User contributions
From Bioinformatikpedia
(newest | oldest) View (newer 50 | older 50) (20 | 50 | 100 | 250 | 500)
- 09:29, 24 August 2012 (diff | hist) . . (+1,914) . . Canavan Task 2 - Sequence alignments (→PSIBLAST)
- 09:10, 24 August 2012 (diff | hist) . . (+1) . . Canavan Task 2 - Sequence alignments (→PSIBLAST)
- 09:09, 24 August 2012 (diff | hist) . . (-860) . . Canavan Task 2 - Sequence alignments (→PSIBLAST)
- 09:08, 24 August 2012 (diff | hist) . . (-8) . . CD task2 protocol (→PsiBlast)
- 09:08, 24 August 2012 (diff | hist) . . (+23) . . CD task2 protocol (→PsiBlast)
- 09:07, 24 August 2012 (diff | hist) . . (+925) . . CD task2 protocol
- 09:06, 24 August 2012 (diff | hist) . . (+1) . . Canavan Task 2 - Sequence alignments (→BLASTP)
- 09:05, 24 August 2012 (diff | hist) . . (+137) . . Canavan Task 2 - Sequence alignments (→BLASTP)
- 09:00, 24 August 2012 (diff | hist) . . (-21) . . Canavan Task 2 - Sequence alignments (→BLASTP)
- 08:59, 24 August 2012 (diff | hist) . . (+59) . . Canavan Task 2 - Sequence alignments (→BLASTP)
- 08:57, 24 August 2012 (diff | hist) . . (+158) . . Canavan Task 2 - Sequence alignments (→BLASTP)
- 08:53, 24 August 2012 (diff | hist) . . (+512) . . Canavan Task 2 - Sequence alignments
- 08:47, 24 August 2012 (diff | hist) . . (+237) . . CD task2 protocol
- 08:45, 24 August 2012 (diff | hist) . . (-847) . . Canavan Task 2 - Sequence alignments
- 08:44, 24 August 2012 (diff | hist) . . (+464) . . N CD task2 protocol (Created page with "=Sequence= The native ASPA sequence (UniProt: P45381): >hsa:443 ASPA, ACY2, ASP; aspartoacylase; K01437 aspartoacylase [EC:3.5.1.15] (A) MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLEN…")
- 08:42, 24 August 2012 (diff | hist) . . (+86) . . Canavan Task 2 - Sequence alignments
- 08:36, 24 August 2012 (diff | hist) . . (-14) . . Canavan Disease 2012 (→Effect of Loss of function)
- 08:36, 24 August 2012 (diff | hist) . . (+24) . . Canavan Disease 2012 (→Pathological Mutations)
- 08:35, 24 August 2012 (diff | hist) . . (+4) . . Canavan Task 4 - Homology based structure predictions (→Analysis of the Aspartoacylase structures)
- 08:35, 24 August 2012 (diff | hist) . . (+29) . . Canavan Disease 2012 (→Protein)
- 08:28, 24 August 2012 (diff | hist) . . (+13) . . Canavan Disease 2012 (→Effect of Loss of function)
- 08:26, 24 August 2012 (diff | hist) . . (0) . . Canavan Disease 2012 (→Effect of Loss of function)
- 08:25, 24 August 2012 (diff | hist) . . (+30) . . Canavan Disease 2012 (→Effect of Loss of function)
- 08:23, 24 August 2012 (diff | hist) . . (+1) . . Canavan Disease 2012 (→= Active Site)
- 16:32, 22 August 2012 (diff | hist) . . (+2) . . Canavan Disease 2012 (→Protein)
- 16:31, 22 August 2012 (diff | hist) . . (+101) . . Canavan Task 4 - Homology based structure predictions (→Comparison of Aspartoacylase Structures)
- 16:29, 22 August 2012 (diff | hist) . . (+144) . . Canavan Disease 2012 (→Protein)
- 16:26, 22 August 2012 (diff | hist) . . (+17) . . Canavan Task 4 - Homology based structure predictions (→Analysis of the Aspartoacylase structures)
- 16:26, 22 August 2012 (diff | hist) . . (-2,703) . . Canavan Task 4 - Homology based structure predictions (→Analysis of the Aspartoacylase structures)
- 16:25, 22 August 2012 (diff | hist) . . (+2,201) . . Canavan Disease 2012 (→Protein)
- 16:21, 22 August 2012 (diff | hist) . . (+600) . . Canavan Disease 2012 (→Protein)
- 16:16, 22 August 2012 (diff | hist) . . (+3) . . Canavan Disease 2012 (→Biochemical disease mechanism)
- 16:16, 22 August 2012 (diff | hist) . . (+419) . . Canavan Disease 2012
- 16:14, 22 August 2012 (diff | hist) . . (-527) . . Canavan Disease 2012 (→Protein)
- 16:12, 22 August 2012 (diff | hist) . . (-7) . . Canavan Disease 2012 (→Effect of mutations)
- 16:11, 22 August 2012 (diff | hist) . . (+1) . . Canavan Disease 2012 (→Pathological Muations)
- 16:02, 22 August 2012 (diff | hist) . . (+103) . . Ala305glu (current)
- 16:00, 22 August 2012 (diff | hist) . . (+200) . . N Tyr231X (Created page with "* 693C-A nonsense mutation in exon 5 of the ASPA gene * [http://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?rs=rs12948217 dbSNP:rs12948217] * validated by 1000 Genomes and also cluster…") (current)
- 15:58, 22 August 2012 (diff | hist) . . (-2) . . Canavan Disease 2012 (→Pathological Muations)
- 15:57, 22 August 2012 (diff | hist) . . (-1) . . Ala305glu
- 15:56, 22 August 2012 (diff | hist) . . (+157) . . Ala305glu
- 15:53, 22 August 2012 (diff | hist) . . (+206) . . Glu285ala (current)
- 15:42, 22 August 2012 (diff | hist) . . (+378) . . Ala305glu
- 15:35, 22 August 2012 (diff | hist) . . (+85) . . N Ala305glu (Created page with " http://decrypthon.igbmc.fr/msv3d/cgi-bin/mutant?protein=P45381&mutation=p.Ala305Glu")
- 15:34, 22 August 2012 (diff | hist) . . (+16) . . Canavan Disease 2012 (→Pathological Muations)
- 15:28, 22 August 2012 (diff | hist) . . (-31) . . Canavan Disease 2012 (→Mutations)
- 17:36, 21 August 2012 (diff | hist) . . (+103) . . Canavan Disease 2012 (→Gene Therapy)
- 17:36, 21 August 2012 (diff | hist) . . (+24) . . Canavan Disease 2012 (→References)
- 17:35, 21 August 2012 (diff | hist) . . (+314) . . Canavan Disease 2012 (→References)
- 17:29, 21 August 2012 (diff | hist) . . (+1) . . Canavan Disease 2012 (→Treatment)