User contributions
From Bioinformatikpedia
(newest | oldest) View (newer 500 | older 500) (20 | 50 | 100 | 250 | 500)
- 23:56, 10 June 2011 (diff | hist) . . (+181) . . Task 4: Homology based structure predictions (→iTasser)
- 23:43, 10 June 2011 (diff | hist) . . (+394) . . Task 4: Homology based structure predictions (→Homology modelling with iTasser)
- 23:34, 10 June 2011 (diff | hist) . . (-53) . . Task 4: Homology based structure predictions (→Homology modelling with iTasser)
- 23:31, 10 June 2011 (diff | hist) . . (-9) . . Task 4: Homology based structure predictions (→Alignment Mode: Modeling with adjusted alignment 1ltz_A (<40%))
- 23:27, 10 June 2011 (diff | hist) . . (+2) . . Task 4: Homology based structure predictions (→Alignment Mode: Modeling with adjusted alignment 1toh_A (>40%))
- 23:25, 10 June 2011 (diff | hist) . . (-14) . . Task 4: Homology based structure predictions (→Alignment Mode: Modeling with adjusted alignment 1toh_A (>40%))
- 23:17, 10 June 2011 (diff | hist) . . (+3,575) . . Task 4: Homology based structure predictions (→Swissmodel)
- 23:00, 10 June 2011 (diff | hist) . . (0) . . N File:Local quality estimation 1toh imp template annolea qmean gromos.png (current)
- 23:00, 10 June 2011 (diff | hist) . . (0) . . N File:Local quality estimation 1phz imp template annolea qmean gromos.png (current)
- 22:59, 10 June 2011 (diff | hist) . . (0) . . N File:Local quality estimation 1ltz imp template annolea qmean gromos.png (current)
- 22:57, 10 June 2011 (diff | hist) . . (0) . . N File:QMEAN plots energy profile plots 1ltz imp template.pdb local energy profile QMEANlocal.png (current)
- 22:56, 10 June 2011 (diff | hist) . . (0) . . N File:QMEAN plots energy profile plots 1phz imp template.pdb local energy profile QMEANlocal.png (current)
- 22:56, 10 June 2011 (diff | hist) . . (0) . . N File:QMEAN plots energy profile plots 1toh imp template.pdb local energy profile QMEANlocal.png (current)
- 22:55, 10 June 2011 (diff | hist) . . (0) . . N File:1toh imp template coloring by residue error.jpeg (current)
- 22:50, 10 June 2011 (diff | hist) . . (0) . . N File:1phz imp template coloring by residue error.jpeg (current)
- 22:49, 10 June 2011 (diff | hist) . . (0) . . N File:1ltz imp template coloring by residue error.jpeg (current)
- 22:48, 10 June 2011 (diff | hist) . . (0) . . N File:QMEAN plots 1ltz imp template plot.png slider.png (current)
- 22:48, 10 June 2011 (diff | hist) . . (0) . . N File:QMEAN plots 1phz imp template plot.png slider.png (current)
- 22:48, 10 June 2011 (diff | hist) . . (0) . . N File:QMEAN plots 1toh imp template plot.png slider.png (current)
- 22:47, 10 June 2011 (diff | hist) . . (0) . . N File:QMEAN plots 1toh imp template pdb plot.png density plot.png (current)
- 22:45, 10 June 2011 (diff | hist) . . (0) . . N File:QMEAN plots 1ltz imp template pdb plot.png density plot.png (current)
- 22:45, 10 June 2011 (diff | hist) . . (0) . . N File:QMEAN plots 1phz imp template pdb plot.png density plot.png (current)
- 22:44, 10 June 2011 (diff | hist) . . (0) . . N File:QMEAN plots 1toh imp template.pdb plot.png (current)
- 22:43, 10 June 2011 (diff | hist) . . (0) . . N File:QMEAN plots 1ltz imp template.pdb plot.png (current)
- 22:43, 10 June 2011 (diff | hist) . . (0) . . N File:QMEAN plots 1phz imp template.pdb plot.png (current)
- 14:33, 10 June 2011 (diff | hist) . . (+373) . . Task 4: Homology based structure predictions (→Comparison to experimental structure)
- 14:27, 10 June 2011 (diff | hist) . . (0) . . m Automated Evaluation of Homoloy Models (moved Pah hom autom eval to Automated Evaluation of Homoloy Models: former title was kind of weird)
- 14:27, 10 June 2011 (diff | hist) . . (+52) . . N Pah hom autom eval (moved Pah hom autom eval to Automated Evaluation of Homoloy Models: former title was kind of weird) (current)
- 14:25, 10 June 2011 (diff | hist) . . (+893) . . Automated Evaluation of Homoloy Models
- 14:21, 10 June 2011 (diff | hist) . . (+19) . . Automated Evaluation of Homoloy Models
- 14:21, 10 June 2011 (diff | hist) . . (+5,508) . . N Automated Evaluation of Homoloy Models (Created page with "=Source code for Eval.java= <code> import java.io.BufferedReader; import java.io.BufferedWriter; import java.io.File; import java.io.FileNotFoundException; import java.io.FileRea…")
- 14:20, 10 June 2011 (diff | hist) . . (0) . . Task 4: Homology based structure predictions (→Comparison to experimental structure)
- 14:19, 10 June 2011 (diff | hist) . . (+35) . . Task 4: Homology based structure predictions (→Comparison to experimental structure)
- 14:15, 10 June 2011 (diff | hist) . . (-401) . . Task 4: Homology based structure predictions (→Homology modelling with Modeller)
- 14:06, 10 June 2011 (diff | hist) . . (+89) . . Task 4: Homology based structure predictions (→Alignment Refinement)
- 14:05, 10 June 2011 (diff | hist) . . (+12,425) . . Task 4: Homology based structure predictions (→Calculation of models)
- 13:46, 10 June 2011 (diff | hist) . . (-657) . . Task 4: Homology based structure predictions (→Homology modelling with Modeller)
- 13:43, 10 June 2011 (diff | hist) . . (+46) . . Task 4: Homology based structure predictions (→Modeller)
- 13:35, 10 June 2011 (diff | hist) . . (+1) . . Task 4: Homology based structure predictions (→Homology modelling with Modeller)
- 10:50, 10 June 2011 (diff | hist) . . (+84) . . Task 4: Homology based structure predictions (→Modeller)
- 10:32, 10 June 2011 (diff | hist) . . (0) . . Task 4: Homology based structure predictions (→Modeller)
- 10:30, 10 June 2011 (diff | hist) . . (-39) . . Task 4: Homology based structure predictions (→Modeller)
- 10:24, 10 June 2011 (diff | hist) . . (+1) . . Task 4: Homology based structure predictions (→Standard Workflow)
- 10:10, 10 June 2011 (diff | hist) . . (+78) . . Task 4: Homology based structure predictions (→Modeller)
- 10:09, 10 June 2011 (diff | hist) . . (+1,737) . . Task 4: Homology based structure predictions (→Comparison to experimental structure)
- 10:06, 10 June 2011 (diff | hist) . . (0) . . Task 4: Homology based structure predictions (→Comparison to experimental structure)
- 10:06, 10 June 2011 (diff | hist) . . (+11) . . Task 4: Homology based structure predictions (→Modeller)
- 10:04, 10 June 2011 (diff | hist) . . (+546) . . Task 4: Homology based structure predictions
- 19:15, 8 June 2011 (diff | hist) . . (-1) . . Task 4: Homology based structure predictions (→Homology modelling with Modeller)
- 19:04, 8 June 2011 (diff | hist) . . (+2) . . Task 4: Homology based structure predictions (→Homology modelling with Modeller)
- 19:04, 8 June 2011 (diff | hist) . . (+17) . . Task 4: Homology based structure predictions (→Homology modelling with Modeller)
- 18:59, 8 June 2011 (diff | hist) . . (+499) . . Task 4: Homology based structure predictions (→Homology modelling with iTasser)
- 18:48, 8 June 2011 (diff | hist) . . (-29) . . Task 4: Homology based structure predictions (→Task description)
- 18:46, 8 June 2011 (diff | hist) . . (+599) . . Task 4: Homology based structure predictions (→Task description)
- 18:18, 8 June 2011 (diff | hist) . . (+443) . . Task 4: Homology based structure predictions (→Homology modelling with Modeller)
- 14:48, 8 June 2011 (diff | hist) . . (+215) . . Task 4: Homology based structure predictions (→Homology modelling with Modeller)
- 14:41, 8 June 2011 (diff | hist) . . (+401) . . Task 4: Homology based structure predictions (→Homology modelling with Modeller)
- 14:36, 8 June 2011 (diff | hist) . . (-6) . . Task 4: Homology based structure predictions (→Homology modelling with Modeller)
- 14:34, 8 June 2011 (diff | hist) . . (+1,528) . . Task 4: Homology based structure predictions (→Homology modelling with Modeller)
- 14:04, 8 June 2011 (diff | hist) . . (+1) . . Task 4: Homology based structure predictions (→Homology modelling with Modeller)
- 14:03, 8 June 2011 (diff | hist) . . (+914) . . Task 4: Homology based structure predictions (→Homology modelling with Modeller)
- 13:52, 8 June 2011 (diff | hist) . . (+364) . . Task 4: Homology based structure predictions (→Homology modelling with Modeller)
- 13:46, 8 June 2011 (diff | hist) . . (+367) . . Task 4: Homology based structure predictions (→Homology modelling with Modeller)
- 13:46, 8 June 2011 (diff | hist) . . (0) . . Resource software (→Python)
- 13:45, 8 June 2011 (diff | hist) . . (+194) . . Resource software (→Modeller)
- 13:43, 8 June 2011 (diff | hist) . . (-5) . . Resource software (→Modeller)
- 13:42, 8 June 2011 (diff | hist) . . (+5) . . Resource software (→Modeller)
- 13:42, 8 June 2011 (diff | hist) . . (+22) . . Resource software (→Modeller)
- 13:39, 8 June 2011 (diff | hist) . . (+650) . . Resource software
- 13:04, 8 June 2011 (diff | hist) . . (+1) . . Phenylketonuria 2011
- 12:59, 8 June 2011 (diff | hist) . . (+21) . . Phenylketonuria 2011 (→Mutations)
- 12:57, 8 June 2011 (diff | hist) . . (-4) . . Phenylketonuria 2011 (→The PAH gene)
- 12:54, 8 June 2011 (diff | hist) . . (-2) . . Phenylketonuria 2011 (→Phenotype)
- 12:53, 8 June 2011 (diff | hist) . . (+14) . . Phenylketonuria 2011 (→Treatment of phenylketonuria)
- 12:51, 8 June 2011 (diff | hist) . . (+2) . . Phenylketonuria 2011 (→Diagnosis of phenylketonuria)
- 12:49, 8 June 2011 (diff | hist) . . (+3) . . Phenylketonuria 2011 (→Biochemical disease mechanism)
- 12:47, 8 June 2011 (diff | hist) . . (+2) . . Phenylketonuria 2011 (→Phenotype)
- 12:42, 8 June 2011 (diff | hist) . . (-4) . . Phenylketonuria 2011 (→Summary)
- 17:19, 7 June 2011 (diff | hist) . . (+789) . . Resource software
- 09:15, 7 June 2011 (diff | hist) . . (-50) . . Task 3: Sequence-based predictions (→Discussion)
- 08:10, 7 June 2011 (diff | hist) . . (-382) . . Task 3: Sequence-based predictions (→Discussion)
- 07:59, 7 June 2011 (diff | hist) . . (0) . . Task 3: Sequence-based predictions (→DSSP)
- 07:58, 7 June 2011 (diff | hist) . . (0) . . Task 3: Sequence-based predictions (→Result)
- 22:25, 6 June 2011 (diff | hist) . . (+202) . . Poodle (→Poodle-W) (current)
- 22:12, 6 June 2011 (diff | hist) . . (+259) . . Poodle (→Poodle-S)
- 21:59, 6 June 2011 (diff | hist) . . (+304) . . Poodle (→Poodle-L)
- 21:52, 6 June 2011 (diff | hist) . . (+1) . . Poodle (→Poodle-L)
- 21:52, 6 June 2011 (diff | hist) . . (-18) . . Poodle (→Poodle)
- 21:50, 6 June 2011 (diff | hist) . . (+462) . . Poodle (→Poodle)
- 21:40, 6 June 2011 (diff | hist) . . (+1,123) . . N Poodle (Created page with "=Poodle= Poodle is a set of tools for the prediction of the secondary structures. The different programs uses different machine learning approaches. ==Poodle-L== {| style="f…")
- 21:21, 6 June 2011 (diff | hist) . . (-10) . . Jpred (→Jnet) (current)
- 21:21, 6 June 2011 (diff | hist) . . (0) . . Jpred (→Jnet)
- 21:21, 6 June 2011 (diff | hist) . . (-30) . . Jpred (→Jnet)
- 21:04, 6 June 2011 (diff | hist) . . (-7) . . Task 3: Sequence-based predictions (→PSIPRED)
- 21:01, 6 June 2011 (diff | hist) . . (+15) . . Task 3: Sequence-based predictions (→Discussion)
- 20:54, 6 June 2011 (diff | hist) . . (-112) . . Task 3: Sequence-based predictions (→Discussion)
- 20:52, 6 June 2011 (diff | hist) . . (+124) . . Task 3: Sequence-based predictions (→Discussion)
- 20:49, 6 June 2011 (diff | hist) . . (0) . . Task 3: Sequence-based predictions (→Discussion)
- 20:45, 6 June 2011 (diff | hist) . . (+1,594) . . Task 3: Sequence-based predictions (→Task 3.2: Prediction of disordered regions)
- 19:56, 6 June 2011 (diff | hist) . . (+2,060) . . Task 3: Sequence-based predictions (→Result)
- 19:53, 6 June 2011 (diff | hist) . . (+835) . . Task 3: Sequence-based predictions (→Result)
- 19:36, 6 June 2011 (diff | hist) . . (+254) . . Task 3: Sequence-based predictions (→Task 3.2: Prediction of disordered regions)
- 19:32, 6 June 2011 (diff | hist) . . (+24) . . Task 3: Sequence-based predictions (→Discussion)
- 19:31, 6 June 2011 (diff | hist) . . (+186) . . Task 3: Sequence-based predictions (→Discussion)
- 19:24, 6 June 2011 (diff | hist) . . (+527) . . Task 3: Sequence-based predictions (→Discussion)
- 18:29, 6 June 2011 (diff | hist) . . (+1,534) . . Task 3: Sequence-based predictions
- 20:11, 5 June 2011 (diff | hist) . . (+38) . . Task 3: Sequence-based predictions (→META-Disorder)
- 20:04, 5 June 2011 (diff | hist) . . (+858) . . N Iupred (Created page with "=IUPred= ==Basic Information== {| style="float: right; border: 1px solid #BBB; margin: .46em 0 0 .2em;" ! Author | Zsuzsanna Dosztányia, Veronika Csizmóka, Péter Tompaa, Ist…") (current)
- 19:41, 5 June 2011 (diff | hist) . . (-1) . . Disopred (current)
- 19:38, 5 June 2011 (diff | hist) . . (+22) . . Disopred
- 19:37, 5 June 2011 (diff | hist) . . (+737) . . Disopred
- 19:19, 5 June 2011 (diff | hist) . . (-45) . . Disopred
- 19:09, 5 June 2011 (diff | hist) . . (+387) . . Disopred
- 14:15, 3 June 2011 (diff | hist) . . (+3,506) . . Task 3: Sequence-based predictions (→Result)
- 14:07, 3 June 2011 (diff | hist) . . (+90) . . Task 3: Sequence-based predictions (→Result)
- 14:06, 3 June 2011 (diff | hist) . . (-20) . . Task 3: Sequence-based predictions (→Result)
- 14:04, 3 June 2011 (diff | hist) . . (+13,520) . . Task 3: Sequence-based predictions (→Task 3.2: Prediction of disordered regions)
- 12:55, 3 June 2011 (diff | hist) . . (+168) . . Task 3: Sequence-based predictions
- 12:22, 3 June 2011 (diff | hist) . . (-6) . . Task 3: Sequence-based predictions (→Result)
- 12:21, 3 June 2011 (diff | hist) . . (+14) . . Task 3: Sequence-based predictions (→Result)
- 12:19, 3 June 2011 (diff | hist) . . (+26) . . Task 3: Sequence-based predictions (→Result)
- 12:17, 3 June 2011 (diff | hist) . . (-14) . . Task 3: Sequence-based predictions (→Result)
- 12:08, 3 June 2011 (diff | hist) . . (+2) . . Task 3: Sequence-based predictions (→Result)
- 12:08, 3 June 2011 (diff | hist) . . (+681) . . Task 3: Sequence-based predictions (→Result)
- 11:43, 3 June 2011 (diff | hist) . . (+1,638) . . Task 3: Sequence-based predictions
- 21:10, 2 June 2011 (diff | hist) . . (0) . . Dssp (→Details) (current)
- 21:10, 2 June 2011 (diff | hist) . . (-19) . . Dssp
- 21:09, 2 June 2011 (diff | hist) . . (+1,182) . . N Dssp (Created page with "=DSSP - Define Secondary Structure of Proteins= ==Basic Information== {| style="float: right; border: 1px solid #BBB; margin: .46em 0 0 .2em;" ! Author | Kabsch W, Sander C. |- …")
- 20:56, 2 June 2011 (diff | hist) . . (0) . . Jpred
- 20:56, 2 June 2011 (diff | hist) . . (-71) . . Jpred
- 20:55, 2 June 2011 (diff | hist) . . (+1,119) . . N Jpred (Created page with "=Jpred= ==Basic Information== {| style="float: right; border: 1px solid #BBB; margin: .46em 0 0 .2em;" | Jnet |- ! Author | James A. Cuff, Geoffrey J. Barton |- ! Year | 2000 |-…")
- 20:38, 2 June 2011 (diff | hist) . . (+24) . . Task 3: Sequence-based predictions
- 20:37, 2 June 2011 (diff | hist) . . (+875) . . Task 3: Sequence-based predictions
- 20:33, 2 June 2011 (diff | hist) . . (+412) . . Psipred (→Basic Information) (current)
- 20:24, 2 June 2011 (diff | hist) . . (0) . . Psipred (→Basic Information)
- 20:24, 2 June 2011 (diff | hist) . . (-14) . . Psipred (→Basic Information)
- 20:23, 2 June 2011 (diff | hist) . . (+1,576) . . Psipred
- 20:02, 2 June 2011 (diff | hist) . . (+79) . . Psipred
- 19:59, 2 June 2011 (diff | hist) . . (-2) . . Psipred
- 19:59, 2 June 2011 (diff | hist) . . (+136) . . Psipred
- 19:53, 2 June 2011 (diff | hist) . . (+27) . . Psipred
- 19:51, 2 June 2011 (diff | hist) . . (+33) . . Task 3 - Sequence-based predictions 2011
- 13:47, 24 May 2011 (diff | hist) . . (-184) . . Psipred
- 13:08, 24 May 2011 (diff | hist) . . (+266) . . Psipred
- 12:48, 24 May 2011 (diff | hist) . . (+13) . . Psipred
- 12:47, 24 May 2011 (diff | hist) . . (+17) . . Psipred
- 12:46, 24 May 2011 (diff | hist) . . (+4) . . Psipred
- 12:46, 24 May 2011 (diff | hist) . . (+68) . . Psipred
- 12:45, 24 May 2011 (diff | hist) . . (+583) . . N Psipred (Created page with "=PSIPRED= ==running locally== Change in /apps/psipred_3.2/runpsipred the following lines: <code> # The name of the BLAST data bank set dbname = /data/blast/swiss/uniprot_sprot.…")
- 12:42, 24 May 2011 (diff | hist) . . (+1) . . Task 3 - Sequence-based predictions 2011 (→1. Secondary structure prediction)
- 12:41, 24 May 2011 (diff | hist) . . (+58) . . Task 3 - Sequence-based predictions 2011 (→1. Secondary structure prediction)
- 21:33, 23 May 2011 (diff | hist) . . (-406) . . Task 2: Sequence alignments (sequence searches and multiple alignments) (→Overlap)
- 21:23, 23 May 2011 (diff | hist) . . (+1) . . Task 2: Sequence alignments (sequence searches and multiple alignments) (→Overlap)
- 21:22, 23 May 2011 (diff | hist) . . (+109) . . Task 2: Sequence alignments (sequence searches and multiple alignments) (→Overlap)
- 21:21, 23 May 2011 (diff | hist) . . (+1,007) . . Task 2: Sequence alignments (sequence searches and multiple alignments)
- 20:56, 23 May 2011 (diff | hist) . . (+17) . . Task 2: Sequence alignments (sequence searches and multiple alignments)
- 20:55, 23 May 2011 (diff | hist) . . (+83) . . Task 2: Sequence alignments (sequence searches and multiple alignments)
- 20:49, 23 May 2011 (diff | hist) . . (+1,750) . . Task 2: Sequence alignments (sequence searches and multiple alignments) (→Comparing the Results)
- 19:43, 23 May 2011 (diff | hist) . . (-38) . . Task 2: Sequence alignments (sequence searches and multiple alignments) (→Summary)
- 19:36, 23 May 2011 (diff | hist) . . (+2,709) . . Task 2: Sequence alignments (sequence searches and multiple alignments) (→Comparing the Results)
- 18:22, 23 May 2011 (diff | hist) . . (+78) . . Task 2: Sequence alignments (sequence searches and multiple alignments)
- 18:17, 23 May 2011 (diff | hist) . . (+36) . . Task 2: Sequence alignments (sequence searches and multiple alignments)
- 18:15, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi simple.hhsearch identity.png (current)
- 18:15, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi simple.hhsearch score.png (current)
- 18:14, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi simple.hhsearch coverage.png (current)
- 18:14, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e10E-6 i3.hhsearch identity.png (current)
- 18:14, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e10E-6 i3.hhsearch score.png (current)
- 18:13, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e10E-6 i3.hhsearch coverage.png (current)
- 18:13, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e005 i3.hhsearch identity.png (current)
- 18:12, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e005 i3.hhsearch score.png (current)
- 18:12, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi e005 i3.hhsearch coverage.png (uploaded a new version of "File:Pah psi e005 i3.hhsearch coverage.png") (current)
- 18:11, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi e005 i3.hhsearch coverage.png (uploaded a new version of "File:Pah psi e005 i3.hhsearch coverage.png")
- 18:11, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e005 i3.hhsearch coverage.png
- 18:10, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e005 i5.hhsearch identity.png (current)
- 18:09, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e005 i5.hhsearch score.png (current)
- 18:09, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e005 i5.hhsearch coverage.png (current)
- 18:09, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e10E-6 i5.hhsearch identity.png (current)
- 18:08, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e10E-6 i5.hhsearch score.png (current)
- 18:07, 23 May 2011 (diff | hist) . . (+1,147) . . Task 2: Sequence alignments (sequence searches and multiple alignments) (→HHSearch)
- 17:56, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e10E-6 i5.hhsearch coverage.png (current)
- 17:51, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi 005 i5 identity.png (uploaded a new version of "File:Pah psi 005 i5 identity.png") (current)
- 17:51, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi 005 i5 coverage.png (uploaded a new version of "File:Pah psi 005 i5 coverage.png") (current)
- 17:49, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi 005 i3 identity.png (uploaded a new version of "File:Pah psi 005 i3 identity.png") (current)
- 17:48, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi 005 i3 coverage.png (uploaded a new version of "File:Pah psi 005 i3 coverage.png") (current)
- 17:46, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi 005 i3 coverage.png (uploaded a new version of "File:Pah psi 005 i3 coverage.png")
- 17:44, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi 10E-6 i3 coverage.png (uploaded a new version of "File:Pah psi 10E-6 i3 coverage.png") (current)
- 17:43, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi 10E-6 i3 similarity.png (uploaded a new version of "File:Pah psi 10E-6 i3 similarity.png") (current)
- 17:42, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi 10E-6 i3 score.png (uploaded a new version of "File:Pah psi 10E-6 i3 score.png") (current)
- 17:40, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi 005 i3 identity.png
- 17:40, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi 005 i3 score.png (current)
- 17:39, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi 005 i3 coverage.png
- 17:38, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi 10E-6 i5 identity.png (current)
- 17:38, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi 10E-6 i5 score.png (current)
- 17:38, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi 10E-6 i5 coverage.png (current)
- 17:36, 23 May 2011 (diff | hist) . . (+31) . . N File:Pah psi 005 i3.blast identity.png (PAH PSI-Blast Search - Identity) (current)
- 17:33, 23 May 2011 (diff | hist) . . (+31) . . N File:Pah psi 10E-6 i3.blast coverage.png (PAH PSI-Blast Search - Identity) (current)
- 17:32, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi 10E-6 i3 identity.png (uploaded a new version of "File:Pah psi 10E-6 i3 identity.png": PAH PSI-Blast Search - Identity) (current)
- 17:17, 23 May 2011 (diff | hist) . . (+31) . . N File:Pah psi 10E-6 i3 identity.png (PAH PSI-Blast Search - Identity)
- 17:16, 23 May 2011 (diff | hist) . . (+31) . . N File:Pah psi 005 i5 identity.png (PAH PSI-Blast Search - Identity)
- 17:15, 23 May 2011 (diff | hist) . . (+28) . . N File:Pah psi 005 i5 score.png (PAH PSI-Blast Search - Score) (current)
- 17:15, 23 May 2011 (diff | hist) . . (+31) . . N File:Pah psi 005 i5 coverage.png (PAH PSI-Blast Search - Coverage)
- 17:14, 23 May 2011 (diff | hist) . . (+33) . . N File:Pah psi 10E-6 i3 similarity.png (PAH PSI-Blast Search - Similarity)
- 17:14, 23 May 2011 (diff | hist) . . (+28) . . N File:Pah psi 10E-6 i3 score.png (PAH PSI-Blast Search - Score)
- 17:12, 23 May 2011 (diff | hist) . . (+1,414) . . Task 2: Sequence alignments (sequence searches and multiple alignments) (→PSI-BLAST)
- 17:10, 23 May 2011 (diff | hist) . . (+31) . . N File:Pah psi 10E-6 i3 coverage.png (PAH PSI-Blast Search - Coverage)
- 16:56, 23 May 2011 (diff | hist) . . (+154) . . Task 2: Sequence alignments (sequence searches and multiple alignments) (→Results)
- 16:56, 23 May 2011 (diff | hist) . . (+27) . . N File:Pah.fasta search identity.png (PAH FASTA Search - Identity) (current)
- 16:55, 23 May 2011 (diff | hist) . . (+27) . . N File:Pah.fasta search score.png (PAH FASTA Search - Coverage) (current)
- 16:54, 23 May 2011 (diff | hist) . . (0) . . File:Pah.fasta search coverage.png (current)
- 16:54, 23 May 2011 (diff | hist) . . (+27) . . N File:Pah.fasta search coverage.png (PAH BLAST Search - Coverage)
- 16:52, 23 May 2011 (diff | hist) . . (+139) . . Task 2: Sequence alignments (sequence searches and multiple alignments) (→Results)
- 16:51, 23 May 2011 (diff | hist) . . (+27) . . N File:Pah.blast identity.png (PAH BLAST Search - Identity) (current)
- 16:50, 23 May 2011 (diff | hist) . . (+24) . . N File:Pah.blast score.png (PAH BLAST Search - Score) (current)
- 16:49, 23 May 2011 (diff | hist) . . (+27) . . N File:Pah.blast coverage.png (PAH BLAST Search - Coverage) (current)
- 16:36, 23 May 2011 (diff | hist) . . (+33) . . Phenylalanine hydroxylase reference (current)
- 16:35, 23 May 2011 (diff | hist) . . (+5,323) . . Task 2: Sequence alignments (sequence searches and multiple alignments)
- 11:38, 22 May 2011 (diff | hist) . . (+1) . . Task 2 - Alignments with PAH Reference (current)
- 11:38, 22 May 2011 (diff | hist) . . (+17) . . Task 2 - Alignments with PAH Reference
- 11:36, 22 May 2011 (diff | hist) . . (+106) . . Task 2 - Alignments with PAH Reference (→HSSP - More Positives)
- 11:27, 22 May 2011 (diff | hist) . . (-47) . . Task 2 - Alignments with PAH Reference
- 11:23, 22 May 2011 (diff | hist) . . (+609) . . Task 2 - Alignments with PAH Reference
- 11:16, 22 May 2011 (diff | hist) . . (-12) . . Task 2 - Alignments with PAH Reference
- 10:59, 22 May 2011 (diff | hist) . . (-49) . . Task 2 - Alignments with PAH Reference
- 10:53, 22 May 2011 (diff | hist) . . (+18) . . Task 2 - Alignments with PAH Reference
- 10:51, 22 May 2011 (diff | hist) . . (+31) . . Task 2 - Alignments with PAH Reference
- 10:45, 22 May 2011 (diff | hist) . . (-44) . . Task 2 - Alignments with PAH Reference
- 10:43, 22 May 2011 (diff | hist) . . (+28) . . Task 2 - Alignments with PAH Reference
- 10:36, 22 May 2011 (diff | hist) . . (+1) . . Task 2 - Alignments with PAH Reference
- 10:35, 22 May 2011 (diff | hist) . . (+4,729) . . N Task 2 - Alignments with PAH Reference (New page: =Task 2 - Alignments with PAH Reference= ==Sequence Searches== ===BLAST== ====Running==== time sudo blastall -p blastp -d '/data/blast/nr/nr' -i /home/student/workspace/reference.fasta -...)
- 10:20, 22 May 2011 (diff | hist) . . (+45) . . Phenylalanine hydroxylase reference
- 20:44, 15 May 2011 (diff | hist) . . (+370) . . Phenylketonuria 2011
- 11:35, 6 May 2011 (diff | hist) . . (-80) . . Phenylketonuria 2011
- 11:34, 6 May 2011 (diff | hist) . . (-8) . . Phenylketonuria 2011
- 11:31, 6 May 2011 (diff | hist) . . (+113) . . Phenylketonuria 2011
- 11:22, 6 May 2011 (diff | hist) . . (-9) . . Phenylalanine hydroxylase reference
- 11:22, 6 May 2011 (diff | hist) . . (-104) . . Phenylalanine hydroxylase reference
- 11:21, 6 May 2011 (diff | hist) . . (-6) . . Phenylalanine hydroxylase reference
- 11:21, 6 May 2011 (diff | hist) . . (0) . . Phenylalanine hydroxylase reference
- 11:20, 6 May 2011 (diff | hist) . . (-4) . . Phenylalanine hydroxylase reference
- 11:16, 6 May 2011 (diff | hist) . . (+155) . . Phenylalanine hydroxylase reference
- 11:15, 6 May 2011 (diff | hist) . . (+4) . . Phenylalanine hydroxylase reference
- 11:15, 6 May 2011 (diff | hist) . . (-3) . . Phenylalanine hydroxylase reference
- 11:14, 6 May 2011 (diff | hist) . . (+5) . . Phenylalanine hydroxylase reference
- 11:14, 6 May 2011 (diff | hist) . . (-4) . . Phenylalanine hydroxylase reference
- 11:13, 6 May 2011 (diff | hist) . . (+4) . . Phenylalanine hydroxylase reference
- 11:12, 6 May 2011 (diff | hist) . . (+662) . . N Phenylalanine hydroxylase reference (New page: == Sequence == <nowiki>MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEE VGALAKVLRLFEENDVNLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDI GATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQ F...)
- 11:03, 6 May 2011 (diff | hist) . . (-122) . . Phenylketonuria 2011
- 10:33, 6 May 2011 (diff | hist) . . (+2,733) . . N Phenylketonuria 2011 (New page: = still under construction = == Summary == Phenylketonuria causes several syndromes: * Delayed mental and social skills * Head size significantly below normal * Hyperactivity * Jerking mo...)
- 09:25, 6 May 2011 (diff | hist) . . (+3) . . Disease list 2011
- 09:23, 6 May 2011 (diff | hist) . . (+23) . . Protein Structure and Function Analysis (version: SS 2011)