
• 16:38, 22 April 2012 (diff | hist) . . (-113)‎ . . Maple Syrup Urine Disease 2012 ‎ (→‎References)
• 16:37, 22 April 2012 (diff | hist) . . (+103)‎ . . Maple Syrup Urine Disease 2012 ‎ (→‎Summary)
• 16:33, 22 April 2012 (diff | hist) . . (+170)‎ . . Maple Syrup Urine Disease 2012 ‎
• 16:30, 22 April 2012 (diff | hist) . . (-240)‎ . . Template:Column-width ‎ (Blanked the page) (current)
• 16:30, 22 April 2012 (diff | hist) . . (-778)‎ . . Template:Reflist ‎ (Blanked the page) (current)
• 16:29, 22 April 2012 (diff | hist) . . (-240)‎ . . Template:Column-count ‎ (Blanked the page) (current)
• 16:28, 22 April 2012 (diff | hist) . . (+240)‎ . . N Template:Column-width ‎ (Created page with "<includeonly>-moz-column-width: {{{1|30em}}}; -webkit-column-width: {{{1|30em}}}; column-width: {{{1|30em}}};</includeonly><noinclude> <!-- ADD CATEGORIES AND INTERWIKIS TO THE …")
• 16:28, 22 April 2012 (diff | hist) . . (+240)‎ . . N Template:Column-count ‎ (Created page with "<includeonly>-moz-column-width: {{{1|30em}}}; -webkit-column-width: {{{1|30em}}}; column-width: {{{1|30em}}};</includeonly><noinclude> <!-- ADD CATEGORIES AND INTERWIKIS TO THE …")
• 16:23, 22 April 2012 (diff | hist) . . (+778)‎ . . N Template:Reflist ‎ (Created page with "<div class="reflist <!-- -->{{#if: {{{1|}}} | {{#iferror: {{#ifexpr: {{{1|1}}} > 1 }} | references-column-width | references-column-count references-column-coun…")
• 16:03, 22 April 2012 (diff | hist) . . (+516)‎ . . Maple Syrup Urine Disease 2012 ‎ (→‎Phenotype)