User contributions
From Bioinformatikpedia
(newest | oldest) View (newer 100 | older 100) (20 | 50 | 100 | 250 | 500)
- 13:41, 24 May 2011 (diff | hist) . . (+58) . . Task 3 - Sequence-based predictions 2011 (→1. Secondary structure prediction)
- 22:33, 23 May 2011 (diff | hist) . . (-406) . . Task 2: Sequence alignments (sequence searches and multiple alignments) (→Overlap)
- 22:23, 23 May 2011 (diff | hist) . . (+1) . . Task 2: Sequence alignments (sequence searches and multiple alignments) (→Overlap)
- 22:22, 23 May 2011 (diff | hist) . . (+109) . . Task 2: Sequence alignments (sequence searches and multiple alignments) (→Overlap)
- 22:21, 23 May 2011 (diff | hist) . . (+1,007) . . Task 2: Sequence alignments (sequence searches and multiple alignments)
- 21:56, 23 May 2011 (diff | hist) . . (+17) . . Task 2: Sequence alignments (sequence searches and multiple alignments)
- 21:55, 23 May 2011 (diff | hist) . . (+83) . . Task 2: Sequence alignments (sequence searches and multiple alignments)
- 21:49, 23 May 2011 (diff | hist) . . (+1,750) . . Task 2: Sequence alignments (sequence searches and multiple alignments) (→Comparing the Results)
- 20:43, 23 May 2011 (diff | hist) . . (-38) . . Task 2: Sequence alignments (sequence searches and multiple alignments) (→Summary)
- 20:36, 23 May 2011 (diff | hist) . . (+2,709) . . Task 2: Sequence alignments (sequence searches and multiple alignments) (→Comparing the Results)
- 19:22, 23 May 2011 (diff | hist) . . (+78) . . Task 2: Sequence alignments (sequence searches and multiple alignments)
- 19:17, 23 May 2011 (diff | hist) . . (+36) . . Task 2: Sequence alignments (sequence searches and multiple alignments)
- 19:15, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi simple.hhsearch identity.png (current)
- 19:15, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi simple.hhsearch score.png (current)
- 19:14, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi simple.hhsearch coverage.png (current)
- 19:14, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e10E-6 i3.hhsearch identity.png (current)
- 19:14, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e10E-6 i3.hhsearch score.png (current)
- 19:13, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e10E-6 i3.hhsearch coverage.png (current)
- 19:13, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e005 i3.hhsearch identity.png (current)
- 19:12, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e005 i3.hhsearch score.png (current)
- 19:12, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi e005 i3.hhsearch coverage.png (uploaded a new version of "File:Pah psi e005 i3.hhsearch coverage.png") (current)
- 19:11, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi e005 i3.hhsearch coverage.png (uploaded a new version of "File:Pah psi e005 i3.hhsearch coverage.png")
- 19:11, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e005 i3.hhsearch coverage.png
- 19:10, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e005 i5.hhsearch identity.png (current)
- 19:09, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e005 i5.hhsearch score.png (current)
- 19:09, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e005 i5.hhsearch coverage.png (current)
- 19:09, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e10E-6 i5.hhsearch identity.png (current)
- 19:08, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e10E-6 i5.hhsearch score.png (current)
- 19:07, 23 May 2011 (diff | hist) . . (+1,147) . . Task 2: Sequence alignments (sequence searches and multiple alignments) (→HHSearch)
- 18:56, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi e10E-6 i5.hhsearch coverage.png (current)
- 18:51, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi 005 i5 identity.png (uploaded a new version of "File:Pah psi 005 i5 identity.png") (current)
- 18:51, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi 005 i5 coverage.png (uploaded a new version of "File:Pah psi 005 i5 coverage.png") (current)
- 18:49, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi 005 i3 identity.png (uploaded a new version of "File:Pah psi 005 i3 identity.png") (current)
- 18:48, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi 005 i3 coverage.png (uploaded a new version of "File:Pah psi 005 i3 coverage.png") (current)
- 18:46, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi 005 i3 coverage.png (uploaded a new version of "File:Pah psi 005 i3 coverage.png")
- 18:44, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi 10E-6 i3 coverage.png (uploaded a new version of "File:Pah psi 10E-6 i3 coverage.png") (current)
- 18:43, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi 10E-6 i3 similarity.png (uploaded a new version of "File:Pah psi 10E-6 i3 similarity.png") (current)
- 18:42, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi 10E-6 i3 score.png (uploaded a new version of "File:Pah psi 10E-6 i3 score.png") (current)
- 18:40, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi 005 i3 identity.png
- 18:40, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi 005 i3 score.png (current)
- 18:39, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi 005 i3 coverage.png
- 18:38, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi 10E-6 i5 identity.png (current)
- 18:38, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi 10E-6 i5 score.png (current)
- 18:38, 23 May 2011 (diff | hist) . . (0) . . N File:Pah psi 10E-6 i5 coverage.png (current)
- 18:36, 23 May 2011 (diff | hist) . . (+31) . . N File:Pah psi 005 i3.blast identity.png (PAH PSI-Blast Search - Identity) (current)
- 18:33, 23 May 2011 (diff | hist) . . (+31) . . N File:Pah psi 10E-6 i3.blast coverage.png (PAH PSI-Blast Search - Identity) (current)
- 18:32, 23 May 2011 (diff | hist) . . (0) . . File:Pah psi 10E-6 i3 identity.png (uploaded a new version of "File:Pah psi 10E-6 i3 identity.png": PAH PSI-Blast Search - Identity) (current)
- 18:17, 23 May 2011 (diff | hist) . . (+31) . . N File:Pah psi 10E-6 i3 identity.png (PAH PSI-Blast Search - Identity)
- 18:16, 23 May 2011 (diff | hist) . . (+31) . . N File:Pah psi 005 i5 identity.png (PAH PSI-Blast Search - Identity)
- 18:15, 23 May 2011 (diff | hist) . . (+28) . . N File:Pah psi 005 i5 score.png (PAH PSI-Blast Search - Score) (current)
- 18:15, 23 May 2011 (diff | hist) . . (+31) . . N File:Pah psi 005 i5 coverage.png (PAH PSI-Blast Search - Coverage)
- 18:14, 23 May 2011 (diff | hist) . . (+33) . . N File:Pah psi 10E-6 i3 similarity.png (PAH PSI-Blast Search - Similarity)
- 18:14, 23 May 2011 (diff | hist) . . (+28) . . N File:Pah psi 10E-6 i3 score.png (PAH PSI-Blast Search - Score)
- 18:12, 23 May 2011 (diff | hist) . . (+1,414) . . Task 2: Sequence alignments (sequence searches and multiple alignments) (→PSI-BLAST)
- 18:10, 23 May 2011 (diff | hist) . . (+31) . . N File:Pah psi 10E-6 i3 coverage.png (PAH PSI-Blast Search - Coverage)
- 17:56, 23 May 2011 (diff | hist) . . (+154) . . Task 2: Sequence alignments (sequence searches and multiple alignments) (→Results)
- 17:56, 23 May 2011 (diff | hist) . . (+27) . . N File:Pah.fasta search identity.png (PAH FASTA Search - Identity) (current)
- 17:55, 23 May 2011 (diff | hist) . . (+27) . . N File:Pah.fasta search score.png (PAH FASTA Search - Coverage) (current)
- 17:54, 23 May 2011 (diff | hist) . . (0) . . File:Pah.fasta search coverage.png (current)
- 17:54, 23 May 2011 (diff | hist) . . (+27) . . N File:Pah.fasta search coverage.png (PAH BLAST Search - Coverage)
- 17:52, 23 May 2011 (diff | hist) . . (+139) . . Task 2: Sequence alignments (sequence searches and multiple alignments) (→Results)
- 17:51, 23 May 2011 (diff | hist) . . (+27) . . N File:Pah.blast identity.png (PAH BLAST Search - Identity) (current)
- 17:50, 23 May 2011 (diff | hist) . . (+24) . . N File:Pah.blast score.png (PAH BLAST Search - Score) (current)
- 17:49, 23 May 2011 (diff | hist) . . (+27) . . N File:Pah.blast coverage.png (PAH BLAST Search - Coverage) (current)
- 17:36, 23 May 2011 (diff | hist) . . (+33) . . Phenylalanine hydroxylase reference (current)
- 17:35, 23 May 2011 (diff | hist) . . (+5,323) . . Task 2: Sequence alignments (sequence searches and multiple alignments)
- 12:38, 22 May 2011 (diff | hist) . . (+1) . . Task 2 - Alignments with PAH Reference (current)
- 12:38, 22 May 2011 (diff | hist) . . (+17) . . Task 2 - Alignments with PAH Reference
- 12:36, 22 May 2011 (diff | hist) . . (+106) . . Task 2 - Alignments with PAH Reference (→HSSP - More Positives)
- 12:27, 22 May 2011 (diff | hist) . . (-47) . . Task 2 - Alignments with PAH Reference
- 12:23, 22 May 2011 (diff | hist) . . (+609) . . Task 2 - Alignments with PAH Reference
- 12:16, 22 May 2011 (diff | hist) . . (-12) . . Task 2 - Alignments with PAH Reference
- 11:59, 22 May 2011 (diff | hist) . . (-49) . . Task 2 - Alignments with PAH Reference
- 11:53, 22 May 2011 (diff | hist) . . (+18) . . Task 2 - Alignments with PAH Reference
- 11:51, 22 May 2011 (diff | hist) . . (+31) . . Task 2 - Alignments with PAH Reference
- 11:45, 22 May 2011 (diff | hist) . . (-44) . . Task 2 - Alignments with PAH Reference
- 11:43, 22 May 2011 (diff | hist) . . (+28) . . Task 2 - Alignments with PAH Reference
- 11:36, 22 May 2011 (diff | hist) . . (+1) . . Task 2 - Alignments with PAH Reference
- 11:35, 22 May 2011 (diff | hist) . . (+4,729) . . N Task 2 - Alignments with PAH Reference (New page: =Task 2 - Alignments with PAH Reference= ==Sequence Searches== ===BLAST== ====Running==== time sudo blastall -p blastp -d '/data/blast/nr/nr' -i /home/student/workspace/reference.fasta -...)
- 11:20, 22 May 2011 (diff | hist) . . (+45) . . Phenylalanine hydroxylase reference
- 21:44, 15 May 2011 (diff | hist) . . (+370) . . Phenylketonuria 2011
- 12:35, 6 May 2011 (diff | hist) . . (-80) . . Phenylketonuria 2011
- 12:34, 6 May 2011 (diff | hist) . . (-8) . . Phenylketonuria 2011
- 12:31, 6 May 2011 (diff | hist) . . (+113) . . Phenylketonuria 2011
- 12:22, 6 May 2011 (diff | hist) . . (-9) . . Phenylalanine hydroxylase reference
- 12:22, 6 May 2011 (diff | hist) . . (-104) . . Phenylalanine hydroxylase reference
- 12:21, 6 May 2011 (diff | hist) . . (-6) . . Phenylalanine hydroxylase reference
- 12:21, 6 May 2011 (diff | hist) . . (0) . . Phenylalanine hydroxylase reference
- 12:20, 6 May 2011 (diff | hist) . . (-4) . . Phenylalanine hydroxylase reference
- 12:16, 6 May 2011 (diff | hist) . . (+155) . . Phenylalanine hydroxylase reference
- 12:15, 6 May 2011 (diff | hist) . . (+4) . . Phenylalanine hydroxylase reference
- 12:15, 6 May 2011 (diff | hist) . . (-3) . . Phenylalanine hydroxylase reference
- 12:14, 6 May 2011 (diff | hist) . . (+5) . . Phenylalanine hydroxylase reference
- 12:14, 6 May 2011 (diff | hist) . . (-4) . . Phenylalanine hydroxylase reference
- 12:13, 6 May 2011 (diff | hist) . . (+4) . . Phenylalanine hydroxylase reference
- 12:12, 6 May 2011 (diff | hist) . . (+662) . . N Phenylalanine hydroxylase reference (New page: == Sequence == <nowiki>MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEE VGALAKVLRLFEENDVNLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDI GATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQ F...)
- 12:03, 6 May 2011 (diff | hist) . . (-122) . . Phenylketonuria 2011
- 11:33, 6 May 2011 (diff | hist) . . (+2,733) . . N Phenylketonuria 2011 (New page: = still under construction = == Summary == Phenylketonuria causes several syndromes: * Delayed mental and social skills * Head size significantly below normal * Hyperactivity * Jerking mo...)
- 10:25, 6 May 2011 (diff | hist) . . (+3) . . Disease list 2011
- 10:23, 6 May 2011 (diff | hist) . . (+23) . . Protein Structure and Function Analysis (version: SS 2011)
