User contributions
From Bioinformatikpedia
(newest | oldest) View (newer 100 | older 100) (20 | 50 | 100 | 250 | 500)
- 12:41, 24 May 2011 (diff | hist) . . (+58) . . Task 3 - Sequence-based predictions 2011 (→1. Secondary structure prediction)
- 21:33, 23 May 2011 (diff | hist) . . (-406) . . Task 2: Sequence alignments (sequence searches and multiple alignments) (→Overlap)
- 21:23, 23 May 2011 (diff | hist) . . (+1) . . Task 2: Sequence alignments (sequence searches and multiple alignments) (→Overlap)
- 21:22, 23 May 2011 (diff | hist) . . (+109) . . Task 2: Sequence alignments (sequence searches and multiple alignments) (→Overlap)
- 21:21, 23 May 2011 (diff | hist) . . (+1,007) . . Task 2: Sequence alignments (sequence searches and multiple alignments)
- 20:56, 23 May 2011 (diff | hist) . . (+17) . . Task 2: Sequence alignments (sequence searches and multiple alignments)
- 20:55, 23 May 2011 (diff | hist) . . (+83) . . Task 2: Sequence alignments (sequence searches and multiple alignments)
- 20:49, 23 May 2011 (diff | hist) . . (+1,750) . . Task 2: Sequence alignments (sequence searches and multiple alignments) (→Comparing the Results)
- 19:43, 23 May 2011 (diff | hist) . . (-38) . . Task 2: Sequence alignments (sequence searches and multiple alignments) (→Summary)
- 19:36, 23 May 2011 (diff | hist) . . (+2,709) . . Task 2: Sequence alignments (sequence searches and multiple alignments) (→Comparing the Results)
- 18:22, 23 May 2011 (diff | hist) . . (+78) . . Task 2: Sequence alignments (sequence searches and multiple alignments)
- 18:17, 23 May 2011 (diff | hist) . . (+36) . . Task 2: Sequence alignments (sequence searches and multiple alignments)
- 18:15, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi simple.hhsearch identity.png (current)
- 18:15, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi simple.hhsearch score.png (current)
- 18:14, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi simple.hhsearch coverage.png (current)
- 18:14, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e10E-6 i3.hhsearch identity.png (current)
- 18:14, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e10E-6 i3.hhsearch score.png (current)
- 18:13, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e10E-6 i3.hhsearch coverage.png (current)
- 18:13, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e005 i3.hhsearch identity.png (current)
- 18:12, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e005 i3.hhsearch score.png (current)
- 18:12, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi e005 i3.hhsearch coverage.png (uploaded a new version of "File:Pah psi e005 i3.hhsearch coverage.png") (current)
- 18:11, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi e005 i3.hhsearch coverage.png (uploaded a new version of "File:Pah psi e005 i3.hhsearch coverage.png")
- 18:11, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e005 i3.hhsearch coverage.png
- 18:10, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e005 i5.hhsearch identity.png (current)
- 18:09, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e005 i5.hhsearch score.png (current)
- 18:09, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e005 i5.hhsearch coverage.png (current)
- 18:09, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e10E-6 i5.hhsearch identity.png (current)
- 18:08, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e10E-6 i5.hhsearch score.png (current)
- 18:07, 23 May 2011 (diff | hist) . . (+1,147) . . Task 2: Sequence alignments (sequence searches and multiple alignments) (→HHSearch)
- 17:56, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e10E-6 i5.hhsearch coverage.png (current)
- 17:51, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi 005 i5 identity.png (uploaded a new version of "File:Pah psi 005 i5 identity.png") (current)
- 17:51, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi 005 i5 coverage.png (uploaded a new version of "File:Pah psi 005 i5 coverage.png") (current)
- 17:49, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi 005 i3 identity.png (uploaded a new version of "File:Pah psi 005 i3 identity.png") (current)
- 17:48, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi 005 i3 coverage.png (uploaded a new version of "File:Pah psi 005 i3 coverage.png") (current)
- 17:46, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi 005 i3 coverage.png (uploaded a new version of "File:Pah psi 005 i3 coverage.png")
- 17:44, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi 10E-6 i3 coverage.png (uploaded a new version of "File:Pah psi 10E-6 i3 coverage.png") (current)
- 17:43, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi 10E-6 i3 similarity.png (uploaded a new version of "File:Pah psi 10E-6 i3 similarity.png") (current)
- 17:42, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi 10E-6 i3 score.png (uploaded a new version of "File:Pah psi 10E-6 i3 score.png") (current)
- 17:40, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi 005 i3 identity.png
- 17:40, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi 005 i3 score.png (current)
- 17:39, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi 005 i3 coverage.png
- 17:38, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi 10E-6 i5 identity.png (current)
- 17:38, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi 10E-6 i5 score.png (current)
- 17:38, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi 10E-6 i5 coverage.png (current)
- 17:36, 23 May 2011 (diff | hist) . . (+31) . . N File:Pah psi 005 i3.blast identity.png (PAH PSI-Blast Search - Identity) (current)
- 17:33, 23 May 2011 (diff | hist) . . (+31) . . N File:Pah psi 10E-6 i3.blast coverage.png (PAH PSI-Blast Search - Identity) (current)
- 17:32, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi 10E-6 i3 identity.png (uploaded a new version of "File:Pah psi 10E-6 i3 identity.png": PAH PSI-Blast Search - Identity) (current)
- 17:17, 23 May 2011 (diff | hist) . . (+31) . . N File:Pah psi 10E-6 i3 identity.png (PAH PSI-Blast Search - Identity)
- 17:16, 23 May 2011 (diff | hist) . . (+31) . . N File:Pah psi 005 i5 identity.png (PAH PSI-Blast Search - Identity)
- 17:15, 23 May 2011 (diff | hist) . . (+28) . . N File:Pah psi 005 i5 score.png (PAH PSI-Blast Search - Score) (current)
- 17:15, 23 May 2011 (diff | hist) . . (+31) . . N File:Pah psi 005 i5 coverage.png (PAH PSI-Blast Search - Coverage)
- 17:14, 23 May 2011 (diff | hist) . . (+33) . . N File:Pah psi 10E-6 i3 similarity.png (PAH PSI-Blast Search - Similarity)
- 17:14, 23 May 2011 (diff | hist) . . (+28) . . N File:Pah psi 10E-6 i3 score.png (PAH PSI-Blast Search - Score)
- 17:12, 23 May 2011 (diff | hist) . . (+1,414) . . Task 2: Sequence alignments (sequence searches and multiple alignments) (→PSI-BLAST)
- 17:10, 23 May 2011 (diff | hist) . . (+31) . . N File:Pah psi 10E-6 i3 coverage.png (PAH PSI-Blast Search - Coverage)
- 16:56, 23 May 2011 (diff | hist) . . (+154) . . Task 2: Sequence alignments (sequence searches and multiple alignments) (→Results)
- 16:56, 23 May 2011 (diff | hist) . . (+27) . . N File:Pah.fasta search identity.png (PAH FASTA Search - Identity) (current)
- 16:55, 23 May 2011 (diff | hist) . . (+27) . . N File:Pah.fasta search score.png (PAH FASTA Search - Coverage) (current)
- 16:54, 23 May 2011 (diff | hist) . . (0) . . File:Pah.fasta search coverage.png (current)
- 16:54, 23 May 2011 (diff | hist) . . (+27) . . N File:Pah.fasta search coverage.png (PAH BLAST Search - Coverage)
- 16:52, 23 May 2011 (diff | hist) . . (+139) . . Task 2: Sequence alignments (sequence searches and multiple alignments) (→Results)
- 16:51, 23 May 2011 (diff | hist) . . (+27) . . N File:Pah.blast identity.png (PAH BLAST Search - Identity) (current)
- 16:50, 23 May 2011 (diff | hist) . . (+24) . . N File:Pah.blast score.png (PAH BLAST Search - Score) (current)
- 16:49, 23 May 2011 (diff | hist) . . (+27) . . N File:Pah.blast coverage.png (PAH BLAST Search - Coverage) (current)
- 16:36, 23 May 2011 (diff | hist) . . (+33) . . Phenylalanine hydroxylase reference (current)
- 16:35, 23 May 2011 (diff | hist) . . (+5,323) . . Task 2: Sequence alignments (sequence searches and multiple alignments)
- 11:38, 22 May 2011 (diff | hist) . . (+1) . . Task 2 - Alignments with PAH Reference (current)
- 11:38, 22 May 2011 (diff | hist) . . (+17) . . Task 2 - Alignments with PAH Reference
- 11:36, 22 May 2011 (diff | hist) . . (+106) . . Task 2 - Alignments with PAH Reference (→HSSP - More Positives)
- 11:27, 22 May 2011 (diff | hist) . . (-47) . . Task 2 - Alignments with PAH Reference
- 11:23, 22 May 2011 (diff | hist) . . (+609) . . Task 2 - Alignments with PAH Reference
- 11:16, 22 May 2011 (diff | hist) . . (-12) . . Task 2 - Alignments with PAH Reference
- 10:59, 22 May 2011 (diff | hist) . . (-49) . . Task 2 - Alignments with PAH Reference
- 10:53, 22 May 2011 (diff | hist) . . (+18) . . Task 2 - Alignments with PAH Reference
- 10:51, 22 May 2011 (diff | hist) . . (+31) . . Task 2 - Alignments with PAH Reference
- 10:45, 22 May 2011 (diff | hist) . . (-44) . . Task 2 - Alignments with PAH Reference
- 10:43, 22 May 2011 (diff | hist) . . (+28) . . Task 2 - Alignments with PAH Reference
- 10:36, 22 May 2011 (diff | hist) . . (+1) . . Task 2 - Alignments with PAH Reference
- 10:35, 22 May 2011 (diff | hist) . . (+4,729) . . N Task 2 - Alignments with PAH Reference (New page: =Task 2 - Alignments with PAH Reference= ==Sequence Searches== ===BLAST== ====Running==== time sudo blastall -p blastp -d '/data/blast/nr/nr' -i /home/student/workspace/reference.fasta -...)
- 10:20, 22 May 2011 (diff | hist) . . (+45) . . Phenylalanine hydroxylase reference
- 20:44, 15 May 2011 (diff | hist) . . (+370) . . Phenylketonuria 2011
- 11:35, 6 May 2011 (diff | hist) . . (-80) . . Phenylketonuria 2011
- 11:34, 6 May 2011 (diff | hist) . . (-8) . . Phenylketonuria 2011
- 11:31, 6 May 2011 (diff | hist) . . (+113) . . Phenylketonuria 2011
- 11:22, 6 May 2011 (diff | hist) . . (-9) . . Phenylalanine hydroxylase reference
- 11:22, 6 May 2011 (diff | hist) . . (-104) . . Phenylalanine hydroxylase reference
- 11:21, 6 May 2011 (diff | hist) . . (-6) . . Phenylalanine hydroxylase reference
- 11:21, 6 May 2011 (diff | hist) . . (0) . . Phenylalanine hydroxylase reference
- 11:20, 6 May 2011 (diff | hist) . . (-4) . . Phenylalanine hydroxylase reference
- 11:16, 6 May 2011 (diff | hist) . . (+155) . . Phenylalanine hydroxylase reference
- 11:15, 6 May 2011 (diff | hist) . . (+4) . . Phenylalanine hydroxylase reference
- 11:15, 6 May 2011 (diff | hist) . . (-3) . . Phenylalanine hydroxylase reference
- 11:14, 6 May 2011 (diff | hist) . . (+5) . . Phenylalanine hydroxylase reference
- 11:14, 6 May 2011 (diff | hist) . . (-4) . . Phenylalanine hydroxylase reference
- 11:13, 6 May 2011 (diff | hist) . . (+4) . . Phenylalanine hydroxylase reference
- 11:12, 6 May 2011 (diff | hist) . . (+662) . . N Phenylalanine hydroxylase reference (New page: == Sequence == <nowiki>MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEE VGALAKVLRLFEENDVNLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDI GATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQ F...)
- 11:03, 6 May 2011 (diff | hist) . . (-122) . . Phenylketonuria 2011
- 10:33, 6 May 2011 (diff | hist) . . (+2,733) . . N Phenylketonuria 2011 (New page: = still under construction = == Summary == Phenylketonuria causes several syndromes: * Delayed mental and social skills * Head size significantly below normal * Hyperactivity * Jerking mo...)
- 09:25, 6 May 2011 (diff | hist) . . (+3) . . Disease list 2011
- 09:23, 6 May 2011 (diff | hist) . . (+23) . . Protein Structure and Function Analysis (version: SS 2011)