User contributions

From Bioinformatikpedia

For Meier (talk | block log | uploads | logs)

Search for contributions

 Show contributions of new accounts only
 IP address or username:

Namespace:  all (Main) Talk User User talk Bioinformatikpedia Bioinformatikpedia talk File File talk MediaWiki MediaWiki talk Template Template talk Help Help talk Category Category talk   Invert selection  Associated namespace 

Tag filter: 

 Only show edits that are latest revisions Only show edits that are page creations Hide minor edits

From date:

To date:

(newest | oldest) View (newer 500 | older 500) (20 | 50 | 100 | 250 | 500)

• 22:28, 4 July 2011 (diff | hist) . . (+491)‎ . . Task 7: Structure-based mutation analysis ‎ (→‎P281L)
• 22:25, 4 July 2011 (diff | hist) . . (+621)‎ . . Task 7: Structure-based mutation analysis ‎ (→‎R261Q)
• 22:11, 4 July 2011 (diff | hist) . . (0)‎ . . N File:PAH SCWRL WT408.png ‎ (current)
• 22:11, 4 July 2011 (diff | hist) . . (0)‎ . . N File:PAH SCWRL WT321.png ‎ (current)
• 22:10, 4 July 2011 (diff | hist) . . (0)‎ . . N File:PAH SCWRL WT281.png ‎ (current)
• 22:10, 4 July 2011 (diff | hist) . . (0)‎ . . N File:PAH SCWRL WT261.png ‎ (current)
• 22:10, 4 July 2011 (diff | hist) . . (0)‎ . . N File:PAH SCWRL R408W.png ‎ (current)
• 22:09, 4 July 2011 (diff | hist) . . (0)‎ . . N File:PAH SCWRL R261Q.png ‎ (current)
• 22:09, 4 July 2011 (diff | hist) . . (0)‎ . . N File:PAH SCWRL P281L.png ‎ (current)
• 22:08, 4 July 2011 (diff | hist) . . (0)‎ . . N File:PAH SCWRL G312D.png ‎ (current)
• 20:46, 4 July 2011 (diff | hist) . . (+62)‎ . . Task 7: Structure-based mutation analysis ‎ (→‎Mutations)
• 20:39, 4 July 2011 (diff | hist) . . (-24)‎ . . Task 7: Structure-based mutation analysis ‎ (→‎Comparison of the delta energies of the different methods and mutations)
• 20:38, 4 July 2011 (diff | hist) . . (+71)‎ . . Task 7: Structure-based mutation analysis ‎ (→‎Comparison of the delta energies of the different methods and mutations)
• 20:35, 4 July 2011 (diff | hist) . . (+310)‎ . . Task 7: Structure-based mutation analysis ‎ (→‎Comparison of the delta energies of the different methods and mutations)
• 20:26, 4 July 2011 (diff | hist) . . (+86)‎ . . Task 7: Structure-based mutation analysis ‎ (→‎Comparison of the delta energies of the different methods and mutations)
• 20:25, 4 July 2011 (diff | hist) . . (+23)‎ . . Task 7: Structure-based mutation analysis ‎ (→‎Minimise)
• 20:22, 4 July 2011 (diff | hist) . . (-2)‎ . . Task 7: Structure-based mutation analysis ‎ (→‎Hydrogen bond network of the WT and mutants)
• 19:00, 1 July 2011 (diff | hist) . . (0)‎ . . Task 7: Structure-based mutation analysis ‎ (→‎P275S)
• 18:59, 1 July 2011 (diff | hist) . . (+931)‎ . . Task 7: Structure-based mutation analysis ‎ (→‎Gromacs)
• 18:56, 1 July 2011 (diff | hist) . . (-3)‎ . . Task 7: Structure-based mutation analysis ‎ (→‎Gromacs)
• 18:54, 1 July 2011 (diff | hist) . . (+136)‎ . . Task 7: Structure-based mutation analysis ‎ (→‎Gromacs)
• 18:51, 1 July 2011 (diff | hist) . . (0)‎ . . N File:PAH T278N GROMACS Potential.png ‎ (current)
• 18:51, 1 July 2011 (diff | hist) . . (0)‎ . . N File:PAH T278N GROMACS Bond.png ‎ (current)
• 18:51, 1 July 2011 (diff | hist) . . (0)‎ . . N File:PAH T278N GROMACS Angle.png ‎ (current)
• 18:51, 1 July 2011 (diff | hist) . . (0)‎ . . N File:PAH T266A GROMACS Potential.png ‎ (current)
• 18:51, 1 July 2011 (diff | hist) . . (0)‎ . . N File:PAH T266A GROMACS Bond.png ‎ (current)
• 18:50, 1 July 2011 (diff | hist) . . (0)‎ . . N File:PAH T266A GROMACS Angle.png ‎ (current)
• 18:50, 1 July 2011 (diff | hist) . . (0)‎ . . N File:PAH R408W GROMACS Potential.png ‎ (current)
• 18:47, 1 July 2011 (diff | hist) . . (0)‎ . . N File:PAH R408W GROMACS Bond.png ‎ (current)
• 18:46, 1 July 2011 (diff | hist) . . (0)‎ . . N File:PAH R408W GROMACS Angle.png ‎ (current)
• 18:46, 1 July 2011 (diff | hist) . . (0)‎ . . N File:PAH R261Q GROMACS Potential.png ‎ (current)
• 18:45, 1 July 2011 (diff | hist) . . (0)‎ . . File:PAH R261Q GROMACS Bond.png ‎ (uploaded a new version of "File:PAH R261Q GROMACS Bond.png") (current)
• 18:45, 1 July 2011 (diff | hist) . . (0)‎ . . N File:PAH R261Q GROMACS Angle.png ‎ (current)
• 18:45, 1 July 2011 (diff | hist) . . (0)‎ . . N File:PAH R261Q GROMACS Bond.png ‎
• 18:45, 1 July 2011 (diff | hist) . . (0)‎ . . N File:PAH R158Q GROMACS Potential.png ‎ (current)
• 18:44, 1 July 2011 (diff | hist) . . (0)‎ . . N File:PAH R158Q GROMACS Bond.png ‎ (current)
• 18:44, 1 July 2011 (diff | hist) . . (0)‎ . . N File:PAH R158Q GROMACS Angle.png ‎ (current)
• 18:44, 1 July 2011 (diff | hist) . . (0)‎ . . N File:PAH P281L GROMACS Potential.png ‎ (current)
• 18:44, 1 July 2011 (diff | hist) . . (0)‎ . . N File:PAH P281L GROMACS Bond.png ‎ (current)
• 18:43, 1 July 2011 (diff | hist) . . (0)‎ . . N File:PAH P281L GROMACS Angle.png ‎ (current)
• 18:43, 1 July 2011 (diff | hist) . . (0)‎ . . N File:PAH P275S GROMACS Potential.png ‎ (current)
• 18:43, 1 July 2011 (diff | hist) . . (0)‎ . . N File:PAH P275S GROMACS Bond.png ‎ (current)
• 18:43, 1 July 2011 (diff | hist) . . (0)‎ . . N File:PAH P275S GROMACS Angle.png ‎ (current)
• 18:42, 1 July 2011 (diff | hist) . . (0)‎ . . N File:PAH G312D GROMACS Potential.png ‎ (current)
• 18:42, 1 July 2011 (diff | hist) . . (0)‎ . . N File:PAH G312D GROMACS Bond.png ‎ (current)
• 18:42, 1 July 2011 (diff | hist) . . (0)‎ . . N File:PAH G312D GROMACS Angle.png ‎ (current)
• 18:34, 1 July 2011 (diff | hist) . . (+73)‎ . . Task 7: Structure-based mutation analysis ‎ (→‎T266A)
• 18:32, 1 July 2011 (diff | hist) . . (+74)‎ . . Task 7: Structure-based mutation analysis ‎ (→‎R261Q)
• 18:31, 1 July 2011 (diff | hist) . . (+90)‎ . . Task 7: Structure-based mutation analysis ‎ (→‎R408W)
• 18:29, 1 July 2011 (diff | hist) . . (+74)‎ . . Task 7: Structure-based mutation analysis ‎ (→‎R158Q)
• 18:28, 1 July 2011 (diff | hist) . . (+74)‎ . . Task 7: Structure-based mutation analysis ‎ (→‎P281L)
• 18:26, 1 July 2011 (diff | hist) . . (+71)‎ . . Task 7: Structure-based mutation analysis ‎ (→‎T278N)
• 18:24, 1 July 2011 (diff | hist) . . (+66)‎ . . Task 7: Structure-based mutation analysis ‎ (→‎P275S)
• 18:23, 1 July 2011 (diff | hist) . . (+72)‎ . . Task 7: Structure-based mutation analysis ‎ (→‎Mutations)
• 17:50, 1 July 2011 (diff | hist) . . (+1,866)‎ . . Task 7: Structure-based mutation analysis ‎ (→‎Mutations)
• 17:36, 1 July 2011 (diff | hist) . . (-66)‎ . . Task 7: Structure-based mutation analysis ‎ (→‎Minimise)
• 17:30, 1 July 2011 (diff | hist) . . (+209)‎ . . Task 7: Structure-based mutation analysis ‎ (→‎Timerun)
• 17:30, 1 July 2011 (diff | hist) . . (0)‎ . . N File:PAH GROMACS Timeplot.png ‎ (current)
• 17:26, 1 July 2011 (diff | hist) . . (+762)‎ . . Task 7: Structure-based mutation analysis ‎
• 20:16, 27 June 2011 (diff | hist) . . (+3,079)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎Mutations compared to BLOSUM62, PAM(1/250), PSSM and conservation of MSA with all mammalian homologous)
• 10:11, 27 June 2011 (diff | hist) . . (+3)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎R408W)
• 10:10, 27 June 2011 (diff | hist) . . (-7)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎Execution)
• 10:08, 27 June 2011 (diff | hist) . . (-31)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎PSSM)
• 10:07, 27 June 2011 (diff | hist) . . (+233)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎PSSM)
• 18:10, 25 June 2011 (diff | hist) . . (+62)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎R408W)
• 18:07, 25 June 2011 (diff | hist) . . (+62)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎G312D)
• 18:02, 25 June 2011 (diff | hist) . . (+60)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎R261Q)
• 17:58, 25 June 2011 (diff | hist) . . (+28)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎I65T)
• 17:57, 25 June 2011 (diff | hist) . . (+65)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎R71H)
• 17:53, 25 June 2011 (diff | hist) . . (+36)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎I65T)
• 17:48, 25 June 2011 (diff | hist) . . (+633)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎R71H)
• 17:37, 25 June 2011 (diff | hist) . . (+1,063)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎G312D)
• 17:18, 25 June 2011 (diff | hist) . . (+538)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎R261Q)
• 17:09, 25 June 2011 (diff | hist) . . (+22)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎R261Q)
• 17:08, 25 June 2011 (diff | hist) . . (-8)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎R261Q)
• 17:06, 25 June 2011 (diff | hist) . . (-1,405)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎Mutations compared to BLOSUM62, PAM(1/250), PSSM and conservation of MSA with all mammalian homologous)
• 16:57, 25 June 2011 (diff | hist) . . (+2,582)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎Discussion)
• 15:44, 25 June 2011 (diff | hist) . . (+382)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎Mutations and secondary structure)
• 15:34, 25 June 2011 (diff | hist) . . (-1,786)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎Mutations and secondary structure)
• 15:29, 25 June 2011 (diff | hist) . . (+180)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎Mutations compared to BLOSUM62, PAM(1/250), PSSM and conservation of MSA with all mammalian homologous)
• 14:50, 25 June 2011 (diff | hist) . . (+3)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎G312D)
• 14:49, 25 June 2011 (diff | hist) . . (+484)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎Visualization of the changed Amino Acid)
• 14:44, 25 June 2011 (diff | hist) . . (+39)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎I65T)
• 14:43, 25 June 2011 (diff | hist) . . (+96)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎Visualization of the changed Amino Acid)
• 14:43, 25 June 2011 (diff | hist) . . (0)‎ . . N File:PAH.G312.mut.png ‎ (current)
• 14:42, 25 June 2011 (diff | hist) . . (0)‎ . . N File:PAH.G312.wt.png ‎ (current)
• 14:41, 25 June 2011 (diff | hist) . . (0)‎ . . N File:PAH.R408W.png ‎ (current)
• 14:40, 25 June 2011 (diff | hist) . . (0)‎ . . N File:PAH.R261Q.png ‎ (current)
• 14:36, 25 June 2011 (diff | hist) . . (+196)‎ . . Task 6: Sequence-based mutation analysis ‎
• 14:31, 25 June 2011 (diff | hist) . . (+1)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎Mutations compared to BLOSUM62, PAM(1/250), PSSM and conservation of MSA with all mammalian homologous)
• 14:29, 25 June 2011 (diff | hist) . . (+390)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎Mutations compared to BLOSUM62, PAM(1/250), PSSM and conservation of MSA with all mammalian homologous)
• 14:20, 25 June 2011 (diff | hist) . . (0)‎ . . N File:PAM250.I.png ‎ (current)
• 14:20, 25 June 2011 (diff | hist) . . (0)‎ . . N File:PAM250.R.png ‎ (current)
• 14:19, 25 June 2011 (diff | hist) . . (0)‎ . . N File:PAM250.T.png ‎ (current)
• 14:19, 25 June 2011 (diff | hist) . . (+837)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎Mutations compared to BLOSUM62, PAM(1/250), PSSM and conservation of MSA with all mammalian homologous)
• 14:08, 25 June 2011 (diff | hist) . . (+1,766)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎Mutations compared to BLOSUM62, PAM(1/250), PSSM and conservation of MSA with all mammalian homologous)
• 13:48, 25 June 2011 (diff | hist) . . (0)‎ . . N File:PAH.PSI PSSM.408.png ‎ (current)
• 13:48, 25 June 2011 (diff | hist) . . (0)‎ . . N File:PAH.PSI PSSM.312.png ‎ (current)
• 13:47, 25 June 2011 (diff | hist) . . (0)‎ . . N File:PAH.PSI PSSM.281.png ‎ (current)
• 13:47, 25 June 2011 (diff | hist) . . (0)‎ . . N File:PAH.PSI PSSM.278.png ‎ (current)
• 13:47, 25 June 2011 (diff | hist) . . (0)‎ . . N File:PAH.PSI PSSM.275.png ‎ (current)
• 13:47, 25 June 2011 (diff | hist) . . (0)‎ . . N File:PAH.PSI PSSM.266.png ‎ (current)
• 13:46, 25 June 2011 (diff | hist) . . (0)‎ . . N File:PAH.PSI PSSM.261.png ‎ (current)
• 13:46, 25 June 2011 (diff | hist) . . (0)‎ . . N File:PAH.PSI PSSM.158.png ‎ (current)
• 13:46, 25 June 2011 (diff | hist) . . (0)‎ . . N File:PAH.PSI PSSM.71.png ‎ (current)
• 13:45, 25 June 2011 (diff | hist) . . (0)‎ . . N File:PAH.PSI PSSM.65.png ‎ (current)
• 13:36, 25 June 2011 (diff | hist) . . (0)‎ . . N File:PAM250.P.png ‎ (current)
• 13:36, 25 June 2011 (diff | hist) . . (0)‎ . . N File:PAM250.G.png ‎ (current)
• 13:35, 25 June 2011 (diff | hist) . . (0)‎ . . N File:DAYHOFF.T.png ‎ (current)
• 13:35, 25 June 2011 (diff | hist) . . (0)‎ . . N File:DAYHOFF.R.png ‎ (current)
• 13:35, 25 June 2011 (diff | hist) . . (0)‎ . . N File:DAYHOFF.P.png ‎ (current)
• 13:35, 25 June 2011 (diff | hist) . . (0)‎ . . N File:DAYHOFF.I.png ‎ (current)
• 13:34, 25 June 2011 (diff | hist) . . (0)‎ . . N File:DAYHOFF.G.png ‎ (current)
• 13:34, 25 June 2011 (diff | hist) . . (0)‎ . . N File:BLOSUM62.T.png ‎ (current)
• 13:34, 25 June 2011 (diff | hist) . . (0)‎ . . N File:BLOSUM62.R.png ‎ (current)
• 13:34, 25 June 2011 (diff | hist) . . (0)‎ . . N File:BLOSUM62.P.png ‎ (current)
• 13:34, 25 June 2011 (diff | hist) . . (0)‎ . . N File:BLOSUM62.I.png ‎ (current)
• 13:33, 25 June 2011 (diff | hist) . . (0)‎ . . N File:BLOSUM62.G.png ‎ (current)
• 13:25, 25 June 2011 (diff | hist) . . (+20)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎Physicochemical properties and changes)
• 13:25, 25 June 2011 (diff | hist) . . (+482)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎Physicochemical properties and changes)
• 13:21, 25 June 2011 (diff | hist) . . (+13)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎Execution)
• 13:20, 25 June 2011 (diff | hist) . . (+140)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎SNAP)
• 13:19, 25 June 2011 (diff | hist) . . (+376)‎ . . Task 6: Sequence-based mutation analysis ‎ (→‎SNAP)
• 18:45, 20 June 2011 (diff | hist) . . (-617)‎ . . Task 5: Mapping point mutations ‎ (→‎Reference Sequence)
• 18:44, 20 June 2011 (diff | hist) . . (-872)‎ . . Task 5: Mapping point mutations ‎ (→‎Comparing the annotation of HGMD and SNPdb)
• 18:44, 20 June 2011 (diff | hist) . . (+15)‎ . . Task 5: Mapping point mutations ‎ (→‎Mapping)
• 18:43, 20 June 2011 (diff | hist) . . (-1)‎ . . Task 5: Mapping point mutations ‎ (→‎Mapping)
• 18:42, 20 June 2011 (diff | hist) . . (0)‎ . . Task 5: Mapping point mutations ‎ (→‎Mapping)
• 18:41, 20 June 2011 (diff | hist) . . (0)‎ . . Task 5: Mapping point mutations ‎ (→‎Mapping)
• 18:39, 20 June 2011 (diff | hist) . . (0)‎ . . Task 5: Mapping point mutations ‎ (→‎Mapping)
• 18:38, 20 June 2011 (diff | hist) . . (+12,734)‎ . . Task 5: Mapping point mutations ‎ (→‎Mapping)
• 18:17, 20 June 2011 (diff | hist) . . (-1)‎ . . Task 5: Mapping point mutations ‎ (→‎SNPs)
• 18:17, 20 June 2011 (diff | hist) . . (+64)‎ . . Task 5: Mapping point mutations ‎ (→‎SNPs)
• 18:16, 20 June 2011 (diff | hist) . . (+17,693)‎ . . Task 5: Mapping point mutations ‎ (→‎SNPs)
• 15:24, 20 June 2011 (diff | hist) . . (+20,975)‎ . . Task 5: Mapping point mutations ‎ (→‎Mapping)
• 10:20, 20 June 2011 (diff | hist) . . (+697)‎ . . Task 5: Mapping point mutations ‎ (→‎HGMD)
• 15:00, 15 June 2011 (diff | hist) . . (+100)‎ . . Task 5: Mapping point mutations ‎ (→‎Alignment with the reference sequence used in HGMD)
• 14:53, 15 June 2011 (diff | hist) . . (-7)‎ . . Task 5: Mapping point mutations ‎ (→‎Alignment of the reference sequences)
• 14:53, 15 June 2011 (diff | hist) . . (+734)‎ . . Task 5: Mapping point mutations ‎ (→‎Alignment of the reference sequences)
• 20:38, 14 June 2011 (diff | hist) . . (+319)‎ . . Task 5: Mapping point mutations ‎ (→‎HGMD)
• 20:34, 14 June 2011 (diff | hist) . . (+71)‎ . . Task 5: Mapping point mutations ‎ (→‎HGMD)
• 20:33, 14 June 2011 (diff | hist) . . (+633)‎ . . Task 5: Mapping point mutations ‎ (→‎HGMD)
• 19:16, 14 June 2011 (diff | hist) . . (+386)‎ . . N Task 5: Mapping point mutations ‎ (Created page with "== Task description == A detailed task description can be found here: Mapping point mutations == SNP databases == === HGMD === ==== Reference Sequence…")
• 19:07, 14 June 2011 (diff | hist) . . (+38)‎ . . Phenylketonuria 2011 ‎ (→‎Tasks)
• 14:37, 14 June 2011 (diff | hist) . . (+343)‎ . . Task 4: Homology based structure predictions ‎ (→‎3D-JigSaw)
• 14:31, 14 June 2011 (diff | hist) . . (+382)‎ . . Task 4: Homology based structure predictions ‎ (→‎iTasser)
• 14:22, 14 June 2011 (diff | hist) . . (+667)‎ . . Task 4: Homology based structure predictions ‎ (→‎iTasser)
• 14:16, 14 June 2011 (diff | hist) . . (+1,052)‎ . . Task 4: Homology based structure predictions ‎ (→‎3D-JigSaw)
• 14:01, 14 June 2011 (diff | hist) . . (+280)‎ . . Task 4: Homology based structure predictions ‎ (→‎Discussion)
• 13:57, 14 June 2011 (diff | hist) . . (+254)‎ . . Task 4: Homology based structure predictions ‎ (→‎Homology modeling with Modeller)
• 13:50, 14 June 2011 (diff | hist) . . (-10)‎ . . Task 4: Homology based structure predictions ‎ (→‎Homology modeling with Modeller)
• 13:49, 14 June 2011 (diff | hist) . . (+102)‎ . . Task 4: Homology based structure predictions ‎ (→‎Alignment Refinement)
• 03:37, 14 June 2011 (diff | hist) . . (+2)‎ . . Task 4: Homology based structure predictions ‎ (→‎Discussion)
• 03:36, 14 June 2011 (diff | hist) . . (-4)‎ . . Task 4: Homology based structure predictions ‎ (→‎Discussion)
• 03:32, 14 June 2011 (diff | hist) . . (+579)‎ . . Task 4: Homology based structure predictions ‎ (→‎Discussion)
• 03:21, 14 June 2011 (diff | hist) . . (+1,467)‎ . . Task 4: Homology based structure predictions ‎ (→‎Discussion)
• 02:49, 14 June 2011 (diff | hist) . . (+1,633)‎ . . Task 4: Homology based structure predictions ‎ (→‎Discussion)
• 02:18, 14 June 2011 (diff | hist) . . (+106)‎ . . Task 4: Homology based structure predictions ‎ (→‎Discussion)
• 02:18, 14 June 2011 (diff | hist) . . (+52)‎ . . N File:Pah multi modeller.png ‎ (Modelling of PAH by Modeller with multiple templates) (current)
• 02:10, 14 June 2011 (diff | hist) . . (+160)‎ . . Task 4: Homology based structure predictions ‎ (→‎1phz)
• 02:08, 14 June 2011 (diff | hist) . . (-11)‎ . . Task 4: Homology based structure predictions ‎ (→‎Results of 3D JigSaw)
• 02:08, 14 June 2011 (diff | hist) . . (+8)‎ . . Task 4: Homology based structure predictions ‎ (→‎Results of 3D JigSaw)
• 02:06, 14 June 2011 (diff | hist) . . (-3,130)‎ . . Task 4: Homology based structure predictions ‎ (→‎3D-JigSaw)
• 02:05, 14 June 2011 (diff | hist) . . (+3,153)‎ . . Task 4: Homology based structure predictions ‎ (→‎Calculation of models)
• 02:02, 14 June 2011 (diff | hist) . . (0)‎ . . Task 4: Homology based structure predictions ‎ (→‎JigSaw 3D)
• 01:58, 14 June 2011 (diff | hist) . . (+11)‎ . . Task 4: Homology based structure predictions ‎ (→‎1phz - sequence identity > 60 %)
• 01:57, 14 June 2011 (diff | hist) . . (-3)‎ . . Task 4: Homology based structure predictions ‎ (→‎1ltz - sequence identity < 40 %)
• 01:57, 14 June 2011 (diff | hist) . . (+520)‎ . . Task 4: Homology based structure predictions ‎ (→‎1phz - sequence identity > 60 %)
• 01:51, 14 June 2011 (diff | hist) . . (+60)‎ . . N File:Pah jig 1phz Energy.gif ‎ (The energy diagram of jigsaw feeded with the models of 1phz.) (current)
• 01:50, 14 June 2011 (diff | hist) . . (+85)‎ . . N File:Pah jig 1phz rmp model 5.png ‎ (The ramachandran plot of model 5 calculated by jigsaw feeded with the models of 1phz.) (current)
• 01:50, 14 June 2011 (diff | hist) . . (+85)‎ . . N File:Pah jig 1phz rmp model 4.png ‎ (The ramachandran plot of model 4 calculated by jigsaw feeded with the models of 1phz.) (current)
• 01:50, 14 June 2011 (diff | hist) . . (+85)‎ . . N File:Pah jig 1phz rmp model 3.png ‎ (The ramachandran plot of model 3 calculated by jigsaw feeded with the models of 1phz.) (current)
• 01:50, 14 June 2011 (diff | hist) . . (+85)‎ . . N File:Pah jig 1phz rmp model 2.png ‎ (The ramachandran plot of model 2 calculated by jigsaw feeded with the models of 1phz.) (current)
• 01:49, 14 June 2011 (diff | hist) . . (+85)‎ . . N File:Pah jig 1phz rmp model 1.png ‎ (The ramachandran plot of model 1 calculated by jigsaw feeded with the models of 1phz.) (current)
• 01:46, 14 June 2011 (diff | hist) . . (+34)‎ . . Task 4: Homology based structure predictions ‎ (→‎Adjusted Alignment Workflow)
• 01:41, 14 June 2011 (diff | hist) . . (+24)‎ . . Task 4: Homology based structure predictions ‎ (→‎iTasser)
• 16:01, 13 June 2011 (diff | hist) . . (-3,156)‎ . . Task 4: Homology based structure predictions ‎ (→‎Calculation of models)
• 16:00, 13 June 2011 (diff | hist) . . (+2,761)‎ . . Task 4: Homology based structure predictions ‎ (→‎Calculation of models)
• 15:57, 13 June 2011 (diff | hist) . . (+3)‎ . . Task 4: Homology based structure predictions ‎ (→‎Ranking of JigSaw)
• 15:57, 13 June 2011 (diff | hist) . . (-30)‎ . . Task 4: Homology based structure predictions ‎ (→‎1ltz - sequence identity < 40 %)
• 15:53, 13 June 2011 (diff | hist) . . (+160)‎ . . Task 4: Homology based structure predictions ‎ (→‎1ltz)
• 15:51, 13 June 2011 (diff | hist) . . (+159)‎ . . Task 4: Homology based structure predictions ‎ (→‎1toh)
• 15:38, 13 June 2011 (diff | hist) . . (+1,577)‎ . . Task 4: Homology based structure predictions ‎ (→‎Comparison to experimental structure)
• 15:26, 13 June 2011 (diff | hist) . . (+60)‎ . . Task 4: Homology based structure predictions ‎ (→‎Ranking of JigSaw)
• 15:23, 13 June 2011 (diff | hist) . . (+515)‎ . . Task 4: Homology based structure predictions ‎ (→‎1ltz - sequence identity < 40 %)
• 15:19, 13 June 2011 (diff | hist) . . (+85)‎ . . N File:Pah jig 1ltz rmp model 5.png ‎ (The ramachandran plot of model 5 calculated by jigsaw feeded with the models of 1ltz.) (current)
• 15:19, 13 June 2011 (diff | hist) . . (+85)‎ . . N File:Pah jig 1ltz rmp model 4.png ‎ (The ramachandran plot of model 4 calculated by jigsaw feeded with the models of 1ltz.) (current)
• 15:18, 13 June 2011 (diff | hist) . . (+85)‎ . . N File:Pah jig 1ltz rmp model 3.png ‎ (The ramachandran plot of model 3 calculated by jigsaw feeded with the models of 1ltz.) (current)
• 15:18, 13 June 2011 (diff | hist) . . (+85)‎ . . N File:Pah jig 1ltz rmp model 2.png ‎ (The ramachandran plot of model 2 calculated by jigsaw feeded with the models of 1ltz.) (current)
• 15:18, 13 June 2011 (diff | hist) . . (+85)‎ . . N File:Pah jig 1ltz rmp model 1.png ‎ (The ramachandran plot of model 1 calculated by jigsaw feeded with the models of 1ltz.) (current)
• 15:16, 13 June 2011 (diff | hist) . . (+60)‎ . . N File:Pah jig 1ltz Energy.gif ‎ (The energy diagram of jigsaw feeded with the models of 1ltz.) (current)
• 15:12, 13 June 2011 (diff | hist) . . (+563)‎ . . Task 4: Homology based structure predictions ‎ (→‎Ranking of JigSaw)
• 15:07, 13 June 2011 (diff | hist) . . (+85)‎ . . N File:Pah jig 1toh rmp model 5.png ‎ (The ramachandran plot of model 5 calculated by jigsaw feeded with the models of 1toh.) (current)
• 15:07, 13 June 2011 (diff | hist) . . (+85)‎ . . N File:Pah jig 1toh rmp model 4.png ‎ (The ramachandran plot of model 4 calculated by jigsaw feeded with the models of 1toh.) (current)
• 15:06, 13 June 2011 (diff | hist) . . (+85)‎ . . N File:Pah jig 1toh rmp model 3.png ‎ (The ramachandran plot of model 3 calculated by jigsaw feeded with the models of 1toh.) (current)
• 15:06, 13 June 2011 (diff | hist) . . (+85)‎ . . N File:Pah jig 1toh rmp model 2.png ‎ (The ramachandran plot of model 2 calculated by jigsaw feeded with the models of 1toh.) (current)
• 15:06, 13 June 2011 (diff | hist) . . (+85)‎ . . N File:Pah jig 1toh rmp model 1.png ‎ (The ramachandran plot of model 1 calculated by jigsaw feeded with the models of 1toh.) (current)
• 15:04, 13 June 2011 (diff | hist) . . (+60)‎ . . N File:Pah jig 1toh Energy.gif ‎ (The energy diagram of jigsaw feeded with the models of 1toh.) (current)
• 15:00, 13 June 2011 (diff | hist) . . (+9)‎ . . Task 4: Homology based structure predictions ‎ (→‎1ltz - sequence identity < 40 %)
• 14:59, 13 June 2011 (diff | hist) . . (+27)‎ . . Task 4: Homology based structure predictions ‎ (→‎JigSaw 3D)
• 00:07, 13 June 2011 (diff | hist) . . (+115)‎ . . Task 4: Homology based structure predictions ‎ (→‎JigSaw 3D)
• 23:19, 12 June 2011 (diff | hist) . . (+177)‎ . . Task 4: Homology based structure predictions ‎ (→‎JigSaw 3D)
• 23:12, 12 June 2011 (diff | hist) . . (+61)‎ . . Task 4: Homology based structure predictions ‎ (→‎JigSaw 3D)
• 23:11, 12 June 2011 (diff | hist) . . (-9)‎ . . Task 4: Homology based structure predictions ‎ (→‎1ltz - sequence identity < 40 %)
• 23:09, 12 June 2011 (diff | hist) . . (+305)‎ . . Task 4: Homology based structure predictions ‎ (→‎JigSaw 3D)
• 23:06, 12 June 2011 (diff | hist) . . (+54)‎ . . Task 4: Homology based structure predictions ‎ (→‎JigSaw 3D)
• 23:05, 12 June 2011 (diff | hist) . . (+156)‎ . . Task 4: Homology based structure predictions ‎ (→‎JigSaw 3D)
• 23:02, 12 June 2011 (diff | hist) . . (+121)‎ . . Task 4: Homology based structure predictions ‎ (→‎JigSaw 3D)
• 23:00, 12 June 2011 (diff | hist) . . (+33)‎ . . Task 4: Homology based structure predictions ‎ (→‎JigSaw 3D)
• 22:54, 12 June 2011 (diff | hist) . . (+857)‎ . . Task 4: Homology based structure predictions ‎ (→‎JigSaw 3D)
• 22:30, 12 June 2011 (diff | hist) . . (0)‎ . . Task 4: Homology based structure predictions ‎ (→‎JigSaw 3D)
• 22:29, 12 June 2011 (diff | hist) . . (+1,031)‎ . . Task 4: Homology based structure predictions ‎ (→‎JigSaw 3D)
• 22:17, 12 June 2011 (diff | hist) . . (+70)‎ . . Task 4: Homology based structure predictions ‎ (→‎Adjusted Alignment Workflow)
• 22:16, 12 June 2011 (diff | hist) . . (+103)‎ . . Task 4: Homology based structure predictions ‎ (→‎Standard Workflow)
• 22:11, 12 June 2011 (diff | hist) . . (0)‎ . . Task 4: Homology based structure predictions ‎ (→‎Modeller)
• 22:10, 12 June 2011 (diff | hist) . . (0)‎ . . Task 4: Homology based structure predictions ‎ (→‎iTasser)
• 22:04, 12 June 2011 (diff | hist) . . (+135)‎ . . Task 4: Homology based structure predictions ‎ (→‎iTasser)
• 17:37, 12 June 2011 (diff | hist) . . (+24)‎ . . Task 4: Homology based structure predictions ‎ (→‎Adjusted Alignment Workflow)
• 17:33, 12 June 2011 (diff | hist) . . (+36)‎ . . Task 4: Homology based structure predictions ‎ (→‎Modeller)
• 17:16, 12 June 2011 (diff | hist) . . (-759)‎ . . Automated Evaluation of Homoloy Models ‎
• 16:22, 12 June 2011 (diff | hist) . . (+340)‎ . . Task 4: Homology based structure predictions ‎
• 16:07, 12 June 2011 (diff | hist) . . (+26)‎ . . Task 4: Homology based structure predictions ‎ (→‎iTasser)
• 16:02, 12 June 2011 (diff | hist) . . (+78)‎ . . Task 4: Homology based structure predictions ‎ (→‎Adjusted Alignment Workflow)
• 15:23, 12 June 2011 (diff | hist) . . (+225)‎ . . Task 4: Homology based structure predictions ‎ (→‎Homology modelling with iTasser)
• 15:20, 12 June 2011 (diff | hist) . . (+56)‎ . . N File:Pah itasser 2.png ‎ (itasser workflow with alignment and template restriction) (current)
• 15:19, 12 June 2011 (diff | hist) . . (+42)‎ . . N File:Pah itasser 1.png ‎ (itasser workflow with template restriction) (current)
• 15:14, 12 June 2011 (diff | hist) . . (0)‎ . . Task 4: Homology based structure predictions ‎ (→‎Homology modelling with iTasser)
• 15:14, 12 June 2011 (diff | hist) . . (+184)‎ . . Task 4: Homology based structure predictions ‎ (→‎Homology modelling with iTasser)
• 15:13, 12 June 2011 (diff | hist) . . (-18)‎ . . Task 4: Homology based structure predictions ‎ (→‎Homology modelling with iTasser)
• 15:11, 12 June 2011 (diff | hist) . . (+6)‎ . . Task 4: Homology based structure predictions ‎ (→‎Homology modelling with iTasser)
• 15:10, 12 June 2011 (diff | hist) . . (+1,655)‎ . . Task 4: Homology based structure predictions ‎ (→‎Calculation of models)
• 14:55, 12 June 2011 (diff | hist) . . (+40)‎ . . Task 4: Homology based structure predictions ‎ (→‎Workflow with own alignment)
• 14:54, 12 June 2011 (diff | hist) . . (+773)‎ . . Task 4: Homology based structure predictions ‎ (→‎Homology modelling with Swissmodel)
• 14:53, 12 June 2011 (diff | hist) . . (+130)‎ . . N File:Pah swiss 3.png ‎ (workflow of swissmodel in alignment mode - third step - checking of the adjusted alignment with respect to the chosen template pdb) (current)
• 14:52, 12 June 2011 (diff | hist) . . (+93)‎ . . N File:Pah swiss 2.png ‎ (workflow of swissmodel in alignment mode - second step - specification of target and template) (current)
• 14:51, 12 June 2011 (diff | hist) . . (+86)‎ . . N File:Pah swiss 1.png ‎ (workflow of swissmodel in alignment mode - first step - specification of the alignment) (current)
• 14:33, 12 June 2011 (diff | hist) . . (+26)‎ . . Task 4: Homology based structure predictions ‎ (→‎Homology modelling with Swissmodel)
• 14:31, 12 June 2011 (diff | hist) . . (+57)‎ . . Task 4: Homology based structure predictions ‎ (→‎Homology modelling with Modeller)
• 14:29, 12 June 2011 (diff | hist) . . (+355)‎ . . Task 4: Homology based structure predictions ‎ (→‎Homology modelling with Modeller)
• 14:13, 12 June 2011 (diff | hist) . . (0)‎ . . Task 4: Homology based structure predictions ‎ (→‎Alignment Refinement)
• 14:11, 12 June 2011 (diff | hist) . . (-1,529)‎ . . Task 4: Homology based structure predictions ‎ (→‎Alignment Refinement)
• 14:07, 12 June 2011 (diff | hist) . . (+1,972)‎ . . Task 4: Homology based structure predictions ‎ (→‎Alignment Refinement)
• 13:46, 12 June 2011 (diff | hist) . . (+96)‎ . . Task 4: Homology based structure predictions ‎ (→‎Alignment Refinement)
• 13:32, 12 June 2011 (diff | hist) . . (0)‎ . . Task 4: Homology based structure predictions ‎ (→‎Alignment Refinement)
• 13:28, 12 June 2011 (diff | hist) . . (+17)‎ . . Task 4: Homology based structure predictions ‎ (→‎Alignment Refinement)
• 13:28, 12 June 2011 (diff | hist) . . (0)‎ . . Task 4: Homology based structure predictions ‎ (→‎Alignment Refinement)
• 13:26, 12 June 2011 (diff | hist) . . (+17)‎ . . Task 4: Homology based structure predictions ‎ (→‎Alignment Refinement)
• 13:26, 12 June 2011 (diff | hist) . . (+80)‎ . . Task 4: Homology based structure predictions ‎ (→‎Alignment Refinement)
• 01:01, 11 June 2011 (diff | hist) . . (+73)‎ . . Automated Evaluation of Homoloy Models ‎
• 00:56, 11 June 2011 (diff | hist) . . (0)‎ . . Task 4: Homology based structure predictions ‎ (→‎iTasser)
• 00:56, 11 June 2011 (diff | hist) . . (+181)‎ . . Task 4: Homology based structure predictions ‎ (→‎iTasser)
• 00:43, 11 June 2011 (diff | hist) . . (+394)‎ . . Task 4: Homology based structure predictions ‎ (→‎Homology modelling with iTasser)
• 00:34, 11 June 2011 (diff | hist) . . (-53)‎ . . Task 4: Homology based structure predictions ‎ (→‎Homology modelling with iTasser)
• 00:31, 11 June 2011 (diff | hist) . . (-9)‎ . . Task 4: Homology based structure predictions ‎ (→‎Alignment Mode: Modeling with adjusted alignment 1ltz_A (<40%))
• 00:27, 11 June 2011 (diff | hist) . . (+2)‎ . . Task 4: Homology based structure predictions ‎ (→‎Alignment Mode: Modeling with adjusted alignment 1toh_A (>40%))
• 00:25, 11 June 2011 (diff | hist) . . (-14)‎ . . Task 4: Homology based structure predictions ‎ (→‎Alignment Mode: Modeling with adjusted alignment 1toh_A (>40%))
• 00:17, 11 June 2011 (diff | hist) . . (+3,575)‎ . . Task 4: Homology based structure predictions ‎ (→‎Swissmodel)
• 00:00, 11 June 2011 (diff | hist) . . (0)‎ . . N File:Local quality estimation 1toh imp template annolea qmean gromos.png ‎ (current)
• 00:00, 11 June 2011 (diff | hist) . . (0)‎ . . N File:Local quality estimation 1phz imp template annolea qmean gromos.png ‎ (current)
• 23:59, 10 June 2011 (diff | hist) . . (0)‎ . . N File:Local quality estimation 1ltz imp template annolea qmean gromos.png ‎ (current)
• 23:57, 10 June 2011 (diff | hist) . . (0)‎ . . N File:QMEAN plots energy profile plots 1ltz imp template.pdb local energy profile QMEANlocal.png ‎ (current)
• 23:56, 10 June 2011 (diff | hist) . . (0)‎ . . N File:QMEAN plots energy profile plots 1phz imp template.pdb local energy profile QMEANlocal.png ‎ (current)
• 23:56, 10 June 2011 (diff | hist) . . (0)‎ . . N File:QMEAN plots energy profile plots 1toh imp template.pdb local energy profile QMEANlocal.png ‎ (current)
• 23:55, 10 June 2011 (diff | hist) . . (0)‎ . . N File:1toh imp template coloring by residue error.jpeg ‎ (current)
• 23:50, 10 June 2011 (diff | hist) . . (0)‎ . . N File:1phz imp template coloring by residue error.jpeg ‎ (current)
• 23:49, 10 June 2011 (diff | hist) . . (0)‎ . . N File:1ltz imp template coloring by residue error.jpeg ‎ (current)
• 23:48, 10 June 2011 (diff | hist) . . (0)‎ . . N File:QMEAN plots 1ltz imp template plot.png slider.png ‎ (current)
• 23:48, 10 June 2011 (diff | hist) . . (0)‎ . . N File:QMEAN plots 1phz imp template plot.png slider.png ‎ (current)
• 23:48, 10 June 2011 (diff | hist) . . (0)‎ . . N File:QMEAN plots 1toh imp template plot.png slider.png ‎ (current)
• 23:47, 10 June 2011 (diff | hist) . . (0)‎ . . N File:QMEAN plots 1toh imp template pdb plot.png density plot.png ‎ (current)
• 23:45, 10 June 2011 (diff | hist) . . (0)‎ . . N File:QMEAN plots 1ltz imp template pdb plot.png density plot.png ‎ (current)
• 23:45, 10 June 2011 (diff | hist) . . (0)‎ . . N File:QMEAN plots 1phz imp template pdb plot.png density plot.png ‎ (current)
• 23:44, 10 June 2011 (diff | hist) . . (0)‎ . . N File:QMEAN plots 1toh imp template.pdb plot.png ‎ (current)
• 23:43, 10 June 2011 (diff | hist) . . (0)‎ . . N File:QMEAN plots 1ltz imp template.pdb plot.png ‎ (current)
• 23:43, 10 June 2011 (diff | hist) . . (0)‎ . . N File:QMEAN plots 1phz imp template.pdb plot.png ‎ (current)
• 15:33, 10 June 2011 (diff | hist) . . (+373)‎ . . Task 4: Homology based structure predictions ‎ (→‎Comparison to experimental structure)
• 15:27, 10 June 2011 (diff | hist) . . (+52)‎ . . N Pah hom autom eval ‎ (moved Pah hom autom eval to Automated Evaluation of Homoloy Models: former title was kind of weird) (current)
• 15:27, 10 June 2011 (diff | hist) . . (0)‎ . . m Automated Evaluation of Homoloy Models ‎ (moved Pah hom autom eval to Automated Evaluation of Homoloy Models: former title was kind of weird)
• 15:25, 10 June 2011 (diff | hist) . . (+893)‎ . . Automated Evaluation of Homoloy Models ‎
• 15:21, 10 June 2011 (diff | hist) . . (+19)‎ . . Automated Evaluation of Homoloy Models ‎
• 15:21, 10 June 2011 (diff | hist) . . (+5,508)‎ . . N Automated Evaluation of Homoloy Models ‎ (Created page with "=Source code for Eval.java= <code> import java.io.BufferedReader; import java.io.BufferedWriter; import java.io.File; import java.io.FileNotFoundException; import java.io.FileRea…")
• 15:20, 10 June 2011 (diff | hist) . . (0)‎ . . Task 4: Homology based structure predictions ‎ (→‎Comparison to experimental structure)
• 15:19, 10 June 2011 (diff | hist) . . (+35)‎ . . Task 4: Homology based structure predictions ‎ (→‎Comparison to experimental structure)
• 15:15, 10 June 2011 (diff | hist) . . (-401)‎ . . Task 4: Homology based structure predictions ‎ (→‎Homology modelling with Modeller)
• 15:06, 10 June 2011 (diff | hist) . . (+89)‎ . . Task 4: Homology based structure predictions ‎ (→‎Alignment Refinement)
• 15:05, 10 June 2011 (diff | hist) . . (+12,425)‎ . . Task 4: Homology based structure predictions ‎ (→‎Calculation of models)
• 14:46, 10 June 2011 (diff | hist) . . (-657)‎ . . Task 4: Homology based structure predictions ‎ (→‎Homology modelling with Modeller)
• 14:43, 10 June 2011 (diff | hist) . . (+46)‎ . . Task 4: Homology based structure predictions ‎ (→‎Modeller)
• 14:35, 10 June 2011 (diff | hist) . . (+1)‎ . . Task 4: Homology based structure predictions ‎ (→‎Homology modelling with Modeller)
• 11:50, 10 June 2011 (diff | hist) . . (+84)‎ . . Task 4: Homology based structure predictions ‎ (→‎Modeller)
• 11:32, 10 June 2011 (diff | hist) . . (0)‎ . . Task 4: Homology based structure predictions ‎ (→‎Modeller)
• 11:30, 10 June 2011 (diff | hist) . . (-39)‎ . . Task 4: Homology based structure predictions ‎ (→‎Modeller)
• 11:24, 10 June 2011 (diff | hist) . . (+1)‎ . . Task 4: Homology based structure predictions ‎ (→‎Standard Workflow)
• 11:10, 10 June 2011 (diff | hist) . . (+78)‎ . . Task 4: Homology based structure predictions ‎ (→‎Modeller)
• 11:09, 10 June 2011 (diff | hist) . . (+1,737)‎ . . Task 4: Homology based structure predictions ‎ (→‎Comparison to experimental structure)
• 11:06, 10 June 2011 (diff | hist) . . (0)‎ . . Task 4: Homology based structure predictions ‎ (→‎Comparison to experimental structure)
• 11:06, 10 June 2011 (diff | hist) . . (+11)‎ . . Task 4: Homology based structure predictions ‎ (→‎Modeller)
• 11:04, 10 June 2011 (diff | hist) . . (+546)‎ . . Task 4: Homology based structure predictions ‎
• 20:15, 8 June 2011 (diff | hist) . . (-1)‎ . . Task 4: Homology based structure predictions ‎ (→‎Homology modelling with Modeller)
• 20:04, 8 June 2011 (diff | hist) . . (+2)‎ . . Task 4: Homology based structure predictions ‎ (→‎Homology modelling with Modeller)
• 20:04, 8 June 2011 (diff | hist) . . (+17)‎ . . Task 4: Homology based structure predictions ‎ (→‎Homology modelling with Modeller)
• 19:59, 8 June 2011 (diff | hist) . . (+499)‎ . . Task 4: Homology based structure predictions ‎ (→‎Homology modelling with iTasser)
• 19:48, 8 June 2011 (diff | hist) . . (-29)‎ . . Task 4: Homology based structure predictions ‎ (→‎Task description)
• 19:46, 8 June 2011 (diff | hist) . . (+599)‎ . . Task 4: Homology based structure predictions ‎ (→‎Task description)
• 19:18, 8 June 2011 (diff | hist) . . (+443)‎ . . Task 4: Homology based structure predictions ‎ (→‎Homology modelling with Modeller)
• 15:48, 8 June 2011 (diff | hist) . . (+215)‎ . . Task 4: Homology based structure predictions ‎ (→‎Homology modelling with Modeller)
• 15:41, 8 June 2011 (diff | hist) . . (+401)‎ . . Task 4: Homology based structure predictions ‎ (→‎Homology modelling with Modeller)
• 15:36, 8 June 2011 (diff | hist) . . (-6)‎ . . Task 4: Homology based structure predictions ‎ (→‎Homology modelling with Modeller)
• 15:34, 8 June 2011 (diff | hist) . . (+1,528)‎ . . Task 4: Homology based structure predictions ‎ (→‎Homology modelling with Modeller)
• 15:04, 8 June 2011 (diff | hist) . . (+1)‎ . . Task 4: Homology based structure predictions ‎ (→‎Homology modelling with Modeller)
• 15:03, 8 June 2011 (diff | hist) . . (+914)‎ . . Task 4: Homology based structure predictions ‎ (→‎Homology modelling with Modeller)
• 14:52, 8 June 2011 (diff | hist) . . (+364)‎ . . Task 4: Homology based structure predictions ‎ (→‎Homology modelling with Modeller)
• 14:46, 8 June 2011 (diff | hist) . . (+367)‎ . . Task 4: Homology based structure predictions ‎ (→‎Homology modelling with Modeller)
• 14:46, 8 June 2011 (diff | hist) . . (0)‎ . . Resource software ‎ (→‎Python)
• 14:45, 8 June 2011 (diff | hist) . . (+194)‎ . . Resource software ‎ (→‎Modeller)
• 14:43, 8 June 2011 (diff | hist) . . (-5)‎ . . Resource software ‎ (→‎Modeller)
• 14:42, 8 June 2011 (diff | hist) . . (+5)‎ . . Resource software ‎ (→‎Modeller)
• 14:42, 8 June 2011 (diff | hist) . . (+22)‎ . . Resource software ‎ (→‎Modeller)
• 14:39, 8 June 2011 (diff | hist) . . (+650)‎ . . Resource software ‎
• 14:04, 8 June 2011 (diff | hist) . . (+1)‎ . . Phenylketonuria 2011 ‎
• 13:59, 8 June 2011 (diff | hist) . . (+21)‎ . . Phenylketonuria 2011 ‎ (→‎Mutations)
• 13:57, 8 June 2011 (diff | hist) . . (-4)‎ . . Phenylketonuria 2011 ‎ (→‎The PAH gene)
• 13:54, 8 June 2011 (diff | hist) . . (-2)‎ . . Phenylketonuria 2011 ‎ (→‎Phenotype)
• 13:53, 8 June 2011 (diff | hist) . . (+14)‎ . . Phenylketonuria 2011 ‎ (→‎Treatment of phenylketonuria)
• 13:51, 8 June 2011 (diff | hist) . . (+2)‎ . . Phenylketonuria 2011 ‎ (→‎Diagnosis of phenylketonuria)
• 13:49, 8 June 2011 (diff | hist) . . (+3)‎ . . Phenylketonuria 2011 ‎ (→‎Biochemical disease mechanism)
• 13:47, 8 June 2011 (diff | hist) . . (+2)‎ . . Phenylketonuria 2011 ‎ (→‎Phenotype)
• 13:42, 8 June 2011 (diff | hist) . . (-4)‎ . . Phenylketonuria 2011 ‎ (→‎Summary)
• 18:19, 7 June 2011 (diff | hist) . . (+789)‎ . . Resource software ‎
• 10:15, 7 June 2011 (diff | hist) . . (-50)‎ . . Task 3: Sequence-based predictions ‎ (→‎Discussion)
• 09:10, 7 June 2011 (diff | hist) . . (-382)‎ . . Task 3: Sequence-based predictions ‎ (→‎Discussion)
• 08:59, 7 June 2011 (diff | hist) . . (0)‎ . . Task 3: Sequence-based predictions ‎ (→‎DSSP)
• 08:58, 7 June 2011 (diff | hist) . . (0)‎ . . Task 3: Sequence-based predictions ‎ (→‎Result)
• 23:25, 6 June 2011 (diff | hist) . . (+202)‎ . . Poodle ‎ (→‎Poodle-W) (current)
• 23:12, 6 June 2011 (diff | hist) . . (+259)‎ . . Poodle ‎ (→‎Poodle-S)
• 22:59, 6 June 2011 (diff | hist) . . (+304)‎ . . Poodle ‎ (→‎Poodle-L)
• 22:52, 6 June 2011 (diff | hist) . . (+1)‎ . . Poodle ‎ (→‎Poodle-L)
• 22:52, 6 June 2011 (diff | hist) . . (-18)‎ . . Poodle ‎ (→‎Poodle)
• 22:50, 6 June 2011 (diff | hist) . . (+462)‎ . . Poodle ‎ (→‎Poodle)
• 22:40, 6 June 2011 (diff | hist) . . (+1,123)‎ . . N Poodle ‎ (Created page with "=Poodle= Poodle is a set of tools for the prediction of the secondary structures. The different programs uses different machine learning approaches. ==Poodle-L== {| style="f…")
• 22:21, 6 June 2011 (diff | hist) . . (-10)‎ . . Jpred ‎ (→‎Jnet) (current)
• 22:21, 6 June 2011 (diff | hist) . . (0)‎ . . Jpred ‎ (→‎Jnet)
• 22:21, 6 June 2011 (diff | hist) . . (-30)‎ . . Jpred ‎ (→‎Jnet)
• 22:04, 6 June 2011 (diff | hist) . . (-7)‎ . . Task 3: Sequence-based predictions ‎ (→‎PSIPRED)
• 22:01, 6 June 2011 (diff | hist) . . (+15)‎ . . Task 3: Sequence-based predictions ‎ (→‎Discussion)
• 21:54, 6 June 2011 (diff | hist) . . (-112)‎ . . Task 3: Sequence-based predictions ‎ (→‎Discussion)
• 21:52, 6 June 2011 (diff | hist) . . (+124)‎ . . Task 3: Sequence-based predictions ‎ (→‎Discussion)
• 21:49, 6 June 2011 (diff | hist) . . (0)‎ . . Task 3: Sequence-based predictions ‎ (→‎Discussion)
• 21:45, 6 June 2011 (diff | hist) . . (+1,594)‎ . . Task 3: Sequence-based predictions ‎ (→‎Task 3.2: Prediction of disordered regions)
• 20:56, 6 June 2011 (diff | hist) . . (+2,060)‎ . . Task 3: Sequence-based predictions ‎ (→‎Result)
• 20:53, 6 June 2011 (diff | hist) . . (+835)‎ . . Task 3: Sequence-based predictions ‎ (→‎Result)
• 20:36, 6 June 2011 (diff | hist) . . (+254)‎ . . Task 3: Sequence-based predictions ‎ (→‎Task 3.2: Prediction of disordered regions)
• 20:32, 6 June 2011 (diff | hist) . . (+24)‎ . . Task 3: Sequence-based predictions ‎ (→‎Discussion)
• 20:31, 6 June 2011 (diff | hist) . . (+186)‎ . . Task 3: Sequence-based predictions ‎ (→‎Discussion)
• 20:24, 6 June 2011 (diff | hist) . . (+527)‎ . . Task 3: Sequence-based predictions ‎ (→‎Discussion)
• 19:29, 6 June 2011 (diff | hist) . . (+1,534)‎ . . Task 3: Sequence-based predictions ‎
• 21:11, 5 June 2011 (diff | hist) . . (+38)‎ . . Task 3: Sequence-based predictions ‎ (→‎META-Disorder)
• 21:04, 5 June 2011 (diff | hist) . . (+858)‎ . . N Iupred ‎ (Created page with "=IUPred= ==Basic Information== {| style="float: right; border: 1px solid #BBB; margin: .46em 0 0 .2em;" ! Author | Zsuzsanna Dosztányia, Veronika Csizmóka, Péter Tompaa, Ist…") (current)
• 20:41, 5 June 2011 (diff | hist) . . (-1)‎ . . Disopred ‎ (current)
• 20:38, 5 June 2011 (diff | hist) . . (+22)‎ . . Disopred ‎
• 20:37, 5 June 2011 (diff | hist) . . (+737)‎ . . Disopred ‎
• 20:19, 5 June 2011 (diff | hist) . . (-45)‎ . . Disopred ‎
• 20:09, 5 June 2011 (diff | hist) . . (+387)‎ . . Disopred ‎
• 15:15, 3 June 2011 (diff | hist) . . (+3,506)‎ . . Task 3: Sequence-based predictions ‎ (→‎Result)
• 15:07, 3 June 2011 (diff | hist) . . (+90)‎ . . Task 3: Sequence-based predictions ‎ (→‎Result)
• 15:06, 3 June 2011 (diff | hist) . . (-20)‎ . . Task 3: Sequence-based predictions ‎ (→‎Result)
• 15:04, 3 June 2011 (diff | hist) . . (+13,520)‎ . . Task 3: Sequence-based predictions ‎ (→‎Task 3.2: Prediction of disordered regions)
• 13:55, 3 June 2011 (diff | hist) . . (+168)‎ . . Task 3: Sequence-based predictions ‎
• 13:22, 3 June 2011 (diff | hist) . . (-6)‎ . . Task 3: Sequence-based predictions ‎ (→‎Result)
• 13:21, 3 June 2011 (diff | hist) . . (+14)‎ . . Task 3: Sequence-based predictions ‎ (→‎Result)
• 13:19, 3 June 2011 (diff | hist) . . (+26)‎ . . Task 3: Sequence-based predictions ‎ (→‎Result)
• 13:17, 3 June 2011 (diff | hist) . . (-14)‎ . . Task 3: Sequence-based predictions ‎ (→‎Result)
• 13:08, 3 June 2011 (diff | hist) . . (+2)‎ . . Task 3: Sequence-based predictions ‎ (→‎Result)
• 13:08, 3 June 2011 (diff | hist) . . (+681)‎ . . Task 3: Sequence-based predictions ‎ (→‎Result)
• 12:43, 3 June 2011 (diff | hist) . . (+1,638)‎ . . Task 3: Sequence-based predictions ‎
• 22:10, 2 June 2011 (diff | hist) . . (0)‎ . . Dssp ‎ (→‎Details) (current)
• 22:10, 2 June 2011 (diff | hist) . . (-19)‎ . . Dssp ‎
• 22:09, 2 June 2011 (diff | hist) . . (+1,182)‎ . . N Dssp ‎ (Created page with "=DSSP - Define Secondary Structure of Proteins= ==Basic Information== {| style="float: right; border: 1px solid #BBB; margin: .46em 0 0 .2em;" ! Author | Kabsch W, Sander C. |- …")
• 21:56, 2 June 2011 (diff | hist) . . (0)‎ . . Jpred ‎
• 21:56, 2 June 2011 (diff | hist) . . (-71)‎ . . Jpred ‎
• 21:55, 2 June 2011 (diff | hist) . . (+1,119)‎ . . N Jpred ‎ (Created page with "=Jpred= ==Basic Information== {| style="float: right; border: 1px solid #BBB; margin: .46em 0 0 .2em;" | Jnet |- ! Author | James A. Cuff, Geoffrey J. Barton |- ! Year | 2000 |-…")
• 21:38, 2 June 2011 (diff | hist) . . (+24)‎ . . Task 3: Sequence-based predictions ‎
• 21:37, 2 June 2011 (diff | hist) . . (+875)‎ . . Task 3: Sequence-based predictions ‎
• 21:33, 2 June 2011 (diff | hist) . . (+412)‎ . . Psipred ‎ (→‎Basic Information) (current)
• 21:24, 2 June 2011 (diff | hist) . . (0)‎ . . Psipred ‎ (→‎Basic Information)
• 21:24, 2 June 2011 (diff | hist) . . (-14)‎ . . Psipred ‎ (→‎Basic Information)
• 21:23, 2 June 2011 (diff | hist) . . (+1,576)‎ . . Psipred ‎
• 21:02, 2 June 2011 (diff | hist) . . (+79)‎ . . Psipred ‎
• 20:59, 2 June 2011 (diff | hist) . . (-2)‎ . . Psipred ‎
• 20:59, 2 June 2011 (diff | hist) . . (+136)‎ . . Psipred ‎
• 20:53, 2 June 2011 (diff | hist) . . (+27)‎ . . Psipred ‎
• 20:51, 2 June 2011 (diff | hist) . . (+33)‎ . . Task 3 - Sequence-based predictions 2011 ‎
• 14:47, 24 May 2011 (diff | hist) . . (-184)‎ . . Psipred ‎
• 14:08, 24 May 2011 (diff | hist) . . (+266)‎ . . Psipred ‎
• 13:48, 24 May 2011 (diff | hist) . . (+13)‎ . . Psipred ‎
• 13:47, 24 May 2011 (diff | hist) . . (+17)‎ . . Psipred ‎
• 13:46, 24 May 2011 (diff | hist) . . (+4)‎ . . Psipred ‎
• 13:46, 24 May 2011 (diff | hist) . . (+68)‎ . . Psipred ‎
• 13:45, 24 May 2011 (diff | hist) . . (+583)‎ . . N Psipred ‎ (Created page with "=PSIPRED= ==running locally== Change in /apps/psipred_3.2/runpsipred the following lines: <code> # The name of the BLAST data bank set dbname = /data/blast/swiss/uniprot_sprot.…")
• 13:42, 24 May 2011 (diff | hist) . . (+1)‎ . . Task 3 - Sequence-based predictions 2011 ‎ (→‎1. Secondary structure prediction)
• 13:41, 24 May 2011 (diff | hist) . . (+58)‎ . . Task 3 - Sequence-based predictions 2011 ‎ (→‎1. Secondary structure prediction)
• 22:33, 23 May 2011 (diff | hist) . . (-406)‎ . . Task 2: Sequence alignments (sequence searches and multiple alignments) ‎ (→‎Overlap)
• 22:23, 23 May 2011 (diff | hist) . . (+1)‎ . . Task 2: Sequence alignments (sequence searches and multiple alignments) ‎ (→‎Overlap)
• 22:22, 23 May 2011 (diff | hist) . . (+109)‎ . . Task 2: Sequence alignments (sequence searches and multiple alignments) ‎ (→‎Overlap)
• 22:21, 23 May 2011 (diff | hist) . . (+1,007)‎ . . Task 2: Sequence alignments (sequence searches and multiple alignments) ‎
• 21:56, 23 May 2011 (diff | hist) . . (+17)‎ . . Task 2: Sequence alignments (sequence searches and multiple alignments) ‎
• 21:55, 23 May 2011 (diff | hist) . . (+83)‎ . . Task 2: Sequence alignments (sequence searches and multiple alignments) ‎
• 21:49, 23 May 2011 (diff | hist) . . (+1,750)‎ . . Task 2: Sequence alignments (sequence searches and multiple alignments) ‎ (→‎Comparing the Results)
• 20:43, 23 May 2011 (diff | hist) . . (-38)‎ . . Task 2: Sequence alignments (sequence searches and multiple alignments) ‎ (→‎Summary)
• 20:36, 23 May 2011 (diff | hist) . . (+2,709)‎ . . Task 2: Sequence alignments (sequence searches and multiple alignments) ‎ (→‎Comparing the Results)
• 19:22, 23 May 2011 (diff | hist) . . (+78)‎ . . Task 2: Sequence alignments (sequence searches and multiple alignments) ‎
• 19:17, 23 May 2011 (diff | hist) . . (+36)‎ . . Task 2: Sequence alignments (sequence searches and multiple alignments) ‎
• 19:15, 23 May 2011 (diff | hist) . . (0)‎ . . N File:Pah psi simple.hhsearch identity.png ‎ (current)
• 19:15, 23 May 2011 (diff | hist) . . (0)‎ . . N File:Pah psi simple.hhsearch score.png ‎ (current)
• 19:14, 23 May 2011 (diff | hist) . . (0)‎ . . N File:Pah psi simple.hhsearch coverage.png ‎ (current)
• 19:14, 23 May 2011 (diff | hist) . . (0)‎ . . N File:Pah psi e10E-6 i3.hhsearch identity.png ‎ (current)
• 19:14, 23 May 2011 (diff | hist) . . (0)‎ . . N File:Pah psi e10E-6 i3.hhsearch score.png ‎ (current)
• 19:13, 23 May 2011 (diff | hist) . . (0)‎ . . N File:Pah psi e10E-6 i3.hhsearch coverage.png ‎ (current)
• 19:13, 23 May 2011 (diff | hist) . . (0)‎ . . N File:Pah psi e005 i3.hhsearch identity.png ‎ (current)
• 19:12, 23 May 2011 (diff | hist) . . (0)‎ . . N File:Pah psi e005 i3.hhsearch score.png ‎ (current)
• 19:12, 23 May 2011 (diff | hist) . . (0)‎ . . File:Pah psi e005 i3.hhsearch coverage.png ‎ (uploaded a new version of "File:Pah psi e005 i3.hhsearch coverage.png") (current)
• 19:11, 23 May 2011 (diff | hist) . . (0)‎ . . File:Pah psi e005 i3.hhsearch coverage.png ‎ (uploaded a new version of "File:Pah psi e005 i3.hhsearch coverage.png")
• 19:11, 23 May 2011 (diff | hist) . . (0)‎ . . N File:Pah psi e005 i3.hhsearch coverage.png ‎
• 19:10, 23 May 2011 (diff | hist) . . (0)‎ . . N File:Pah psi e005 i5.hhsearch identity.png ‎ (current)
• 19:09, 23 May 2011 (diff | hist) . . (0)‎ . . N File:Pah psi e005 i5.hhsearch score.png ‎ (current)
• 19:09, 23 May 2011 (diff | hist) . . (0)‎ . . N File:Pah psi e005 i5.hhsearch coverage.png ‎ (current)
• 19:09, 23 May 2011 (diff | hist) . . (0)‎ . . N File:Pah psi e10E-6 i5.hhsearch identity.png ‎ (current)
• 19:08, 23 May 2011 (diff | hist) . . (0)‎ . . N File:Pah psi e10E-6 i5.hhsearch score.png ‎ (current)
• 19:07, 23 May 2011 (diff | hist) . . (+1,147)‎ . . Task 2: Sequence alignments (sequence searches and multiple alignments) ‎ (→‎HHSearch)
• 18:56, 23 May 2011 (diff | hist) . . (0)‎ . . N File:Pah psi e10E-6 i5.hhsearch coverage.png ‎ (current)
• 18:51, 23 May 2011 (diff | hist) . . (0)‎ . . File:Pah psi 005 i5 identity.png ‎ (uploaded a new version of "File:Pah psi 005 i5 identity.png") (current)
• 18:51, 23 May 2011 (diff | hist) . . (0)‎ . . File:Pah psi 005 i5 coverage.png ‎ (uploaded a new version of "File:Pah psi 005 i5 coverage.png") (current)
• 18:49, 23 May 2011 (diff | hist) . . (0)‎ . . File:Pah psi 005 i3 identity.png ‎ (uploaded a new version of "File:Pah psi 005 i3 identity.png") (current)
• 18:48, 23 May 2011 (diff | hist) . . (0)‎ . . File:Pah psi 005 i3 coverage.png ‎ (uploaded a new version of "File:Pah psi 005 i3 coverage.png") (current)
• 18:46, 23 May 2011 (diff | hist) . . (0)‎ . . File:Pah psi 005 i3 coverage.png ‎ (uploaded a new version of "File:Pah psi 005 i3 coverage.png")
• 18:44, 23 May 2011 (diff | hist) . . (0)‎ . . File:Pah psi 10E-6 i3 coverage.png ‎ (uploaded a new version of "File:Pah psi 10E-6 i3 coverage.png") (current)
• 18:43, 23 May 2011 (diff | hist) . . (0)‎ . . File:Pah psi 10E-6 i3 similarity.png ‎ (uploaded a new version of "File:Pah psi 10E-6 i3 similarity.png") (current)
• 18:42, 23 May 2011 (diff | hist) . . (0)‎ . . File:Pah psi 10E-6 i3 score.png ‎ (uploaded a new version of "File:Pah psi 10E-6 i3 score.png") (current)
• 18:40, 23 May 2011 (diff | hist) . . (0)‎ . . N File:Pah psi 005 i3 identity.png ‎
• 18:40, 23 May 2011 (diff | hist) . . (0)‎ . . N File:Pah psi 005 i3 score.png ‎ (current)
• 18:39, 23 May 2011 (diff | hist) . . (0)‎ . . N File:Pah psi 005 i3 coverage.png ‎
• 18:38, 23 May 2011 (diff | hist) . . (0)‎ . . N File:Pah psi 10E-6 i5 identity.png ‎ (current)
• 18:38, 23 May 2011 (diff | hist) . . (0)‎ . . N File:Pah psi 10E-6 i5 score.png ‎ (current)
• 18:38, 23 May 2011 (diff | hist) . . (0)‎ . . N File:Pah psi 10E-6 i5 coverage.png ‎ (current)
• 18:36, 23 May 2011 (diff | hist) . . (+31)‎ . . N File:Pah psi 005 i3.blast identity.png ‎ (PAH PSI-Blast Search - Identity) (current)
• 18:33, 23 May 2011 (diff | hist) . . (+31)‎ . . N File:Pah psi 10E-6 i3.blast coverage.png ‎ (PAH PSI-Blast Search - Identity) (current)
• 18:32, 23 May 2011 (diff | hist) . . (0)‎ . . File:Pah psi 10E-6 i3 identity.png ‎ (uploaded a new version of "File:Pah psi 10E-6 i3 identity.png": PAH PSI-Blast Search - Identity) (current)
• 18:17, 23 May 2011 (diff | hist) . . (+31)‎ . . N File:Pah psi 10E-6 i3 identity.png ‎ (PAH PSI-Blast Search - Identity)
• 18:16, 23 May 2011 (diff | hist) . . (+31)‎ . . N File:Pah psi 005 i5 identity.png ‎ (PAH PSI-Blast Search - Identity)
• 18:15, 23 May 2011 (diff | hist) . . (+28)‎ . . N File:Pah psi 005 i5 score.png ‎ (PAH PSI-Blast Search - Score) (current)
• 18:15, 23 May 2011 (diff | hist) . . (+31)‎ . . N File:Pah psi 005 i5 coverage.png ‎ (PAH PSI-Blast Search - Coverage)
• 18:14, 23 May 2011 (diff | hist) . . (+33)‎ . . N File:Pah psi 10E-6 i3 similarity.png ‎ (PAH PSI-Blast Search - Similarity)
• 18:14, 23 May 2011 (diff | hist) . . (+28)‎ . . N File:Pah psi 10E-6 i3 score.png ‎ (PAH PSI-Blast Search - Score)
• 18:12, 23 May 2011 (diff | hist) . . (+1,414)‎ . . Task 2: Sequence alignments (sequence searches and multiple alignments) ‎ (→‎PSI-BLAST)
• 18:10, 23 May 2011 (diff | hist) . . (+31)‎ . . N File:Pah psi 10E-6 i3 coverage.png ‎ (PAH PSI-Blast Search - Coverage)
• 17:56, 23 May 2011 (diff | hist) . . (+154)‎ . . Task 2: Sequence alignments (sequence searches and multiple alignments) ‎ (→‎Results)
• 17:56, 23 May 2011 (diff | hist) . . (+27)‎ . . N File:Pah.fasta search identity.png ‎ (PAH FASTA Search - Identity) (current)
• 17:55, 23 May 2011 (diff | hist) . . (+27)‎ . . N File:Pah.fasta search score.png ‎ (PAH FASTA Search - Coverage) (current)
• 17:54, 23 May 2011 (diff | hist) . . (0)‎ . . File:Pah.fasta search coverage.png ‎ (current)
• 17:54, 23 May 2011 (diff | hist) . . (+27)‎ . . N File:Pah.fasta search coverage.png ‎ (PAH BLAST Search - Coverage)
• 17:52, 23 May 2011 (diff | hist) . . (+139)‎ . . Task 2: Sequence alignments (sequence searches and multiple alignments) ‎ (→‎Results)
• 17:51, 23 May 2011 (diff | hist) . . (+27)‎ . . N File:Pah.blast identity.png ‎ (PAH BLAST Search - Identity) (current)
• 17:50, 23 May 2011 (diff | hist) . . (+24)‎ . . N File:Pah.blast score.png ‎ (PAH BLAST Search - Score) (current)
• 17:49, 23 May 2011 (diff | hist) . . (+27)‎ . . N File:Pah.blast coverage.png ‎ (PAH BLAST Search - Coverage) (current)
• 17:36, 23 May 2011 (diff | hist) . . (+33)‎ . . Phenylalanine hydroxylase reference ‎ (current)
• 17:35, 23 May 2011 (diff | hist) . . (+5,323)‎ . . Task 2: Sequence alignments (sequence searches and multiple alignments) ‎
• 12:38, 22 May 2011 (diff | hist) . . (+1)‎ . . Task 2 - Alignments with PAH Reference ‎ (current)
• 12:38, 22 May 2011 (diff | hist) . . (+17)‎ . . Task 2 - Alignments with PAH Reference ‎
• 12:36, 22 May 2011 (diff | hist) . . (+106)‎ . . Task 2 - Alignments with PAH Reference ‎ (→‎HSSP - More Positives)
• 12:27, 22 May 2011 (diff | hist) . . (-47)‎ . . Task 2 - Alignments with PAH Reference ‎
• 12:23, 22 May 2011 (diff | hist) . . (+609)‎ . . Task 2 - Alignments with PAH Reference ‎
• 12:16, 22 May 2011 (diff | hist) . . (-12)‎ . . Task 2 - Alignments with PAH Reference ‎
• 11:59, 22 May 2011 (diff | hist) . . (-49)‎ . . Task 2 - Alignments with PAH Reference ‎
• 11:53, 22 May 2011 (diff | hist) . . (+18)‎ . . Task 2 - Alignments with PAH Reference ‎
• 11:51, 22 May 2011 (diff | hist) . . (+31)‎ . . Task 2 - Alignments with PAH Reference ‎
• 11:45, 22 May 2011 (diff | hist) . . (-44)‎ . . Task 2 - Alignments with PAH Reference ‎
• 11:43, 22 May 2011 (diff | hist) . . (+28)‎ . . Task 2 - Alignments with PAH Reference ‎
• 11:36, 22 May 2011 (diff | hist) . . (+1)‎ . . Task 2 - Alignments with PAH Reference ‎
• 11:35, 22 May 2011 (diff | hist) . . (+4,729)‎ . . N Task 2 - Alignments with PAH Reference ‎ (New page: =Task 2 - Alignments with PAH Reference= ==Sequence Searches== ===BLAST== ====Running==== time sudo blastall -p blastp -d '/data/blast/nr/nr' -i /home/student/workspace/reference.fasta -...)
• 11:20, 22 May 2011 (diff | hist) . . (+45)‎ . . Phenylalanine hydroxylase reference ‎
• 21:44, 15 May 2011 (diff | hist) . . (+370)‎ . . Phenylketonuria 2011 ‎
• 12:35, 6 May 2011 (diff | hist) . . (-80)‎ . . Phenylketonuria 2011 ‎
• 12:34, 6 May 2011 (diff | hist) . . (-8)‎ . . Phenylketonuria 2011 ‎
• 12:31, 6 May 2011 (diff | hist) . . (+113)‎ . . Phenylketonuria 2011 ‎
• 12:22, 6 May 2011 (diff | hist) . . (-9)‎ . . Phenylalanine hydroxylase reference ‎
• 12:22, 6 May 2011 (diff | hist) . . (-104)‎ . . Phenylalanine hydroxylase reference ‎
• 12:21, 6 May 2011 (diff | hist) . . (-6)‎ . . Phenylalanine hydroxylase reference ‎
• 12:21, 6 May 2011 (diff | hist) . . (0)‎ . . Phenylalanine hydroxylase reference ‎
• 12:20, 6 May 2011 (diff | hist) . . (-4)‎ . . Phenylalanine hydroxylase reference ‎
• 12:16, 6 May 2011 (diff | hist) . . (+155)‎ . . Phenylalanine hydroxylase reference ‎
• 12:15, 6 May 2011 (diff | hist) . . (+4)‎ . . Phenylalanine hydroxylase reference ‎
• 12:15, 6 May 2011 (diff | hist) . . (-3)‎ . . Phenylalanine hydroxylase reference ‎
• 12:14, 6 May 2011 (diff | hist) . . (+5)‎ . . Phenylalanine hydroxylase reference ‎
• 12:14, 6 May 2011 (diff | hist) . . (-4)‎ . . Phenylalanine hydroxylase reference ‎
• 12:13, 6 May 2011 (diff | hist) . . (+4)‎ . . Phenylalanine hydroxylase reference ‎
• 12:12, 6 May 2011 (diff | hist) . . (+662)‎ . . N Phenylalanine hydroxylase reference ‎ (New page: == Sequence == <nowiki>MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEE VGALAKVLRLFEENDVNLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDI GATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQ F...)
• 12:03, 6 May 2011 (diff | hist) . . (-122)‎ . . Phenylketonuria 2011 ‎
• 11:33, 6 May 2011 (diff | hist) . . (+2,733)‎ . . N Phenylketonuria 2011 ‎ (New page: = still under construction = == Summary == Phenylketonuria causes several syndromes: * Delayed mental and social skills * Head size significantly below normal * Hyperactivity * Jerking mo...)
• 10:25, 6 May 2011 (diff | hist) . . (+3)‎ . . Disease list 2011 ‎
• 10:23, 6 May 2011 (diff | hist) . . (+23)‎ . . Protein Structure and Function Analysis (version: SS 2011) ‎

(newest | oldest) View (newer 500 | older 500) (20 | 50 | 100 | 250 | 500)