User contributions
From Bioinformatikpedia
(newest | oldest) View (newer 500 | older 500) (20 | 50 | 100 | 250 | 500)
- 20:47, 26 June 2011 (diff | hist) . . (+677) . . Rs121907982 (→SIFT Prediction)
- 20:45, 26 June 2011 (diff | hist) . . (+717) . . Rs1800430 (→SIFT Prediction)
- 20:43, 26 June 2011 (diff | hist) . . (+711) . . Rs1054374 (→SIFT Prediction)
- 20:36, 26 June 2011 (diff | hist) . . (+734) . . Rs61747114 (→SIFT Prediction)
- 20:32, 26 June 2011 (diff | hist) . . (+680) . . Rs121907974 (→SIFT Prediction)
- 20:28, 26 June 2011 (diff | hist) . . (+683) . . Rs61731240 (→SIFT Prediction)
- 20:25, 26 June 2011 (diff | hist) . . (+693) . . Rs121907979 (→SIFT Prediction)
- 20:23, 26 June 2011 (diff | hist) . . (+670) . . Rs4777505 (→SIFT Prediction)
- 20:15, 26 June 2011 (diff | hist) . . (+338) . . Rs121907967 (→PSSM Analysis)
- 20:15, 26 June 2011 (diff | hist) . . (+457) . . Rs121907967 (→PSSM analysis)
- 20:13, 26 June 2011 (diff | hist) . . (+847) . . Rs121907968 (→PSSM analysis)
- 20:10, 26 June 2011 (diff | hist) . . (+6) . . Rs121907979 (→PSSM Analysis)
- 20:09, 26 June 2011 (diff | hist) . . (+12) . . Sequence-based mutation analysis HEXA (→Own prediction)
- 20:08, 26 June 2011 (diff | hist) . . (+5) . . Sequence-based mutation analysis HEXA (→Results)
- 20:07, 26 June 2011 (diff | hist) . . (-98) . . Rs1800430 (→PSSM Analysis)
- 19:59, 26 June 2011 (diff | hist) . . (-149) . . Rs1800430 (→PSSM Analysis)
- 19:54, 26 June 2011 (diff | hist) . . (+993) . . Rs1800430 (→PSSM analysis)
- 19:53, 26 June 2011 (diff | hist) . . (+842) . . Rs1054374 (→PSSM analysis)
- 19:52, 26 June 2011 (diff | hist) . . (+2) . . Rs121907979 (→PSSM Analysis)
- 19:51, 26 June 2011 (diff | hist) . . (-3) . . Rs121907979 (→PSSM Analysis)
- 19:49, 26 June 2011 (diff | hist) . . (+7) . . Rs4777505 (→PSSM Analysis)
- 19:47, 26 June 2011 (diff | hist) . . (+1) . . Rs121907979 (→PSSM Analysis)
- 19:47, 26 June 2011 (diff | hist) . . (+7) . . Rs61731240 (→PSSM Analysis)
- 19:46, 26 June 2011 (diff | hist) . . (+1) . . Rs61747114 (→PSSM Analysis)
- 19:46, 26 June 2011 (diff | hist) . . (+7) . . Rs121907974 (→PSSM Analysis)
- 19:45, 26 June 2011 (diff | hist) . . (-152) . . Rs61747114 (→PSSM Analysis)
- 19:45, 26 June 2011 (diff | hist) . . (+995) . . Rs61747114 (→PSSM analysis)
- 19:45, 26 June 2011 (diff | hist) . . (+6) . . Rs121907979 (→PSSM Analysis)
- 19:41, 26 June 2011 (diff | hist) . . (0) . . Rs121907974 (→Subsitution Matrices values)
- 19:40, 26 June 2011 (diff | hist) . . (-23) . . Rs121907974 (→PSSM analysis)
- 19:40, 26 June 2011 (diff | hist) . . (+859) . . Rs121907974 (→PSSM analysis)
- 19:38, 26 June 2011 (diff | hist) . . (-152) . . Rs61731240 (→PSSM Analysis)
- 19:38, 26 June 2011 (diff | hist) . . (-23) . . Rs61731240 (→PSSM Analysis)
- 19:37, 26 June 2011 (diff | hist) . . (+1,014) . . Rs61731240 (→PSSM analysis)
- 19:34, 26 June 2011 (diff | hist) . . (0) . . Rs4777505 (→PSSM analysis)
- 19:32, 26 June 2011 (diff | hist) . . (0) . . Rs121907979 (→PSSM analysis)
- 19:32, 26 June 2011 (diff | hist) . . (-23) . . Rs121907979 (→PSSM Analysis)
- 19:32, 26 June 2011 (diff | hist) . . (-154) . . Rs121907979 (→PSSM analysis)
- 19:31, 26 June 2011 (diff | hist) . . (+1,010) . . Rs121907979 (→PSSM analysis)
- 19:29, 26 June 2011 (diff | hist) . . (+1) . . Rs4777505 (→PSSM analysis)
- 19:28, 26 June 2011 (diff | hist) . . (+402) . . Rs4777505 (→PSSM analysis)
- 19:17, 26 June 2011 (diff | hist) . . (+23) . . Rs4777505 (→PSSM analysis)
- 19:16, 26 June 2011 (diff | hist) . . (-1) . . Rs4777505 (→PSSM analysis)
- 15:20, 26 June 2011 (diff | hist) . . (+40) . . Rs4777505 (→PSSM analysis)
- 15:18, 26 June 2011 (diff | hist) . . (+367) . . Rs4777505 (→PSSM analysis)
- 15:06, 26 June 2011 (diff | hist) . . (+557) . . Rs61747114 (→PolyPhen2 Prediction)
- 14:57, 26 June 2011 (diff | hist) . . (+707) . . Rs61747114 (→PolyPhen2 Prediction)
- 14:57, 26 June 2011 (diff | hist) . . (+876) . . Rs121907968 (→PolyPhen2 Prediction)
- 14:56, 26 June 2011 (diff | hist) . . (+866) . . Rs121907982 (→PolyPhen2 Prediction)
- 14:56, 26 June 2011 (diff | hist) . . (+865) . . Rs1800430 (→PolyPhen2 Prediction)
- 14:56, 26 June 2011 (diff | hist) . . (+865) . . Rs1054374 (→PolyPhen2 Prediction)
- 14:54, 26 June 2011 (diff | hist) . . (+878) . . Rs121907974 (→PolyPhen2 Prediction)
- 14:54, 26 June 2011 (diff | hist) . . (+878) . . Rs61731240 (→Polyphen2 Prediction)
- 14:53, 26 June 2011 (diff | hist) . . (-16) . . Rs121907979 (→Polyphen2 Prediction)
- 14:53, 26 June 2011 (diff | hist) . . (-18) . . Rs4777505 (→PolyPhen2 Prediction)
- 14:53, 26 June 2011 (diff | hist) . . (+883) . . Rs4777505 (→PolyPhen2 Prediction)
- 14:51, 26 June 2011 (diff | hist) . . (+637) . . Rs121907979 (→Polyphen2 Prediction)
- 14:21, 26 June 2011 (diff | hist) . . (+82) . . Rs121907967 (→PolyPhen2 Prediction)
- 14:19, 26 June 2011 (diff | hist) . . (+187) . . Rs121907967 (→SNAP Prediction)
- 14:18, 26 June 2011 (diff | hist) . . (+1,415) . . Rs121907967 (→Secondary Structure Mutation Analysis)
- 14:11, 26 June 2011 (diff | hist) . . (0) . . N File:Mut 7.png (current)
- 14:11, 26 June 2011 (diff | hist) . . (+736) . . Rs121907967 (→Conservation Analysis with Multiple Alignments)
- 14:05, 26 June 2011 (diff | hist) . . (+631) . . Rs121907967 (→Subsitution Matrices Values)
- 14:00, 26 June 2011 (diff | hist) . . (0) . . Rs121907968 (→Subsitution Matrices Values)
- 14:00, 26 June 2011 (diff | hist) . . (+1,170) . . Rs121907968 (→Subsitution Matrices Values)
- 13:54, 26 June 2011 (diff | hist) . . (+502) . . Rs121907968 (→SNAP Prediction)
- 13:53, 26 June 2011 (diff | hist) . . (+1,665) . . Rs121907968 (→Secondary Structure Mutation Analysis)
- 13:51, 26 June 2011 (diff | hist) . . (+575) . . Rs121907968 (→Conservation Analysis with Multiple Alignments)
- 13:49, 26 June 2011 (diff | hist) . . (+606) . . Rs121907982 (→SNAP Prediction)
- 13:47, 26 June 2011 (diff | hist) . . (+1,845) . . Rs121907982 (→Secondary Structure Mutation Analysis)
- 13:45, 26 June 2011 (diff | hist) . . (+593) . . Rs121907982 (→Subsitution Matrices Values)
- 13:44, 26 June 2011 (diff | hist) . . (+581) . . Rs121907982 (→Conservation Analysis with Multiple Alignments)
- 13:42, 26 June 2011 (diff | hist) . . (0) . . Sequence-based mutation analysis HEXA (→Results)
- 13:41, 26 June 2011 (diff | hist) . . (-1) . . Sequence-based mutation analysis HEXA (→Results)
- 13:40, 26 June 2011 (diff | hist) . . (+728) . . Rs1800430 (→Secondary Structure Mutation Analysis)
- 13:36, 26 June 2011 (diff | hist) . . (+1,015) . . Rs1800430 (→Secondary Structure Mutation Analysis)
- 12:20, 26 June 2011 (diff | hist) . . (+513) . . Rs1800430 (→SNAP Prediction)
- 12:17, 26 June 2011 (diff | hist) . . (+9) . . Rs1800430 (→Conservation Analysis with Multiple Alignments)
- 12:17, 26 June 2011 (diff | hist) . . (+579) . . Rs1800430 (→Conservation Analysis with Multiple Alignments)
- 12:15, 26 June 2011 (diff | hist) . . (+601) . . Rs1800430 (→Subsitution Matrices Values)
- 12:11, 26 June 2011 (diff | hist) . . (+1,607) . . Rs1054374 (→Subsitution Matrices Values)
- 12:05, 26 June 2011 (diff | hist) . . (+506) . . Rs1054374 (→SNAP Prediction)
- 12:03, 26 June 2011 (diff | hist) . . (+896) . . Rs1054374 (→Secondary Structure Mutation Analysis)
- 12:02, 26 June 2011 (diff | hist) . . (+949) . . Rs1054374 (→Secondary Structure Mutation Analysis)
- 12:01, 26 June 2011 (diff | hist) . . (+636) . . Rs1054374 (→Conservation Analysis with Multiple Alignments)
- 11:56, 26 June 2011 (diff | hist) . . (+862) . . Rs61747114 (→Subsitution Matrices Values)
- 11:50, 26 June 2011 (diff | hist) . . (+513) . . Rs61747114 (→SNAP Prediction)
- 11:48, 26 June 2011 (diff | hist) . . (+1,654) . . Rs61747114 (→Secondary Structure Mutation Analysis)
- 11:45, 26 June 2011 (diff | hist) . . (+579) . . Rs61747114 (→Conservation Analysis with Multiple Alignments)
- 11:43, 26 June 2011 (diff | hist) . . (+3) . . Rs121907974 (→Subsitution Matrices values)
- 11:43, 26 June 2011 (diff | hist) . . (+1) . . Rs61731240 (→Subsitution Matrices Values)
- 11:43, 26 June 2011 (diff | hist) . . (+607) . . Rs121907974 (→Subsitution Matrices values)
- 11:40, 26 June 2011 (diff | hist) . . (-8) . . Rs61731240 (→Subsitution Matrices Values)
- 11:34, 26 June 2011 (diff | hist) . . (+497) . . Rs121907974 (→SNAP Prediction)
- 11:33, 26 June 2011 (diff | hist) . . (+883) . . Rs121907974 (→Secondary Structure Mutation Analysis)
- 11:32, 26 June 2011 (diff | hist) . . (+7) . . Rs61731240 (→Secondary Structure Mutation Analysis)
- 11:31, 26 June 2011 (diff | hist) . . (-1,054) . . Rs61731240 (→Secondary Structure Mutation Analysis)
- 11:31, 26 June 2011 (diff | hist) . . (+932) . . Rs121907974 (→Secondary Structure Mutation Analysis)
- 11:29, 26 June 2011 (diff | hist) . . (-3) . . Rs61731240 (→Conservation analysis with Multiple Alignments)
- 11:29, 26 June 2011 (diff | hist) . . (+578) . . Rs121907974 (→Conservation Analysis with Multiple Alignments)
- 11:14, 26 June 2011 (diff | hist) . . (+270) . . Rs121907979 (→Subsitution Matrices Values)
- 11:12, 26 June 2011 (diff | hist) . . (+1) . . Rs4777505 (→Subsitution Matrices Values)
- 11:11, 26 June 2011 (diff | hist) . . (+1,429) . . Rs61731240 (→Subsitution Matrices Values)
- 11:03, 26 June 2011 (diff | hist) . . (+511) . . Rs61731240 (→SNAP Prediction)
- 11:01, 26 June 2011 (diff | hist) . . (+1,932) . . Rs61731240 (→Secondary Structure Mutation Analysis)
- 10:56, 26 June 2011 (diff | hist) . . (+917) . . Rs61731240 (→Secondary Structure Mutation Analysis)
- 10:52, 26 June 2011 (diff | hist) . . (-3) . . Rs4777505 (→Secondary Structure Mutation Analysis)
- 10:50, 26 June 2011 (diff | hist) . . (+572) . . Rs61731240 (→Conservation analysis with Multiple Alignments)
- 10:45, 26 June 2011 (diff | hist) . . (+331) . . Rs4777505 (→Secondary Structure Mutation Analysis)
- 22:38, 25 June 2011 (diff | hist) . . (-1) . . Rs121907979 (→SNAP Prediction)
- 22:38, 25 June 2011 (diff | hist) . . (+497) . . Rs4777505 (→SNAP Prediction)
- 22:35, 25 June 2011 (diff | hist) . . (+4) . . Sequence-based mutation analysis HEXA (→Own prediction)
- 22:35, 25 June 2011 (diff | hist) . . (+4) . . Sequence-based mutation analysis HEXA (→Results)
- 22:34, 25 June 2011 (diff | hist) . . (-4) . . Sequence-based mutation analysis HEXA (→Results)
- 22:33, 25 June 2011 (diff | hist) . . (-289) . . Sequence-based mutation analysis HEXA (→Own prediction)
- 22:30, 25 June 2011 (diff | hist) . . (+4) . . Sequence-based mutation analysis HEXA (→Results)
- 22:30, 25 June 2011 (diff | hist) . . (+752) . . Rs4777505 (→Secondary Structure Mutation Analysis)
- 22:28, 25 June 2011 (diff | hist) . . (+703) . . Rs4777505 (→Secondary Structure Mutation Analysis)
- 22:25, 25 June 2011 (diff | hist) . . (+608) . . Rs4777505 (→Conservation Analysis with Multiple Alignments)
- 22:19, 25 June 2011 (diff | hist) . . (+1,707) . . Rs4777505 (→Subsitution Matrices Values)
- 21:45, 25 June 2011 (diff | hist) . . (0) . . Rs1800430 (→Visualisation of the Mutation)
- 21:44, 25 June 2011 (diff | hist) . . (+1) . . Rs1054374 (→Visualisation of the Mutation)
- 21:44, 25 June 2011 (diff | hist) . . (0) . . Rs61747114 (→Visualisation of the Mutation)
- 21:37, 25 June 2011 (diff | hist) . . (0) . . Rs121907974 (→Visualisation of the Mutation)
- 21:36, 25 June 2011 (diff | hist) . . (+1) . . Rs4777505 (→Visualisation of the Mutation)
- 21:35, 25 June 2011 (diff | hist) . . (0) . . Rs61731240 (→Visualisation of the Mutation)
- 21:35, 25 June 2011 (diff | hist) . . (+750) . . Rs121907968 (→Visualisation of the Mutation)
- 21:30, 25 June 2011 (diff | hist) . . (+608) . . Rs121907982 (→Visualisation of the Mutation)
- 21:19, 25 June 2011 (diff | hist) . . (+7) . . Rs4777505 (→Visualisation of the Mutation)
- 21:14, 25 June 2011 (diff | hist) . . (+640) . . Rs1800430 (→Visualisation of the Mutation)
- 21:09, 25 June 2011 (diff | hist) . . (-149) . . Rs121907967 (→Visualisation of the Mutation)
- 21:08, 25 June 2011 (diff | hist) . . (+902) . . Rs121907967 (→Visualisation of the Mutation)
- 20:59, 25 June 2011 (diff | hist) . . (+81) . . Rs1054374 (→Visualisation of the Mutation)
- 20:58, 25 June 2011 (diff | hist) . . (+618) . . Rs1054374 (→Visualisation of the Mutation)
- 20:45, 25 June 2011 (diff | hist) . . (+702) . . Rs61747114 (→Visualisation of the Mutation)
- 20:37, 25 June 2011 (diff | hist) . . (0) . . Rs61731240 (→Visualisation of the Mutation)
- 20:37, 25 June 2011 (diff | hist) . . (+620) . . Rs121907974 (→Visualisation of the Mutation)
- 20:32, 25 June 2011 (diff | hist) . . (+669) . . Rs61731240 (→Visualisation of the Mutation)
- 20:29, 25 June 2011 (diff | hist) . . (+648) . . Rs4777505 (→Visualisation of the Mutation)
- 20:25, 25 June 2011 (diff | hist) . . (+203) . . Rs121907968 (→Pysicochemical Properities)
- 20:24, 25 June 2011 (diff | hist) . . (+203) . . Rs121907982 (→Pysicochemical Properities)
- 20:24, 25 June 2011 (diff | hist) . . (+203) . . Rs1800430 (→Pysicochemical Properities)
- 20:24, 25 June 2011 (diff | hist) . . (+203) . . Rs121907967 (→Pysicochemical Properities)
- 20:23, 25 June 2011 (diff | hist) . . (+203) . . Rs1054374 (→Pysicochemical Properities)
- 20:23, 25 June 2011 (diff | hist) . . (+203) . . Rs61747114 (→Pysicochemical Properities)
- 20:22, 25 June 2011 (diff | hist) . . (+203) . . Rs121907974 (→Pysicochemical Properities)
- 20:22, 25 June 2011 (diff | hist) . . (+203) . . Rs61731240 (→Pysicochemical Properities)
- 20:21, 25 June 2011 (diff | hist) . . (+203) . . Rs4777505 (→Pysicochemical Properities)
- 20:21, 25 June 2011 (diff | hist) . . (+26) . . Rs121907979 (→Polyphen2 Prediction)
- 20:19, 25 June 2011 (diff | hist) . . (+233) . . Rs121907979 (→Polyphen2 Prediction)
- 20:15, 25 June 2011 (diff | hist) . . (+510) . . Rs121907979 (→SNAP Prediction)
- 20:06, 25 June 2011 (diff | hist) . . (+1) . . Rs121907979 (→Secondary Structure Mutation Analysis)
- 20:05, 25 June 2011 (diff | hist) . . (+709) . . Rs121907979 (→Secondary Structure Mutation Analysis)
- 19:46, 25 June 2011 (diff | hist) . . (+818) . . Rs121907979 (→Secondary Structure Mutation Analysis)
- 19:34, 25 June 2011 (diff | hist) . . (+173) . . Rs121907979 (→Conservation Analysis with Multiple Alignments)
- 19:29, 25 June 2011 (diff | hist) . . (+2) . . Rs4777505 (→Conservation Analysis with Multiple Alignments)
- 19:28, 25 June 2011 (diff | hist) . . (0) . . File:Mut 1 2.png (uploaded a new version of "File:Mut 1 2.png") (current)
- 19:27, 25 June 2011 (diff | hist) . . (0) . . N File:Mut 1 2.png
- 19:27, 25 June 2011 (diff | hist) . . (+267) . . Rs121907979 (→Conservation Analysis with Multiple Alignments)
- 19:16, 25 June 2011 (diff | hist) . . (+140) . . Rs121907979 (→Conservation Analysis with Multiple Alignments)
- 18:07, 23 June 2011 (diff | hist) . . (+228) . . m Rs121907967 (→PolyPhen2 Prediction)
- 18:04, 23 June 2011 (diff | hist) . . (-125) . . Rs121907967 (→PolyPhen2 Prediction)
- 18:03, 23 June 2011 (diff | hist) . . (-2) . . Sequence-based mutation analysis HEXA
- 18:02, 23 June 2011 (diff | hist) . . (-46,265) . . Sequence-based mutation analysis HEXA (→Analysis of the mutations)
- 17:59, 23 June 2011 (diff | hist) . . (+1) . . Rs121907967
- 17:57, 23 June 2011 (diff | hist) . . (0) . . Rs121907974 (→Secondary structure mutation analysis)
- 17:57, 23 June 2011 (diff | hist) . . (0) . . Rs121907974 (→Conservation analysis with multiple alignments)
- 17:57, 23 June 2011 (diff | hist) . . (0) . . Rs121907974 (→Visualisation of the mutation)
- 17:56, 23 June 2011 (diff | hist) . . (0) . . Rs61731240 (→Secondary structure mutation analysis)
- 17:56, 23 June 2011 (diff | hist) . . (0) . . Rs61731240 (→Conservation analysis with multiple alignments)
- 17:55, 23 June 2011 (diff | hist) . . (0) . . Rs121907979 (→Conservation analysis with multiple alignments)
- 17:55, 23 June 2011 (diff | hist) . . (0) . . Rs121907979 (→Secondary structure mutation analysis)
- 17:54, 23 June 2011 (diff | hist) . . (0) . . Rs4777505 (→Secondary structure mutation analysis)
- 17:53, 23 June 2011 (diff | hist) . . (+4,663) . . N Rs121907968 (Created page with "=== Pysicochemical Properities === {| border="1" style="text-align:center; border-spacing:0;" |Trp |Arg |consequences |- |aromatic, polar, hydrophobic, neutral |positive charged…")
- 17:51, 23 June 2011 (diff | hist) . . (0) . . N File:Mut 9 humvar neu.png (current)
- 17:50, 23 June 2011 (diff | hist) . . (0) . . N File:Mut 9 humdiv neu.png (current)
- 17:50, 23 June 2011 (diff | hist) . . (+8) . . m Rs121907982 (→PolyPhen2 Prediction)
- 17:50, 23 June 2011 (diff | hist) . . (0) . . File:Mut 9 humdiv.png (uploaded a new version of "File:Mut 9 humdiv.png") (current)
- 17:49, 23 June 2011 (diff | hist) . . (0) . . File:Mut 9 humvar.png (uploaded a new version of "File:Mut 9 humvar.png") (current)
- 17:48, 23 June 2011 (diff | hist) . . (0) . . File:Mut 9 humdiv.png (uploaded a new version of "File:Mut 9 humdiv.png")
- 17:46, 23 June 2011 (diff | hist) . . (+4,592) . . N Rs121907982 (Created page with "=== Pysicochemical Properities === {| border="1" style="text-align:center; border-spacing:0;" |Ile |Val |consequences |- |aliphatic, hydrophobic, neutra |aliphatic, hydrophobic,…")
- 17:43, 23 June 2011 (diff | hist) . . (+3,789) . . Rs1800430
- 17:41, 23 June 2011 (diff | hist) . . (+5) . . Sequence-based mutation analysis HEXA (→rs1800430: Asn -> Asp)
- 17:40, 23 June 2011 (diff | hist) . . (+775) . . N Rs1800430 SNAP (Created page with "{| border="1" style="text-align:center; border-spacing:0;" |Substitution |Prediction |Reliability Index |Expected Accuracy |- |A |Non-neutral |0 |58% |- |C |Non-neutral |2 |70% …") (current)
- 17:39, 23 June 2011 (diff | hist) . . (+1,569) . . Rs121907967
- 17:36, 23 June 2011 (diff | hist) . . (+5) . . Sequence-based mutation analysis HEXA (→rs121907967: Trp -> TER)
- 17:36, 23 June 2011 (diff | hist) . . (+791) . . N Rs121907967 SNAP (Created page with "{| border="1" style="text-align:center; border-spacing:0;" |Substitution |Prediction |Reliability Index |Expected Accuracy |- |A |Non-neutral |5 |87% |- |C |Non-neutral |5 |87% …") (current)
- 17:34, 23 June 2011 (diff | hist) . . (+4,732) . . N Rs1054374 (Created page with "=== Pysicochemical Properities === {| border="1" style="text-align:center; border-spacing:0;" |Ser |Ile |consequences |- |polar, tiny, hydrophilic, neutral |aliphatic, hydropho…")
- 17:30, 23 June 2011 (diff | hist) . . (+4,725) . . N Rs61747114 (Created page with "=== Pysicochemical Properities === {| border="1" style="text-align:center; border-spacing:0;" |Leu |Phe |consequences |- |aliphatic, hydrophobic, neutral |aromatic, hydrophobic,…")
- 17:26, 23 June 2011 (diff | hist) . . (+4,735) . . Rs121907974
- 17:23, 23 June 2011 (diff | hist) . . (+764) . . N Rs121907974 SNAP (Created page with "{| border="1" style="text-align:center; border-spacing:0;" |Substitution |Prediction |Reliability Index |Expected Accuracy |- |C |Non-neutral |6 |93% |- |D |Non-neutral |7 |96% …") (current)
- 17:23, 23 June 2011 (diff | hist) . . (+5) . . Sequence-based mutation analysis HEXA (→rs121907974: Phe -> Ser)
- 17:22, 23 June 2011 (diff | hist) . . (-764) . . Rs121907974 (Blanked the page)
- 17:21, 23 June 2011 (diff | hist) . . (+6) . . Rs61731240
- 17:20, 23 June 2011 (diff | hist) . . (+4,894) . . N Rs61731240 (Created page with "=== Pysicochemical Properities === {| border="1" style="text-align:center; border-spacing:0;" |His |Asp |consequences |- |aromatic, positive charged, polar, hydrophilic |negativ…")
- 17:17, 23 June 2011 (diff | hist) . . (+6) . . Rs121907979
- 17:17, 23 June 2011 (diff | hist) . . (+6,566) . . N Rs121907979 (Created page with "=== Pysicochemical Properities === First of all, we explored the amino acid properties and compared them for the original and the mutated amino acid. Therefore we created the po…")
- 17:12, 23 June 2011 (diff | hist) . . (0) . . Rs4777505 (→Polyphen2 Prediction)
- 17:11, 23 June 2011 (diff | hist) . . (+6) . . Rs4777505
- 17:11, 23 June 2011 (diff | hist) . . (+9) . . Rs4777505
- 17:10, 23 June 2011 (diff | hist) . . (+36) . . Rs4777505
- 17:08, 23 June 2011 (diff | hist) . . (+7) . . Rs4777505
- 17:08, 23 June 2011 (diff | hist) . . (-27) . . Rs4777505 (→rs4777505: Asn -> Ser)
- 17:06, 23 June 2011 (diff | hist) . . (+4,644) . . N Rs4777505 (Created page with "===rs4777505: Asn -> Ser === '''pysicochemical properities''' {| border="1" style="text-align:center; border-spacing:0;" |Asn |Ser |consequences |- |polar, small, hydrophilic,…")
- 16:19, 23 June 2011 (diff | hist) . . (+2) . . Sequence-based mutation analysis HEXA (→rs121907979: Leu -> Arg)
- 16:18, 23 June 2011 (diff | hist) . . (+1) . . Sequence-based mutation analysis HEXA (→rs121907979: Leu -> Arg)
- 16:18, 23 June 2011 (diff | hist) . . (+1,852) . . Sequence-based mutation analysis HEXA (→rs121907979: Leu -> Arg)
- 16:16, 23 June 2011 (diff | hist) . . (-128) . . Sequence-based mutation analysis HEXA (→rs121907979: Leu -> Arg)
- 14:24, 23 June 2011 (diff | hist) . . (0) . . N File:Mut 10 humvar.png (current)
- 14:24, 23 June 2011 (diff | hist) . . (0) . . N File:Mut 10 humdiv.png (current)
- 14:24, 23 June 2011 (diff | hist) . . (0) . . File:Mut 9 humvar.png (uploaded a new version of "File:Mut 9 humvar.png")
- 14:22, 23 June 2011 (diff | hist) . . (0) . . N File:Mut 9 humvar.png
- 14:22, 23 June 2011 (diff | hist) . . (0) . . N File:Mut 9 humdiv.png
- 14:21, 23 June 2011 (diff | hist) . . (0) . . N File:Mut 8 humvar.png (current)
- 14:19, 23 June 2011 (diff | hist) . . (0) . . N File:Mut 8 humdiv.png (current)
- 14:19, 23 June 2011 (diff | hist) . . (0) . . N File:Mut 7 humvar.png (current)
- 14:18, 23 June 2011 (diff | hist) . . (0) . . N File:Mut 7 humdiv.png (current)
- 14:18, 23 June 2011 (diff | hist) . . (0) . . N File:Mut 6 humvar.png (current)
- 14:18, 23 June 2011 (diff | hist) . . (0) . . N File:Mut 6 humdiv.png (current)
- 14:17, 23 June 2011 (diff | hist) . . (+153) . . Sequence-based mutation analysis HEXA (→rs121907968: Trp -> Arg)
- 14:17, 23 June 2011 (diff | hist) . . (+151) . . Sequence-based mutation analysis HEXA (→rs121907982: Ile -> Val)
- 14:16, 23 June 2011 (diff | hist) . . (+151) . . Sequence-based mutation analysis HEXA (→rs1800430: Asn -> Asp)
- 14:16, 23 June 2011 (diff | hist) . . (0) . . Sequence-based mutation analysis HEXA (→rs121907967: Trp -> TER)
- 14:16, 23 June 2011 (diff | hist) . . (+151) . . Sequence-based mutation analysis HEXA (→rs121907967: Trp -> TER)
- 14:15, 23 June 2011 (diff | hist) . . (+151) . . Sequence-based mutation analysis HEXA (→rs1054374: Ser -> Ile)
- 14:14, 23 June 2011 (diff | hist) . . (0) . . File:Mut 4 humvar.png (uploaded a new version of "File:Mut 4 humvar.png") (current)
- 14:14, 23 June 2011 (diff | hist) . . (0) . . N File:Mut 5 humvar.png (current)
- 14:14, 23 June 2011 (diff | hist) . . (0) . . N File:Mut 5 humdiv.png (current)
- 14:13, 23 June 2011 (diff | hist) . . (0) . . N File:Mut 4 humvar.png
- 14:13, 23 June 2011 (diff | hist) . . (0) . . N File:Mut 4 humdiv.png (current)
- 14:12, 23 June 2011 (diff | hist) . . (0) . . N File:Mut 3 humvar.png (current)
- 14:12, 23 June 2011 (diff | hist) . . (0) . . N File:Mut 3 humdiv.png (current)
- 14:12, 23 June 2011 (diff | hist) . . (0) . . N File:Mut 2 humvar.png (current)
- 14:12, 23 June 2011 (diff | hist) . . (0) . . N File:Mut 2 humdiv.png (current)
- 14:11, 23 June 2011 (diff | hist) . . (-30) . . Sequence-based mutation analysis HEXA (→rs121907979: Leu -> Arg)
- 14:11, 23 June 2011 (diff | hist) . . (-30) . . Sequence-based mutation analysis HEXA (→rs4777505: Asn -> Ser)
- 14:10, 23 June 2011 (diff | hist) . . (+150) . . Sequence-based mutation analysis HEXA (→rs61747114: Leu -> Phe)
- 14:10, 23 June 2011 (diff | hist) . . (+150) . . Sequence-based mutation analysis HEXA (→rs121907974: Phe -> Ser)
- 14:10, 23 June 2011 (diff | hist) . . (-32) . . Sequence-based mutation analysis HEXA (→rs61731240: His -> Asp)
- 14:09, 23 June 2011 (diff | hist) . . (+183) . . Sequence-based mutation analysis HEXA (→rs61731240: His -> Asp)
- 14:08, 23 June 2011 (diff | hist) . . (+182) . . Sequence-based mutation analysis HEXA (→rs121907979: Leu -> Arg)
- 14:07, 23 June 2011 (diff | hist) . . (0) . . Sequence-based mutation analysis HEXA (→rs4777505: Asn -> Ser)
- 14:07, 23 June 2011 (diff | hist) . . (0) . . Sequence-based mutation analysis HEXA (→rs4777505: Asn -> Ser)
- 14:07, 23 June 2011 (diff | hist) . . (0) . . Sequence-based mutation analysis HEXA (→rs4777505: Asn -> Ser)
- 14:06, 23 June 2011 (diff | hist) . . (0) . . N File:Mut 1 humvar.png (current)
- 14:06, 23 June 2011 (diff | hist) . . (0) . . N File:Mut 1 humdiv.png (current)
- 14:06, 23 June 2011 (diff | hist) . . (+182) . . Sequence-based mutation analysis HEXA (→rs4777505: Asn -> Ser)
- 12:18, 23 June 2011 (diff | hist) . . (0) . . N File:Mut 10.png (current)
- 12:18, 23 June 2011 (diff | hist) . . (+1) . . Sequence-based mutation analysis HEXA (→rs121907968: Trp -> Arg)
- 12:17, 23 June 2011 (diff | hist) . . (0) . . N File:Mut 9.png (current)
- 12:17, 23 June 2011 (diff | hist) . . (0) . . N File:Mut 8.png (current)
- 12:17, 23 June 2011 (diff | hist) . . (0) . . N File:Mut 6.png (current)
- 12:16, 23 June 2011 (diff | hist) . . (0) . . N File:Mut 5.png (current)
- 12:16, 23 June 2011 (diff | hist) . . (0) . . N File:Mut 4.png (current)
- 12:15, 23 June 2011 (diff | hist) . . (0) . . N File:Mut 3.png (current)
- 12:15, 23 June 2011 (diff | hist) . . (0) . . N File:Mut 2.png (current)
- 12:15, 23 June 2011 (diff | hist) . . (0) . . Sequence-based mutation analysis HEXA (→rs121907968: Trp -> Arg)
- 12:15, 23 June 2011 (diff | hist) . . (+128) . . Sequence-based mutation analysis HEXA (→rs121907968: Trp -> Arg)
- 12:14, 23 June 2011 (diff | hist) . . (+127) . . Sequence-based mutation analysis HEXA (→rs121907982: Ile -> Val)
- 12:14, 23 June 2011 (diff | hist) . . (+127) . . Sequence-based mutation analysis HEXA (→rs1800430: Asn -> Asp)
- 12:14, 23 June 2011 (diff | hist) . . (+127) . . Sequence-based mutation analysis HEXA (→rs121907967: Trp -> TER)
- 12:14, 23 June 2011 (diff | hist) . . (+127) . . Sequence-based mutation analysis HEXA (→rs1054374: Ser -> Ile)
- 12:13, 23 June 2011 (diff | hist) . . (+126) . . Sequence-based mutation analysis HEXA (→rs61747114: Leu -> Phe)
- 12:13, 23 June 2011 (diff | hist) . . (0) . . Sequence-based mutation analysis HEXA (→rs121907974: Phe -> Ser)
- 12:13, 23 June 2011 (diff | hist) . . (+127) . . Sequence-based mutation analysis HEXA (→rs121907974: Phe -> Ser)
- 12:12, 23 June 2011 (diff | hist) . . (+128) . . Sequence-based mutation analysis HEXA (→rs61731240: His -> Asp)
- 12:12, 23 June 2011 (diff | hist) . . (+127) . . Sequence-based mutation analysis HEXA (→rs121907979: Leu -> Arg)
- 12:11, 23 June 2011 (diff | hist) . . (+2) . . Sequence-based mutation analysis HEXA (→rs4777505: Asn -> Ser)
- 12:11, 23 June 2011 (diff | hist) . . (-2) . . Sequence-based mutation analysis HEXA (→rs4777505: Asn -> Ser)
- 12:11, 23 June 2011 (diff | hist) . . (+7) . . Sequence-based mutation analysis HEXA (→rs4777505: Asn -> Ser)
- 12:10, 23 June 2011 (diff | hist) . . (0) . . N File:Mut 1.png (current)
- 12:10, 23 June 2011 (diff | hist) . . (0) . . Sequence-based mutation analysis HEXA (→rs4777505: Asn -> Ser)
- 12:09, 23 June 2011 (diff | hist) . . (+1) . . Sequence-based mutation analysis HEXA (→rs4777505: Asn -> Ser)
- 12:08, 23 June 2011 (diff | hist) . . (+66) . . Sequence-based mutation analysis HEXA (→rs4777505: Asn -> Ser)
- 12:05, 23 June 2011 (diff | hist) . . (+53) . . Sequence-based mutation analysis HEXA (→rs4777505: Asn -> Ser)
- 22:53, 20 June 2011 (diff | hist) . . (+610) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and DBSNP)
- 00:25, 20 June 2011 (diff | hist) . . (0) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and DBSNP)
- 00:24, 20 June 2011 (diff | hist) . . (0) . . N File:Bp mat.png (current)
- 00:24, 20 June 2011 (diff | hist) . . (+98) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and DBSNP)
- 23:52, 19 June 2011 (diff | hist) . . (+26) . . Mapping SNPs HEXA (→Silent Mutations)
- 23:37, 19 June 2011 (diff | hist) . . (+554) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and DBSNP)
- 23:27, 19 June 2011 (diff | hist) . . (-86) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and DBSNP)
- 23:18, 19 June 2011 (diff | hist) . . (0) . . N File:Aa mat.png (current)
- 23:18, 19 June 2011 (diff | hist) . . (-1) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and DBSNP)
- 19:05, 18 June 2011 (diff | hist) . . (+3) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and DBSNP)
- 18:54, 18 June 2011 (diff | hist) . . (+254) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and DBSNP)
- 18:47, 18 June 2011 (diff | hist) . . (+548) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and DBSNP)
- 18:36, 18 June 2011 (diff | hist) . . (-3) . . Mapping SNPs HEXA (→Silent Mutations)
- 16:39, 18 June 2011 (diff | hist) . . (-1) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and DBSNP)
- 16:39, 18 June 2011 (diff | hist) . . (0) . . N File:Heatmap.png (current)
- 16:38, 18 June 2011 (diff | hist) . . (+113) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and DBSNP)
- 15:19, 18 June 2011 (diff | hist) . . (-1) . . Mapping SNPs HEXA (→Mutations annotated only in SNP-DB)
- 15:18, 18 June 2011 (diff | hist) . . (+4) . . Mapping SNPs HEXA (→Mutations annotated only in SNP-DB)
- 11:58, 18 June 2011 (diff | hist) . . (+2) . . Mapping SNPs HEXA (→Silent Mutations)
- 11:57, 18 June 2011 (diff | hist) . . (+13) . . Mapping SNPs HEXA (→Silent Mutations)
- 11:57, 18 June 2011 (diff | hist) . . (+208) . . Mapping SNPs HEXA (→Silent Mutations)
- 11:42, 18 June 2011 (diff | hist) . . (+2) . . Mapping SNPs HEXA (→Silent Mutations)
- 11:42, 18 June 2011 (diff | hist) . . (+112) . . Mapping SNPs HEXA (→Silent Mutations)
- 11:40, 18 June 2011 (diff | hist) . . (+3) . . Mapping SNPs HEXA (→Mutations annotated only in SNP-DB)
- 11:39, 18 June 2011 (diff | hist) . . (+113) . . Mapping SNPs HEXA (→Mutations annotated only in SNP-DB)
- 11:38, 18 June 2011 (diff | hist) . . (+8) . . Mapping SNPs HEXA (→Mutations annotated only in SNP-DB)
- 11:37, 18 June 2011 (diff | hist) . . (+82) . . Mapping SNPs HEXA (→Mutations annotated only in SNP-DB)
- 11:16, 18 June 2011 (diff | hist) . . (+1) . . Mapping SNPs HEXA (→Silent Mutation)
- 11:16, 18 June 2011 (diff | hist) . . (0) . . Mapping SNPs HEXA (→silent mutation)
- 11:15, 18 June 2011 (diff | hist) . . (0) . . Mapping SNPs HEXA (→Summary)
- 11:15, 18 June 2011 (diff | hist) . . (+6) . . Mapping SNPs HEXA (→Summary)
- 11:15, 18 June 2011 (diff | hist) . . (+306) . . Mapping SNPs HEXA (→Summary)
- 11:08, 18 June 2011 (diff | hist) . . (+88) . . Mapping SNPs HEXA (→Mutations annotated only in HGMD)
- 11:07, 18 June 2011 (diff | hist) . . (-5) . . Mapping SNPs HEXA (→Mutations annotated in both databases)
- 11:07, 18 June 2011 (diff | hist) . . (+5) . . Mapping SNPs HEXA (→Mutations annotated in both databases)
- 11:06, 18 June 2011 (diff | hist) . . (+351) . . Mapping SNPs HEXA (→Mutations annotated in both databases)
- 10:59, 18 June 2011 (diff | hist) . . (+146) . . Mapping SNPs HEXA (→Comparison of mutations in HGMD and DBSNP)
- 10:57, 18 June 2011 (diff | hist) . . (+361) . . Mapping SNPs HEXA (→Mutations annotated in both databases)
- 10:50, 18 June 2011 (diff | hist) . . (+237) . . Mapping SNPs HEXA (→Comparison of mutations in HGMD and DBSNP)
- 10:44, 18 June 2011 (diff | hist) . . (+533) . . Mapping SNPs HEXA (→Comparison of mutations in HGMD and DBSNP)
- 10:37, 18 June 2011 (diff | hist) . . (+67) . . Mapping SNPs HEXA (→Comparison of mutations in HGMD and SNP-DB)
- 10:33, 18 June 2011 (diff | hist) . . (+139) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and DBSNP)
- 10:31, 18 June 2011 (diff | hist) . . (0) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and DBSNP)
- 10:30, 18 June 2011 (diff | hist) . . (0) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and DBSNP)
- 10:30, 18 June 2011 (diff | hist) . . (+572) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and DBSNP)
- 10:20, 18 June 2011 (diff | hist) . . (+877) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and DBSNP)
- 09:56, 18 June 2011 (diff | hist) . . (+427) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and DBSNP)
- 19:31, 17 June 2011 (diff | hist) . . (+4) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and DBSNP)
- 19:29, 17 June 2011 (diff | hist) . . (+574) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and DBSNP)
- 19:14, 17 June 2011 (diff | hist) . . (+799) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and DBSNP)
- 18:38, 17 June 2011 (diff | hist) . . (+284) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and DBSNP)
- 18:00, 17 June 2011 (diff | hist) . . (-1) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and SNP-DB)
- 17:59, 17 June 2011 (diff | hist) . . (+1) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and SNP-DB)
- 17:59, 17 June 2011 (diff | hist) . . (-4) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and SNP-DB)
- 17:59, 17 June 2011 (diff | hist) . . (+4) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and SNP-DB)
- 17:58, 17 June 2011 (diff | hist) . . (0) . . N File:Barplot aa.png (current)
- 17:58, 17 June 2011 (diff | hist) . . (-1) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and SNP-DB)
- 17:58, 17 June 2011 (diff | hist) . . (+136) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and SNP-DB)
- 17:55, 17 June 2011 (diff | hist) . . (+125) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and SNP-DB)
- 17:53, 17 June 2011 (diff | hist) . . (+527) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and SNP-DB)
- 17:45, 17 June 2011 (diff | hist) . . (+395) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and SNP-DB)
- 17:38, 17 June 2011 (diff | hist) . . (-1) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and SNP-DB)
- 17:37, 17 June 2011 (diff | hist) . . (+1) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and SNP-DB)
- 17:37, 17 June 2011 (diff | hist) . . (+9) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and SNP-DB)
- 17:36, 17 June 2011 (diff | hist) . . (+551) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and SNP-DB)
- 17:27, 17 June 2011 (diff | hist) . . (+190) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and SNP-DB)
- 17:24, 17 June 2011 (diff | hist) . . (+492) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and SNP-DB)
- 17:10, 17 June 2011 (diff | hist) . . (+339) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and SNP-DB)
- 17:05, 17 June 2011 (diff | hist) . . (0) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and SNP-DB)
- 17:05, 17 June 2011 (diff | hist) . . (0) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and SNP-DB)
- 17:05, 17 June 2011 (diff | hist) . . (0) . . N File:Barplot.png (current)
- 17:04, 17 June 2011 (diff | hist) . . (+102) . . Mapping SNPs HEXA (→Statistical comparison of HGMD and SNP-DB)
- 16:55, 17 June 2011 (diff | hist) . . (+49) . . Mapping SNPs HEXA
- 20:58, 13 June 2011 (diff | hist) . . (+3) . . Homology-modelling HEXA (→iTasser)
- 20:57, 13 June 2011 (diff | hist) . . (+18) . . Homology-modelling HEXA (→iTasser)
- 20:56, 13 June 2011 (diff | hist) . . (+317) . . Homology-modelling HEXA (→iTasser)
- 20:51, 13 June 2011 (diff | hist) . . (+256) . . Homology-modelling HEXA (→iTasser)
- 20:47, 13 June 2011 (diff | hist) . . (0) . . N File:3lut acc.png
- 20:46, 13 June 2011 (diff | hist) . . (0) . . N File:3cui acc.png (current)
- 20:46, 13 June 2011 (diff | hist) . . (0) . . N File:3bc9 acc.png
- 20:46, 13 June 2011 (diff | hist) . . (+479) . . Homology-modelling HEXA (→iTasser)
- 20:32, 13 June 2011 (diff | hist) . . (0) . . N File:3lut binding.png
- 20:32, 13 June 2011 (diff | hist) . . (0) . . N File:3cui binding.png (current)
- 20:31, 13 June 2011 (diff | hist) . . (0) . . Homology-modelling HEXA (→iTasser)
- 20:31, 13 June 2011 (diff | hist) . . (0) . . N File:3bc9 binding.png
- 20:30, 13 June 2011 (diff | hist) . . (+439) . . Homology-modelling HEXA (→iTasser)
- 20:22, 13 June 2011 (diff | hist) . . (+149) . . Homology-modelling HEXA (→iTasser)
- 20:21, 13 June 2011 (diff | hist) . . (0) . . File:3lut sec.png (uploaded a new version of "File:3lut sec.png")
- 20:20, 13 June 2011 (diff | hist) . . (0) . . File:3lut sec.png (uploaded a new version of "File:3lut sec.png")
- 20:17, 13 June 2011 (diff | hist) . . (0) . . N File:3lut sec.png
- 20:16, 13 June 2011 (diff | hist) . . (-1) . . Homology-modelling HEXA (→iTasser)
- 20:16, 13 June 2011 (diff | hist) . . (0) . . File:3bc9 sec.png (uploaded a new version of "File:3bc9 sec.png")
- 20:15, 13 June 2011 (diff | hist) . . (+84) . . Homology-modelling HEXA (→iTasser)
- 20:04, 13 June 2011 (diff | hist) . . (+72) . . Homology-modelling HEXA (→iTasser)
- 20:03, 13 June 2011 (diff | hist) . . (0) . . N File:3cui sec.png (current)
- 20:02, 13 June 2011 (diff | hist) . . (+158) . . Homology-modelling HEXA (→iTasser)
- 19:46, 13 June 2011 (diff | hist) . . (+7) . . Homology-modelling HEXA (→iTasser)
- 19:45, 13 June 2011 (diff | hist) . . (0) . . N File:3bc9 sec.png
- 19:45, 13 June 2011 (diff | hist) . . (+516) . . Homology-modelling HEXA (→iTasser)
- 18:21, 13 June 2011 (diff | hist) . . (0) . . Homology-modelling HEXA (→iTasser)
- 18:20, 13 June 2011 (diff | hist) . . (+292) . . Homology-modelling HEXA (→iTasser)
- 18:18, 13 June 2011 (diff | hist) . . (0) . . N File:Model5 3lut.gif (current)
- 18:18, 13 June 2011 (diff | hist) . . (0) . . N File:Model4 3lut.gif (current)
- 18:18, 13 June 2011 (diff | hist) . . (0) . . File:Model3 3lut.gif (uploaded a new version of "File:Model3 3lut.gif") (current)
- 18:17, 13 June 2011 (diff | hist) . . (0) . . N File:Model3 3lut.gif
- 18:17, 13 June 2011 (diff | hist) . . (0) . . N File:Model2 3lut.gif (current)
- 18:17, 13 June 2011 (diff | hist) . . (0) . . N File:Model1 3lut.gif
- 18:14, 13 June 2011 (diff | hist) . . (0) . . N File:Model5 3cui.gif (current)
- 18:14, 13 June 2011 (diff | hist) . . (0) . . N File:Model4 3cui.gif (current)
- 18:14, 13 June 2011 (diff | hist) . . (0) . . N File:Model3 3cui.gif (current)
- 18:13, 13 June 2011 (diff | hist) . . (0) . . N File:Model2 3cui.gif (current)
- 18:13, 13 June 2011 (diff | hist) . . (0) . . N File:Model1 3cui.gif (current)
- 18:13, 13 June 2011 (diff | hist) . . (0) . . N File:Model5 3bc9.gif (current)
- 18:12, 13 June 2011 (diff | hist) . . (0) . . N File:Model4 3bc9.gif (current)
- 18:12, 13 June 2011 (diff | hist) . . (0) . . N File:Model3 3bc9.gif (current)
- 18:12, 13 June 2011 (diff | hist) . . (0) . . N File:Model2 3bc9.gif (current)
- 18:12, 13 June 2011 (diff | hist) . . (0) . . N File:Model1 3bc9.gif
- 18:11, 13 June 2011 (diff | hist) . . (-268) . . Homology-modelling HEXA (→iTasser)
- 18:10, 13 June 2011 (diff | hist) . . (0) . . N File:Model1.gif (current)
- 18:09, 13 June 2011 (diff | hist) . . (+1,583) . . Homology-modelling HEXA (→iTasser)
- 17:59, 13 June 2011 (diff | hist) . . (+15) . . Homology-modelling HEXA (→iTasser)
- 17:58, 13 June 2011 (diff | hist) . . (+7) . . Homology-modelling HEXA (→iTasser)
- 23:37, 6 June 2011 (diff | hist) . . (+4) . . Sequence-based predictions HEXA (→DSSP)
- 23:34, 6 June 2011 (diff | hist) . . (+620) . . Sequence-based predictions HEXA (→DSSP)
- 23:10, 6 June 2011 (diff | hist) . . (+2) . . Sequence-based predictions HEXA (→DSSP)
- 23:09, 6 June 2011 (diff | hist) . . (+759) . . Sequence-based predictions HEXA (→DSSP)
- 22:27, 6 June 2011 (diff | hist) . . (+48) . . Sequence-based predictions HEXA (→DSSP)
- 22:22, 6 June 2011 (diff | hist) . . (+289) . . Sequence-based predictions HEXA (→DSSP)
- 22:19, 6 June 2011 (diff | hist) . . (+3,281) . . Sequence-based predictions HEXA (→DSSP)
- 22:18, 6 June 2011 (diff | hist) . . (-1) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 22:17, 6 June 2011 (diff | hist) . . (-46) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 20:37, 6 June 2011 (diff | hist) . . (+73) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 18:50, 6 June 2011 (diff | hist) . . (-3) . . Sequence-based predictions HEXA (→Jpred3)
- 18:50, 6 June 2011 (diff | hist) . . (0) . . N File:Jpred pic.png (current)
- 18:49, 6 June 2011 (diff | hist) . . (-923) . . Sequence-based predictions HEXA (→Jpred3)
- 18:10, 6 June 2011 (diff | hist) . . (+107) . . Sequence-based predictions HEXA (→Jpred3)
- 18:04, 6 June 2011 (diff | hist) . . (-118) . . Sequence-based predictions HEXA (→Jpred3)
- 18:04, 6 June 2011 (diff | hist) . . (+1,188) . . Sequence-based predictions HEXA (→Jpred3)
- 17:54, 6 June 2011 (diff | hist) . . (+231) . . Sequence-based predictions HEXA (→PSIPRED)
- 17:49, 6 June 2011 (diff | hist) . . (-2,486) . . Sequence-based predictions HEXA (→PSIPRED)
- 17:49, 6 June 2011 (diff | hist) . . (+2,410) . . Sequence-based predictions HEXA (→PSIPRED)
- 17:47, 6 June 2011 (diff | hist) . . (+76) . . Sequence-based predictions HEXA (→PSIPRED)
- 17:38, 6 June 2011 (diff | hist) . . (+3) . . Sequence-based predictions HEXA (→PSIPRED)
- 17:37, 6 June 2011 (diff | hist) . . (+4) . . Sequence-based predictions HEXA (→PSIPRED)
- 17:37, 6 June 2011 (diff | hist) . . (0) . . N File:Psipred3.png (current)
- 17:36, 6 June 2011 (diff | hist) . . (0) . . N File:Psipred2.png (current)
- 17:35, 6 June 2011 (diff | hist) . . (0) . . N File:Psipred1.png (current)
- 17:35, 6 June 2011 (diff | hist) . . (+234) . . Sequence-based predictions HEXA (→PSIPRED)
- 17:25, 6 June 2011 (diff | hist) . . (-4) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 17:19, 6 June 2011 (diff | hist) . . (+49) . . Sequence-based predictions HEXA (→Secondary Structure prediction)
- 17:17, 6 June 2011 (diff | hist) . . (-5) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 17:16, 6 June 2011 (diff | hist) . . (+131) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 17:12, 6 June 2011 (diff | hist) . . (+348) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 17:04, 6 June 2011 (diff | hist) . . (+438) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 16:50, 6 June 2011 (diff | hist) . . (+29) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 16:49, 6 June 2011 (diff | hist) . . (+484) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 16:45, 6 June 2011 (diff | hist) . . (+18) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 12:50, 6 June 2011 (diff | hist) . . (+167) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 12:47, 6 June 2011 (diff | hist) . . (+170) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 17:46, 5 June 2011 (diff | hist) . . (+436) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 17:40, 5 June 2011 (diff | hist) . . (+313) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 17:32, 5 June 2011 (diff | hist) . . (+429) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 17:27, 5 June 2011 (diff | hist) . . (+367) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 17:19, 5 June 2011 (diff | hist) . . (-1) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 17:19, 5 June 2011 (diff | hist) . . (+211) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 17:12, 5 June 2011 (diff | hist) . . (+26) . . Sequence-based predictions HEXA (→Secondary Structure Prediction)
- 21:51, 23 May 2011 (diff | hist) . . (+9) . . Sequence Alignments HEXA (→Statistic results)
- 21:50, 23 May 2011 (diff | hist) . . (0) . . Sequence Alignments HEXA (→Statistic results)
- 20:07, 23 May 2011 (diff | hist) . . (+1) . . Sequence Alignments HEXA (→Functional residues)
- 20:04, 23 May 2011 (diff | hist) . . (0) . . Sequence Alignments HEXA (→Gaps)
- 20:04, 23 May 2011 (diff | hist) . . (0) . . Sequence Alignments HEXA (→Gaps)
- 20:03, 23 May 2011 (diff | hist) . . (-6) . . Sequence Alignments HEXA (→Gaps)
- 20:03, 23 May 2011 (diff | hist) . . (0) . . N File:Secondary.png (current)
- 20:02, 23 May 2011 (diff | hist) . . (+180) . . Sequence Alignments HEXA (→Gaps)
- 19:18, 23 May 2011 (diff | hist) . . (+334) . . Sequence Alignments HEXA (→Gaps)
- 19:14, 23 May 2011 (diff | hist) . . (+1) . . Sequence Alignments HEXA (→Functional residues)
- 19:10, 23 May 2011 (diff | hist) . . (-40) . . Sequence Alignments HEXA (→Gaps)
- 19:04, 23 May 2011 (diff | hist) . . (+4) . . Sequence Alignments HEXA (→Statistic results)
- 19:00, 23 May 2011 (diff | hist) . . (+13) . . Sequence Alignments HEXA (→Statistic results)
- 18:55, 23 May 2011 (diff | hist) . . (+123) . . Sequence Alignments HEXA (→Statistic results)
- 18:53, 23 May 2011 (diff | hist) . . (+79) . . Sequence Alignments HEXA (→Multiple Alignments)
- 18:51, 23 May 2011 (diff | hist) . . (+1,840) . . Sequence Alignments HEXA (→Statistic results)
- 16:43, 23 May 2011 (diff | hist) . . (-165) . . Sequence Alignments HEXA (→Statistic results)
- 16:42, 23 May 2011 (diff | hist) . . (+702) . . Sequence Alignments HEXA (→Statistic results)
- 15:55, 23 May 2011 (diff | hist) . . (+117) . . Sequence Alignments HEXA (→Statistic results)
- 15:44, 23 May 2011 (diff | hist) . . (+10) . . Sequence Alignments HEXA
- 20:46, 14 May 2011 (diff | hist) . . (+7) . . Tay-Sachs Disease 2011 (→Biochemical disease mechanism)
- 20:45, 14 May 2011 (diff | hist) . . (+95) . . Tay-Sachs Disease 2011 (→Biochemical disease mechanism)
- 20:43, 14 May 2011 (diff | hist) . . (-1) . . Tay-Sachs Disease 2011 (→Biochemical disease mechanism)
- 20:41, 14 May 2011 (diff | hist) . . (-93) . . Tay-Sachs Disease 2011 (→Biochemical disease mechanism)
- 20:32, 14 May 2011 (diff | hist) . . (+463) . . Tay-Sachs Disease 2011 (→Biochemical disease mechanism)
- 20:31, 14 May 2011 (diff | hist) . . (0) . . N File:Hexa pathway.png (current)
- 12:50, 14 May 2011 (diff | hist) . . (+80) . . Tay-Sachs Disease 2011 (→Mutations)
- 12:39, 14 May 2011 (diff | hist) . . (+6) . . Tay-Sachs Disease 2011 (→Biochemical disease mechanism)
- 12:33, 14 May 2011 (diff | hist) . . (+5) . . Tay-Sachs Disease 2011 (→Biochemical disease mechanism)
- 12:28, 14 May 2011 (diff | hist) . . (+58) . . Tay-Sachs Disease 2011 (→Biochemical disease mechanism)
- 12:27, 14 May 2011 (diff | hist) . . (+57) . . Tay-Sachs Disease 2011 (→Biochemical disease mechanism)
- 12:25, 14 May 2011 (diff | hist) . . (0) . . N File:Hsa00604.png (current)
- 12:24, 14 May 2011 (diff | hist) . . (+145) . . Tay-Sachs Disease 2011 (→Biochemical disease mechanism)
- 12:00, 14 May 2011 (diff | hist) . . (+16) . . Tay-Sachs Disease 2011 (→Mutations)
- 11:56, 14 May 2011 (diff | hist) . . (-28) . . Tay-Sachs Disease 2011 (→Beta-Hexosaminidase A)
- 11:54, 14 May 2011 (diff | hist) . . (0) . . N File:2gjx bio r 500.jpg (current)
- 11:53, 14 May 2011 (diff | hist) . . (+121) . . Tay-Sachs Disease 2011 (→Mutations)
- 20:47, 13 May 2011 (diff | hist) . . (+404) . . Example sequence (current)
- 20:46, 13 May 2011 (diff | hist) . . (-651) . . Example sequence (→Fasta Sequence)
- 20:44, 13 May 2011 (diff | hist) . . (+663) . . N Beta-hexosaminidase subunit alpha (New page: == Fasta Sequence == <code>>>sp|P06865|HEXA_HUMAN Beta-hexosaminidase subunit alpha OS=Homo sapiens GN=HEXA PE=1 SV=2 MTSSRLWFSLLLAAAFAGRATALWPWPQNFQTSDQRYVLYPNNFQFQYDVSSAAQPGCSV LDEAFQRY...)
- 20:42, 13 May 2011 (diff | hist) . . (-200) . . Tay-Sachs Disease 2011 (→Reference sequence)
- 20:40, 13 May 2011 (diff | hist) . . (+100) . . Example sequence
- 16:55, 13 May 2011 (diff | hist) . . (-2) . . Tay-Sachs Disease 2011 (→Biochemical disease mechanism)
- 16:54, 13 May 2011 (diff | hist) . . (+88) . . Tay-Sachs Disease 2011 (→Biochemical disease mechanism)
- 16:47, 13 May 2011 (diff | hist) . . (+7) . . Tay-Sachs Disease 2011 (→Phenotype)
- 17:19, 12 May 2011 (diff | hist) . . (+641) . . Tay-Sachs Disease 2011 (→Mutations)
- 17:08, 12 May 2011 (diff | hist) . . (-1) . . Tay-Sachs Disease 2011 (→Biochemical disease mechanism)
- 17:08, 12 May 2011 (diff | hist) . . (+296) . . Tay-Sachs Disease 2011 (→Biochemical disease mechanism)
- 16:53, 12 May 2011 (diff | hist) . . (+46) . . Tay-Sachs Disease 2011 (→Cross-references)
- 16:52, 12 May 2011 (diff | hist) . . (-2) . . Tay-Sachs Disease 2011 (→Phenotype)
- 16:50, 12 May 2011 (diff | hist) . . (+2) . . Tay-Sachs Disease 2011 (→Phenotype)
- 16:48, 12 May 2011 (diff | hist) . . (+5) . . Tay-Sachs Disease 2011 (→Phenotype)
- 16:47, 12 May 2011 (diff | hist) . . (+903) . . Tay-Sachs Disease 2011 (→Phenotype)
- 16:32, 12 May 2011 (diff | hist) . . (+498) . . Tay-Sachs Disease 2011 (→Summary)
- 16:23, 12 May 2011 (diff | hist) . . (+1,133) . . Tay-Sachs Disease 2011
- 16:22, 12 May 2011 (diff | hist) . . (+294) . . Tay-Sachs Disease 2011 (→Phenotype)
- 16:20, 12 May 2011 (diff | hist) . . (+32) . . Tay-Sachs Disease 2011
- 16:19, 12 May 2011 (diff | hist) . . (+30) . . N Tay-Sachs Disease 2011 (New page: '''== Tay-Sachs Disease ==''')
- 16:17, 12 May 2011 (diff | hist) . . (+25) . . Protein Structure and Function Analysis (version: SS 2011) (→Diseases)
