User contributions
From Bioinformatikpedia
(newest | oldest) View (newer 250 | older 250) (20 | 50 | 100 | 250 | 500)
- 19:56, 13 June 2011 (diff | hist) . . (+317) . . Homology-modelling HEXA (→iTasser)
- 19:51, 13 June 2011 (diff | hist) . . (+256) . . Homology-modelling HEXA (→iTasser)
- 19:47, 13 June 2011 (diff | hist) . . (0) . . N File:3lut acc.png
- 19:46, 13 June 2011 (diff | hist) . . (0) . . N File:3cui acc.png (current)
- 19:46, 13 June 2011 (diff | hist) . . (0) . . N File:3bc9 acc.png
- 19:46, 13 June 2011 (diff | hist) . . (+479) . . Homology-modelling HEXA (→iTasser)
- 19:32, 13 June 2011 (diff | hist) . . (0) . . N File:3lut binding.png
- 19:32, 13 June 2011 (diff | hist) . . (0) . . N File:3cui binding.png (current)
- 19:31, 13 June 2011 (diff | hist) . . (0) . . Homology-modelling HEXA (→iTasser)
- 19:31, 13 June 2011 (diff | hist) . . (0) . . N File:3bc9 binding.png
- 19:30, 13 June 2011 (diff | hist) . . (+439) . . Homology-modelling HEXA (→iTasser)
- 19:22, 13 June 2011 (diff | hist) . . (+149) . . Homology-modelling HEXA (→iTasser)
- 19:21, 13 June 2011 (diff | hist) . . (0) . . File:3lut sec.png (uploaded a new version of "File:3lut sec.png")
- 19:20, 13 June 2011 (diff | hist) . . (0) . . File:3lut sec.png (uploaded a new version of "File:3lut sec.png")
- 19:17, 13 June 2011 (diff | hist) . . (0) . . N File:3lut sec.png
- 19:16, 13 June 2011 (diff | hist) . . (-1) . . Homology-modelling HEXA (→iTasser)
- 19:16, 13 June 2011 (diff | hist) . . (0) . . File:3bc9 sec.png (uploaded a new version of "File:3bc9 sec.png")
- 19:15, 13 June 2011 (diff | hist) . . (+84) . . Homology-modelling HEXA (→iTasser)
- 19:04, 13 June 2011 (diff | hist) . . (+72) . . Homology-modelling HEXA (→iTasser)
- 19:03, 13 June 2011 (diff | hist) . . (0) . . N File:3cui sec.png (current)
- 19:02, 13 June 2011 (diff | hist) . . (+158) . . Homology-modelling HEXA (→iTasser)
- 18:46, 13 June 2011 (diff | hist) . . (+7) . . Homology-modelling HEXA (→iTasser)
- 18:45, 13 June 2011 (diff | hist) . . (0) . . N File:3bc9 sec.png
- 18:45, 13 June 2011 (diff | hist) . . (+516) . . Homology-modelling HEXA (→iTasser)
- 17:21, 13 June 2011 (diff | hist) . . (0) . . Homology-modelling HEXA (→iTasser)
- 17:20, 13 June 2011 (diff | hist) . . (+292) . . Homology-modelling HEXA (→iTasser)
- 17:18, 13 June 2011 (diff | hist) . . (0) . . N File:Model5 3lut.gif (current)
- 17:18, 13 June 2011 (diff | hist) . . (0) . . N File:Model4 3lut.gif (current)
- 17:18, 13 June 2011 (diff | hist) . . (0) . . File:Model3 3lut.gif (uploaded a new version of "File:Model3 3lut.gif") (current)
- 17:17, 13 June 2011 (diff | hist) . . (0) . . N File:Model3 3lut.gif
- 17:17, 13 June 2011 (diff | hist) . . (0) . . N File:Model2 3lut.gif (current)
- 17:17, 13 June 2011 (diff | hist) . . (0) . . N File:Model1 3lut.gif
- 17:14, 13 June 2011 (diff | hist) . . (0) . . N File:Model5 3cui.gif (current)
- 17:14, 13 June 2011 (diff | hist) . . (0) . . N File:Model4 3cui.gif (current)
- 17:14, 13 June 2011 (diff | hist) . . (0) . . N File:Model3 3cui.gif (current)
- 17:13, 13 June 2011 (diff | hist) . . (0) . . N File:Model2 3cui.gif (current)
- 17:13, 13 June 2011 (diff | hist) . . (0) . . N File:Model1 3cui.gif (current)
- 17:13, 13 June 2011 (diff | hist) . . (0) . . N File:Model5 3bc9.gif (current)
- 17:12, 13 June 2011 (diff | hist) . . (0) . . N File:Model4 3bc9.gif (current)
- 17:12, 13 June 2011 (diff | hist) . . (0) . . N File:Model3 3bc9.gif (current)
- 17:12, 13 June 2011 (diff | hist) . . (0) . . N File:Model2 3bc9.gif (current)
- 17:12, 13 June 2011 (diff | hist) . . (0) . . N File:Model1 3bc9.gif
- 17:11, 13 June 2011 (diff | hist) . . (-268) . . Homology-modelling HEXA (→iTasser)
- 17:10, 13 June 2011 (diff | hist) . . (0) . . N File:Model1.gif (current)
- 17:09, 13 June 2011 (diff | hist) . . (+1,583) . . Homology-modelling HEXA (→iTasser)
- 16:59, 13 June 2011 (diff | hist) . . (+15) . . Homology-modelling HEXA (→iTasser)
- 16:58, 13 June 2011 (diff | hist) . . (+7) . . Homology-modelling HEXA (→iTasser)
- 22:37, 6 June 2011 (diff | hist) . . (+4) . . Sequence-based predictions HEXA (→DSSP)
- 22:34, 6 June 2011 (diff | hist) . . (+620) . . Sequence-based predictions HEXA (→DSSP)
- 22:10, 6 June 2011 (diff | hist) . . (+2) . . Sequence-based predictions HEXA (→DSSP)
- 22:09, 6 June 2011 (diff | hist) . . (+759) . . Sequence-based predictions HEXA (→DSSP)
- 21:27, 6 June 2011 (diff | hist) . . (+48) . . Sequence-based predictions HEXA (→DSSP)
- 21:22, 6 June 2011 (diff | hist) . . (+289) . . Sequence-based predictions HEXA (→DSSP)
- 21:19, 6 June 2011 (diff | hist) . . (+3,281) . . Sequence-based predictions HEXA (→DSSP)
- 21:18, 6 June 2011 (diff | hist) . . (-1) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 21:17, 6 June 2011 (diff | hist) . . (-46) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 19:37, 6 June 2011 (diff | hist) . . (+73) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 17:50, 6 June 2011 (diff | hist) . . (-3) . . Sequence-based predictions HEXA (→Jpred3)
- 17:50, 6 June 2011 (diff | hist) . . (0) . . N File:Jpred pic.png (current)
- 17:49, 6 June 2011 (diff | hist) . . (-923) . . Sequence-based predictions HEXA (→Jpred3)
- 17:10, 6 June 2011 (diff | hist) . . (+107) . . Sequence-based predictions HEXA (→Jpred3)
- 17:04, 6 June 2011 (diff | hist) . . (-118) . . Sequence-based predictions HEXA (→Jpred3)
- 17:04, 6 June 2011 (diff | hist) . . (+1,188) . . Sequence-based predictions HEXA (→Jpred3)
- 16:54, 6 June 2011 (diff | hist) . . (+231) . . Sequence-based predictions HEXA (→PSIPRED)
- 16:49, 6 June 2011 (diff | hist) . . (-2,486) . . Sequence-based predictions HEXA (→PSIPRED)
- 16:49, 6 June 2011 (diff | hist) . . (+2,410) . . Sequence-based predictions HEXA (→PSIPRED)
- 16:47, 6 June 2011 (diff | hist) . . (+76) . . Sequence-based predictions HEXA (→PSIPRED)
- 16:38, 6 June 2011 (diff | hist) . . (+3) . . Sequence-based predictions HEXA (→PSIPRED)
- 16:37, 6 June 2011 (diff | hist) . . (+4) . . Sequence-based predictions HEXA (→PSIPRED)
- 16:37, 6 June 2011 (diff | hist) . . (0) . . N File:Psipred3.png (current)
- 16:36, 6 June 2011 (diff | hist) . . (0) . . N File:Psipred2.png (current)
- 16:35, 6 June 2011 (diff | hist) . . (0) . . N File:Psipred1.png (current)
- 16:35, 6 June 2011 (diff | hist) . . (+234) . . Sequence-based predictions HEXA (→PSIPRED)
- 16:25, 6 June 2011 (diff | hist) . . (-4) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 16:19, 6 June 2011 (diff | hist) . . (+49) . . Sequence-based predictions HEXA (→Secondary Structure prediction)
- 16:17, 6 June 2011 (diff | hist) . . (-5) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 16:16, 6 June 2011 (diff | hist) . . (+131) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 16:12, 6 June 2011 (diff | hist) . . (+348) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 16:04, 6 June 2011 (diff | hist) . . (+438) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 15:50, 6 June 2011 (diff | hist) . . (+29) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 15:49, 6 June 2011 (diff | hist) . . (+484) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 15:45, 6 June 2011 (diff | hist) . . (+18) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 11:50, 6 June 2011 (diff | hist) . . (+167) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 11:47, 6 June 2011 (diff | hist) . . (+170) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 16:46, 5 June 2011 (diff | hist) . . (+436) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 16:40, 5 June 2011 (diff | hist) . . (+313) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 16:32, 5 June 2011 (diff | hist) . . (+429) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 16:27, 5 June 2011 (diff | hist) . . (+367) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 16:19, 5 June 2011 (diff | hist) . . (-1) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 16:19, 5 June 2011 (diff | hist) . . (+211) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 16:12, 5 June 2011 (diff | hist) . . (+26) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 20:51, 23 May 2011 (diff | hist) . . (+9) . . Sequence Alignments HEXA (→Statistic results)
- 20:50, 23 May 2011 (diff | hist) . . (0) . . Sequence Alignments HEXA (→Statistic results)
- 19:07, 23 May 2011 (diff | hist) . . (+1) . . Sequence Alignments HEXA (→Functional residues)
- 19:04, 23 May 2011 (diff | hist) . . (0) . . Sequence Alignments HEXA (→Gaps)
- 19:04, 23 May 2011 (diff | hist) . . (0) . . Sequence Alignments HEXA (→Gaps)
- 19:03, 23 May 2011 (diff | hist) . . (-6) . . Sequence Alignments HEXA (→Gaps)
- 19:03, 23 May 2011 (diff | hist) . . (0) . . N File:Secondary.png (current)
- 19:02, 23 May 2011 (diff | hist) . . (+180) . . Sequence Alignments HEXA (→Gaps)
- 18:18, 23 May 2011 (diff | hist) . . (+334) . . Sequence Alignments HEXA (→Gaps)
- 18:14, 23 May 2011 (diff | hist) . . (+1) . . Sequence Alignments HEXA (→Functional residues)
- 18:10, 23 May 2011 (diff | hist) . . (-40) . . Sequence Alignments HEXA (→Gaps)
- 18:04, 23 May 2011 (diff | hist) . . (+4) . . Sequence Alignments HEXA (→Statistic results)
- 18:00, 23 May 2011 (diff | hist) . . (+13) . . Sequence Alignments HEXA (→Statistic results)
- 17:55, 23 May 2011 (diff | hist) . . (+123) . . Sequence Alignments HEXA (→Statistic results)
- 17:53, 23 May 2011 (diff | hist) . . (+79) . . Sequence Alignments HEXA (→Multiple Alignments)
- 17:51, 23 May 2011 (diff | hist) . . (+1,840) . . Sequence Alignments HEXA (→Statistic results)
- 15:43, 23 May 2011 (diff | hist) . . (-165) . . Sequence Alignments HEXA (→Statistic results)
- 15:42, 23 May 2011 (diff | hist) . . (+702) . . Sequence Alignments HEXA (→Statistic results)
- 14:55, 23 May 2011 (diff | hist) . . (+117) . . Sequence Alignments HEXA (→Statistic results)
- 14:44, 23 May 2011 (diff | hist) . . (+10) . . Sequence Alignments HEXA
- 19:46, 14 May 2011 (diff | hist) . . (+7) . . Tay-Sachs Disease 2011 (→Biochemical disease mechanism)
- 19:45, 14 May 2011 (diff | hist) . . (+95) . . Tay-Sachs Disease 2011 (→Biochemical disease mechanism)
- 19:43, 14 May 2011 (diff | hist) . . (-1) . . Tay-Sachs Disease 2011 (→Biochemical disease mechanism)
- 19:41, 14 May 2011 (diff | hist) . . (-93) . . Tay-Sachs Disease 2011 (→Biochemical disease mechanism)
- 19:32, 14 May 2011 (diff | hist) . . (+463) . . Tay-Sachs Disease 2011 (→Biochemical disease mechanism)
- 19:31, 14 May 2011 (diff | hist) . . (0) . . N File:Hexa pathway.png (current)
- 11:50, 14 May 2011 (diff | hist) . . (+80) . . Tay-Sachs Disease 2011 (→Mutations)
- 11:39, 14 May 2011 (diff | hist) . . (+6) . . Tay-Sachs Disease 2011 (→Biochemical disease mechanism)
- 11:33, 14 May 2011 (diff | hist) . . (+5) . . Tay-Sachs Disease 2011 (→Biochemical disease mechanism)
- 11:28, 14 May 2011 (diff | hist) . . (+58) . . Tay-Sachs Disease 2011 (→Biochemical disease mechanism)
- 11:27, 14 May 2011 (diff | hist) . . (+57) . . Tay-Sachs Disease 2011 (→Biochemical disease mechanism)
- 11:25, 14 May 2011 (diff | hist) . . (0) . . N File:Hsa00604.png (current)
- 11:24, 14 May 2011 (diff | hist) . . (+145) . . Tay-Sachs Disease 2011 (→Biochemical disease mechanism)
- 11:00, 14 May 2011 (diff | hist) . . (+16) . . Tay-Sachs Disease 2011 (→Mutations)
- 10:56, 14 May 2011 (diff | hist) . . (-28) . . Tay-Sachs Disease 2011 (→Beta-Hexosaminidase A)
- 10:54, 14 May 2011 (diff | hist) . . (0) . . N File:2gjx bio r 500.jpg (current)
- 10:53, 14 May 2011 (diff | hist) . . (+121) . . Tay-Sachs Disease 2011 (→Mutations)
- 19:47, 13 May 2011 (diff | hist) . . (+404) . . Example sequence (current)
- 19:46, 13 May 2011 (diff | hist) . . (-651) . . Example sequence (→Fasta Sequence)
- 19:44, 13 May 2011 (diff | hist) . . (+663) . . N Beta-hexosaminidase subunit alpha (New page: == Fasta Sequence == <code>>>sp|P06865|HEXA_HUMAN Beta-hexosaminidase subunit alpha OS=Homo sapiens GN=HEXA PE=1 SV=2 MTSSRLWFSLLLAAAFAGRATALWPWPQNFQTSDQRYVLYPNNFQFQYDVSSAAQPGCSV LDEAFQRY...)
- 19:42, 13 May 2011 (diff | hist) . . (-200) . . Tay-Sachs Disease 2011 (→Reference sequence)
- 19:40, 13 May 2011 (diff | hist) . . (+100) . . Example sequence
- 15:55, 13 May 2011 (diff | hist) . . (-2) . . Tay-Sachs Disease 2011 (→Biochemical disease mechanism)
- 15:54, 13 May 2011 (diff | hist) . . (+88) . . Tay-Sachs Disease 2011 (→Biochemical disease mechanism)
- 15:47, 13 May 2011 (diff | hist) . . (+7) . . Tay-Sachs Disease 2011 (→Phenotype)
- 16:19, 12 May 2011 (diff | hist) . . (+641) . . Tay-Sachs Disease 2011 (→Mutations)
- 16:08, 12 May 2011 (diff | hist) . . (-1) . . Tay-Sachs Disease 2011 (→Biochemical disease mechanism)
- 16:08, 12 May 2011 (diff | hist) . . (+296) . . Tay-Sachs Disease 2011 (→Biochemical disease mechanism)
- 15:53, 12 May 2011 (diff | hist) . . (+46) . . Tay-Sachs Disease 2011 (→Cross-references)
- 15:52, 12 May 2011 (diff | hist) . . (-2) . . Tay-Sachs Disease 2011 (→Phenotype)
- 15:50, 12 May 2011 (diff | hist) . . (+2) . . Tay-Sachs Disease 2011 (→Phenotype)
- 15:48, 12 May 2011 (diff | hist) . . (+5) . . Tay-Sachs Disease 2011 (→Phenotype)
- 15:47, 12 May 2011 (diff | hist) . . (+903) . . Tay-Sachs Disease 2011 (→Phenotype)
- 15:32, 12 May 2011 (diff | hist) . . (+498) . . Tay-Sachs Disease 2011 (→Summary)
- 15:23, 12 May 2011 (diff | hist) . . (+1,133) . . Tay-Sachs Disease 2011
- 15:22, 12 May 2011 (diff | hist) . . (+294) . . Tay-Sachs Disease 2011 (→Phenotype)
- 15:20, 12 May 2011 (diff | hist) . . (+32) . . Tay-Sachs Disease 2011
- 15:19, 12 May 2011 (diff | hist) . . (+30) . . N Tay-Sachs Disease 2011 (New page: '''== Tay-Sachs Disease ==''')
- 15:17, 12 May 2011 (diff | hist) . . (+25) . . Protein Structure and Function Analysis (version: SS 2011) (→Diseases)