User contributions
From Bioinformatikpedia
- 18:49, 23 January 2012 (diff | hist) . . (+364) . . Molecular Dynamics Simulation of ARSA (→Preparation)
- 18:34, 23 January 2012 (diff | hist) . . (0) . . m Structure-based mutation analysis ARSA (→Summary) (current)
- 18:34, 23 January 2012 (diff | hist) . . (+2) . . m Structure-based mutation analysis ARSA (→Summary)
- 16:44, 5 December 2011 (diff | hist) . . (+3,355) . . Molecular Dynamics Simulation of ARSA
- 16:07, 5 December 2011 (diff | hist) . . (-16) . . Structure-based mutation analysis ARSA (→Gromacs)
- 15:47, 5 December 2011 (diff | hist) . . (+862) . . Structure-based mutation analysis ARSA
- 18:09, 28 August 2011 (diff | hist) . . (+341) . . Metachromatic leukodystrophy reference aminoacids (→3d-coffee)
- 18:02, 28 August 2011 (diff | hist) . . (+350) . . Metachromatic leukodystrophy reference aminoacids (→T-Coffee)
- 17:54, 28 August 2011 (diff | hist) . . (+54) . . Metachromatic leukodystrophy reference aminoacids (→ClustalW)
- 17:54, 28 August 2011 (diff | hist) . . (+526) . . Metachromatic leukodystrophy reference aminoacids (→Muscle)
- 17:48, 28 August 2011 (diff | hist) . . (+361) . . Metachromatic leukodystrophy reference aminoacids (→ClustalW)
- 17:43, 28 August 2011 (diff | hist) . . (+474) . . Metachromatic leukodystrophy reference aminoacids (→Cobalt)
- 17:33, 28 August 2011 (diff | hist) . . (-1) . . Metachromatic leukodystrophy reference aminoacids (→T-Coffee)
- 17:32, 28 August 2011 (diff | hist) . . (+190) . . Metachromatic leukodystrophy reference aminoacids (→Conservation of active sites)
- 17:31, 28 August 2011 (diff | hist) . . (-189) . . Metachromatic leukodystrophy reference aminoacids (→Gaps, conservation and computation time (summary))
- 17:31, 28 August 2011 (diff | hist) . . (+98) . . Metachromatic leukodystrophy reference aminoacids (→Conservation of active sites)
- 17:29, 28 August 2011 (diff | hist) . . (+206) . . Metachromatic leukodystrophy reference aminoacids (→Gaps and conservation (summary))
- 17:26, 28 August 2011 (diff | hist) . . (+69) . . N File:CompTimesMSA.PNG (Computation Times for different MSA-programs measured for MSA of ARSA) (current)
- 16:55, 28 August 2011 (diff | hist) . . (-3) . . Structure-based mutation analysis ARSA (→SCRWL)
- 16:54, 28 August 2011 (diff | hist) . . (-20) . . Structure-based mutation analysis ARSA (→Visualization with Pymol)
- 16:54, 28 August 2011 (diff | hist) . . (+17) . . Structure-based mutation analysis ARSA (→Visualization with Pymol)
- 16:52, 28 August 2011 (diff | hist) . . (+2) . . Structure-based mutation analysis ARSA (→Visualization with Pymol)
- 16:51, 28 August 2011 (diff | hist) . . (-7) . . m Structure-based mutation analysis ARSA (→Visualization with Pymol)
- 16:57, 14 August 2011 (diff | hist) . . (+105) . . Molecular Dynamics Simulation of ARSA
- 16:54, 14 August 2011 (diff | hist) . . (+189) . . Molecular Dynamics Simulation of ARSA
- 16:52, 14 August 2011 (diff | hist) . . (+179) . . Molecular Dynamics Simulation of ARSA
- 16:43, 14 August 2011 (diff | hist) . . (+623) . . Homology Modeling of ARS A (→Discussion)
- 16:37, 14 August 2011 (diff | hist) . . (+27) . . Homology Modeling of ARS A (→SWISS-MODEL)
- 16:34, 14 August 2011 (diff | hist) . . (+66) . . Homology Modeling of ARS A (→iTasser)
- 16:33, 14 August 2011 (diff | hist) . . (+769) . . Homology Modeling of ARS A (→iTasser)
- 15:25, 14 August 2011 (diff | hist) . . (-4) . . Category:Metachromatic Leukodystrophy (current)
- 15:24, 14 August 2011 (diff | hist) . . (+22) . . Metachromatic leukodystrophy 2011
- 15:23, 14 August 2011 (diff | hist) . . (+45) . . Normal Mode Analysis of ARSA
- 15:22, 14 August 2011 (diff | hist) . . (0) . . Structure-based mutation analysis ARSA (→Workflow)
- 15:22, 14 August 2011 (diff | hist) . . (0) . . Structure-based mutation analysis ARSA (→Workflow)
- 15:21, 14 August 2011 (diff | hist) . . (+1) . . Structure-based mutation analysis ARSA (→Workflow)
- 15:20, 14 August 2011 (diff | hist) . . (+55) . . N Molecular Dynamics Simulation of ARSA (Created page with "TODO Becci Category : Metachromatic_Leukodystrophy")
- 15:19, 14 August 2011 (diff | hist) . . (+1) . . m Structure-based mutation analysis ARSA (→Workflow)
- 15:18, 14 August 2011 (diff | hist) . . (+45) . . Structure-based mutation analysis ARSA
- 15:17, 14 August 2011 (diff | hist) . . (+45) . . Sequence-based mutation analysis of ARSA
- 15:16, 14 August 2011 (diff | hist) . . (+45) . . Mapping mutations of ARS A
- 15:15, 14 August 2011 (diff | hist) . . (+45) . . Using Modeller for TASK 4
- 15:14, 14 August 2011 (diff | hist) . . (+45) . . Homology Modeling of ARS A
- 15:12, 14 August 2011 (diff | hist) . . (+46) . . Sequence-based analyses of ARS A
- 15:12, 14 August 2011 (diff | hist) . . (+77) . . N Category:Metachromatic Leukodystrophy (Created page with "Metachromatic Leukodystrophy is a disease caused by a mutation in the genome.")
- 15:09, 14 August 2011 (diff | hist) . . (+45) . . Metachromatic leukodystrophy reference aminoacids
- 15:08, 14 August 2011 (diff | hist) . . (+45) . . Metachromatic leukodystrophy reference nucleotide
- 15:06, 14 August 2011 (diff | hist) . . (+45) . . Metachromatic leukodystrophy 2011
- 15:04, 14 August 2011 (diff | hist) . . (+243) . . Homology Modeling of ARS A (→Discussion)
- 15:01, 14 August 2011 (diff | hist) . . (0) . . m Homology Modeling of ARS A (→Multiple Template Modeling)
- 14:59, 14 August 2011 (diff | hist) . . (+4) . . m Homology Modeling of ARS A (→Modification of Alignments)
- 14:57, 14 August 2011 (diff | hist) . . (-4) . . m Homology Modeling of ARS A (→Modification of Alignments)
- 14:48, 14 August 2011 (diff | hist) . . (+1) . . m Homology Modeling of ARS A (→Single template modelling)
- 04:18, 14 August 2011 (diff | hist) . . (+49) . . Homology Modeling of ARS A (→Single template modelling)
- 04:10, 14 August 2011 (diff | hist) . . (+4) . . m Homology Modeling of ARS A (→Single template modelling)
- 04:05, 14 August 2011 (diff | hist) . . (+11) . . m Homology Modeling of ARS A (→Modeller)
- 03:55, 14 August 2011 (diff | hist) . . (-2) . . m Homology Modeling of ARS A (→Proteins used as templates)
- 03:46, 14 August 2011 (diff | hist) . . (+5) . . m Homology Modeling of ARS A (→Proteins used as templates)
- 03:27, 14 August 2011 (diff | hist) . . (+13) . . m Metachromatic leukodystrophy reference aminoacids (→HSSP)
- 03:22, 14 August 2011 (diff | hist) . . (-2) . . m Metachromatic leukodystrophy reference aminoacids (→Overlap between methods)
- 03:21, 14 August 2011 (diff | hist) . . (0) . . m Metachromatic leukodystrophy reference aminoacids (→Comparison of the methods)
- 03:17, 14 August 2011 (diff | hist) . . (-2) . . m Metachromatic leukodystrophy reference aminoacids (→Database Searches)
- 12:42, 4 July 2011 (diff | hist) . . (+56) . . N File:Gromacs AMBER03 500 angles.png (analysis of minimization with gromacs for ARSA on angles) (current)
- 12:34, 4 July 2011 (diff | hist) . . (+60) . . N File:Gromacs AMBER03 500 potentials.pdf (analysis of minimization with gromacs for ARSA on potentials) (current)
- 12:33, 4 July 2011 (diff | hist) . . (+55) . . N File:Gromacs AMBER03 500 bonds.pdf (analysis of minimization with gromacs for ARSA on bonds) (current)
- 12:33, 4 July 2011 (diff | hist) . . (+56) . . N File:Gromacs AMBER03 500 angles.pdf (analysis of minimization with gromacs for ARSA on angles) (current)
- 12:21, 4 July 2011 (diff | hist) . . (+408) . . Structure-based mutation analysis ARSA (→Gromacs)
- 12:13, 4 July 2011 (diff | hist) . . (+738) . . Structure-based mutation analysis ARSA (→Gromacs)
- 11:33, 4 July 2011 (diff | hist) . . (+2,431) . . Structure-based mutation analysis ARSA (→Gromacs)
- 11:01, 4 July 2011 (diff | hist) . . (+20) . . Structure-based mutation analysis ARSA
- 20:57, 27 June 2011 (diff | hist) . . (+1,759) . . Sequence-based mutation analysis of ARSA (→Summary and Discussion)
- 20:05, 27 June 2011 (diff | hist) . . (-8) . . Homology Modeling of ARS A (→Comparison of the methods)
- 18:13, 27 June 2011 (diff | hist) . . (-1) . . m Homology Modeling of ARS A (→Comparison of the methods)
- 18:13, 27 June 2011 (diff | hist) . . (+559) . . Homology Modeling of ARS A (→3D-Jigsaw)
- 20:45, 26 June 2011 (diff | hist) . . (+328) . . Sequence-based mutation analysis of ARSA (→Comparison of results)
- 20:42, 26 June 2011 (diff | hist) . . (+467) . . Sequence-based mutation analysis of ARSA (→Prediction of effect)
- 20:27, 26 June 2011 (diff | hist) . . (+36) . . Sequence-based mutation analysis of ARSA
- 20:25, 26 June 2011 (diff | hist) . . (+608) . . Sequence-based mutation analysis of ARSA (→SIFT)
- 20:17, 26 June 2011 (diff | hist) . . (+51) . . m Sequence-based mutation analysis of ARSA (→PolyPhen)
- 20:17, 26 June 2011 (diff | hist) . . (+657) . . Sequence-based mutation analysis of ARSA
- 19:57, 26 June 2011 (diff | hist) . . (+35) . . Sequence-based mutation analysis of ARSA
- 19:56, 26 June 2011 (diff | hist) . . (+65) . . Sequence-based mutation analysis of ARSA (→PolyPhen)
- 19:56, 26 June 2011 (diff | hist) . . (+55) . . Sequence-based mutation analysis of ARSA (→PolyPhen)
- 19:55, 26 June 2011 (diff | hist) . . (+105) . . Sequence-based mutation analysis of ARSA (→PolyPhen)
- 19:13, 26 June 2011 (diff | hist) . . (+285) . . Sequence-based mutation analysis of ARSA (→PolyPhen)
- 18:55, 26 June 2011 (diff | hist) . . (+1,480) . . Sequence-based mutation analysis of ARSA (→PolyPhen)
- 18:46, 26 June 2011 (diff | hist) . . (+73) . . Sequence-based mutation analysis of ARSA (→PolyPhen)
- 18:30, 26 June 2011 (diff | hist) . . (+132) . . Sequence-based mutation analysis of ARSA (→SIFT)
- 18:29, 26 June 2011 (diff | hist) . . (+265) . . Sequence-based mutation analysis of ARSA
- 17:13, 26 June 2011 (diff | hist) . . (+178) . . Sequence-based mutation analysis of ARSA (→Secondary Structure)
- 17:09, 26 June 2011 (diff | hist) . . (-1,715) . . Sequence-based mutation analysis of ARSA (→Secondary Structure)
- 17:07, 26 June 2011 (diff | hist) . . (+73) . . N File:Sec Struct Mutations ARSA.png (Secondary Structure Predictions for ARSA with marked Mutations for Task 6) (current)
- 16:57, 26 June 2011 (diff | hist) . . (+421) . . Sequence-based mutation analysis of ARSA (→Description of Mutations)
- 16:53, 26 June 2011 (diff | hist) . . (+40) . . Sequence-based mutation analysis of ARSA (→Description of Mutations)
- 16:51, 26 June 2011 (diff | hist) . . (+12) . . Sequence-based mutation analysis of ARSA (→Description of Mutations)
- 16:07, 26 June 2011 (diff | hist) . . (+1,930) . . Sequence-based mutation analysis of ARSA (→Intro)
- 15:24, 26 June 2011 (diff | hist) . . (+1,605) . . Sequence-based mutation analysis of ARSA (→Intro)
- 15:06, 26 June 2011 (diff | hist) . . (+1,130) . . Sequence-based mutation analysis of ARSA (→Intro)
- 21:40, 25 June 2011 (diff | hist) . . (+678) . . Sequence-based mutation analysis of ARSA (→Intro)
- 21:37, 25 June 2011 (diff | hist) . . (0) . . N File:Arginine.png (current)
- 21:35, 25 June 2011 (diff | hist) . . (0) . . N File:Glycine.png (current)
- 21:33, 25 June 2011 (diff | hist) . . (+672) . . Sequence-based mutation analysis of ARSA (→Intro)
- 21:32, 25 June 2011 (diff | hist) . . (0) . . N File:Serine.png (current)
- 21:30, 25 June 2011 (diff | hist) . . (0) . . N File:Isoleucine.png (current)
- 21:27, 25 June 2011 (diff | hist) . . (0) . . N File:Valine.png (current)
- 21:27, 25 June 2011 (diff | hist) . . (0) . . N File:Phenylalanine.png (current)
- 21:26, 25 June 2011 (diff | hist) . . (+364) . . Sequence-based mutation analysis of ARSA (→Intro)
- 19:59, 25 June 2011 (diff | hist) . . (0) . . N File:Methionine.png (current)
- 19:59, 25 June 2011 (diff | hist) . . (0) . . N File:Threonine.png (current)
- 19:51, 25 June 2011 (diff | hist) . . (+1,564) . . Sequence-based mutation analysis of ARSA
- 19:48, 25 June 2011 (diff | hist) . . (0) . . N File:Cysteine.png (current)
- 19:48, 25 June 2011 (diff | hist) . . (0) . . N File:Tryptophan.png (current)
- 19:42, 25 June 2011 (diff | hist) . . (0) . . N File:Histidine.png (current)
- 19:42, 25 June 2011 (diff | hist) . . (0) . . N File:Glutamine.png (current)
- 19:33, 25 June 2011 (diff | hist) . . (0) . . N File:Proline.png (current)
- 19:33, 25 June 2011 (diff | hist) . . (0) . . N File:Alanine.png (current)
- 19:29, 25 June 2011 (diff | hist) . . (0) . . N File:Aspartic acid.png (current)
- 19:28, 25 June 2011 (diff | hist) . . (0) . . N File:Asparagine.png (current)
- 17:44, 20 June 2011 (diff | hist) . . (+92) . . Homology Modeling of ARS A (→3D-Jigsaw)
- 17:41, 20 June 2011 (diff | hist) . . (+321) . . Homology Modeling of ARS A (→3D-Jigsaw)
- 17:28, 20 June 2011 (diff | hist) . . (+62) . . Homology Modeling of ARS A
- 17:19, 20 June 2011 (diff | hist) . . (+12) . . Homology Modeling of ARS A (→Multiple Template Modeling)
- 17:15, 20 June 2011 (diff | hist) . . (+8) . . Homology Modeling of ARS A (→3ED4)
- 17:13, 20 June 2011 (diff | hist) . . (+20) . . Homology Modeling of ARS A (→Single template modelling)
- 17:07, 20 June 2011 (diff | hist) . . (+8) . . Homology Modeling of ARS A (→Modeller)
- 16:58, 20 June 2011 (diff | hist) . . (+10) . . Homology Modeling of ARS A (→Modelling without template)
- 16:56, 20 June 2011 (diff | hist) . . (+10) . . Homology Modeling of ARS A (→Modelling with single template)
- 16:54, 20 June 2011 (diff | hist) . . (+219) . . Homology Modeling of ARS A (→Discussion)
- 16:22, 20 June 2011 (diff | hist) . . (+79) . . Homology Modeling of ARS A (→Discussion)
- 16:15, 20 June 2011 (diff | hist) . . (0) . . Homology Modeling of ARS A (→SWISS-MODEL)
- 16:14, 20 June 2011 (diff | hist) . . (0) . . Homology Modeling of ARS A (→iTasser)
- 16:14, 20 June 2011 (diff | hist) . . (+3) . . Homology Modeling of ARS A (→iTasser)
- 16:12, 20 June 2011 (diff | hist) . . (-4) . . Homology Modeling of ARS A (→iTasser)
- 16:11, 20 June 2011 (diff | hist) . . (0) . . Homology Modeling of ARS A (→iTasser)
- 16:10, 20 June 2011 (diff | hist) . . (+310) . . Homology Modeling of ARS A (→SWISS-MODEL)
- 16:04, 20 June 2011 (diff | hist) . . (+362) . . Homology Modeling of ARS A (→iTasser)
- 16:00, 20 June 2011 (diff | hist) . . (+151) . . Homology Modeling of ARS A (→Modelling with single template)
- 15:59, 20 June 2011 (diff | hist) . . (0) . . Homology Modeling of ARS A (→Template)
- 15:58, 20 June 2011 (diff | hist) . . (+356) . . Homology Modeling of ARS A (→Modelling without template)
- 15:12, 20 June 2011 (diff | hist) . . (+1) . . Homology Modeling of ARS A (→iTasser)
- 14:51, 20 June 2011 (diff | hist) . . (+24) . . m Homology Modeling of ARS A (→SWISS-MODEL)
- 10:06, 19 June 2011 (diff | hist) . . (+619) . . Homology Modeling of ARS A (→iTasser)
- 10:05, 19 June 2011 (diff | hist) . . (0) . . N File:ARSA iTasser 1P49 model5.gif (current)
- 10:05, 19 June 2011 (diff | hist) . . (0) . . N File:ARSA iTasser 1P49 model4.gif (current)
- 10:05, 19 June 2011 (diff | hist) . . (0) . . N File:ARSA iTasser 1P49 model3.gif (current)
- 10:04, 19 June 2011 (diff | hist) . . (0) . . N File:ARSA iTasser 1P49 model2.gif (current)
- 10:04, 19 June 2011 (diff | hist) . . (0) . . N File:ARSA iTasser 1P49 model1.gif (current)
- 08:40, 19 June 2011 (diff | hist) . . (-1) . . Homology Modeling of ARS A
- 12:38, 18 June 2011 (diff | hist) . . (+110) . . Homology Modeling of ARS A (→Results)
- 12:36, 18 June 2011 (diff | hist) . . (+544) . . Homology Modeling of ARS A (→SWISS-MODEL)
- 12:35, 18 June 2011 (diff | hist) . . (0) . . N File:ARSA SWISSMODEL local quality 2VQRalignment.png (current)
- 12:35, 18 June 2011 (diff | hist) . . (0) . . N File:ARSA SWISSMODEL 2VQRalignment QMEAN slider.png (current)
- 12:34, 18 June 2011 (diff | hist) . . (0) . . N File:ARSA SWISSMODEL 2VQRalignment QMEAN plot.png (current)
- 12:34, 18 June 2011 (diff | hist) . . (0) . . N File:ARSA SWISSMODEL 2VQRalignment QMEAN density plot.png (current)
- 12:33, 18 June 2011 (diff | hist) . . (0) . . N File:ARSA SWISSMODEL 2VQRalignment.jpg (current)
- 12:31, 18 June 2011 (diff | hist) . . (+4,320) . . Homology Modeling of ARS A (→SWISS-MODEL)
- 11:54, 18 June 2011 (diff | hist) . . (+124) . . Homology Modeling of ARS A (→SWISS-MODEL)
- 10:28, 14 June 2011 (diff | hist) . . (+96) . . Homology Modeling of ARS A (→SWISS-MODEL)
- 10:18, 14 June 2011 (diff | hist) . . (+134) . . Homology Modeling of ARS A (→iTasser)
- 10:14, 14 June 2011 (diff | hist) . . (0) . . Rebecca Kaßner (current)
- 10:12, 14 June 2011 (diff | hist) . . (+83) . . Homology Modeling of ARS A (→iTasser)
- 10:10, 14 June 2011 (diff | hist) . . (+375) . . Homology Modeling of ARS A (→iTasser)
- 10:05, 14 June 2011 (diff | hist) . . (-41) . . Homology Modeling of ARS A (→iTasser)
- 10:04, 14 June 2011 (diff | hist) . . (+503) . . Homology Modeling of ARS A (→iTasser)
- 10:03, 14 June 2011 (diff | hist) . . (0) . . N File:ARSA iTasser without template model3.gif (current)
- 10:03, 14 June 2011 (diff | hist) . . (0) . . N File:ARSA iTasser without template model1.gif (current)
- 10:03, 14 June 2011 (diff | hist) . . (0) . . N File:ARSA iTasser without template model5.gif (current)
- 10:03, 14 June 2011 (diff | hist) . . (0) . . N File:ARSA iTasser without template model4.gif (current)
- 10:02, 14 June 2011 (diff | hist) . . (0) . . N File:ARSA iTasser without template model2.gif (current)
- 08:39, 14 June 2011 (diff | hist) . . (0) . . N File:ARSA SWISSMODEL local quality 2VQR.png (current)
- 08:39, 14 June 2011 (diff | hist) . . (+236) . . Homology Modeling of ARS A (→SWISS-MODEL)
- 08:22, 14 June 2011 (diff | hist) . . (+619) . . Homology Modeling of ARS A (→SWISS-MODEL)
- 08:20, 14 June 2011 (diff | hist) . . (0) . . N File:ARSA SWISSMODEL 1P49 QMEAN plot.png (current)
- 08:20, 14 June 2011 (diff | hist) . . (0) . . N File:ARSA SWISSMODEL 1P49 QMEAN density plot.png (current)
- 08:20, 14 June 2011 (diff | hist) . . (0) . . N File:ARSA SWISSMODEL 1P49 QMEAN slider.png (current)
- 08:20, 14 June 2011 (diff | hist) . . (0) . . N File:ARSA SWISSMODEL 1P49.jpg (current)
- 08:19, 14 June 2011 (diff | hist) . . (0) . . N File:ARSA SWISSMODEL 1P49 QMEAN energy profile QMEANlocal.png (current)
- 08:19, 14 June 2011 (diff | hist) . . (+56) . . N File:ARSA SWISSMODEL local quality 1P49.png (plot of local quality of ARSA-model built by SWISS-MODEL) (current)
- 09:53, 13 June 2011 (diff | hist) . . (+4,329) . . Homology Modeling of ARS A (→SWISS-MODEL)
- 09:52, 13 June 2011 (diff | hist) . . (+21) . . Homology Modeling of ARS A (→SWISS-MODEL)
- 09:50, 13 June 2011 (diff | hist) . . (+4,329) . . Homology Modeling of ARS A (→SWISS-MODEL)
- 09:35, 13 June 2011 (diff | hist) . . (+192) . . Homology Modeling of ARS A (→SWISS-MODEL)
- 09:31, 13 June 2011 (diff | hist) . . (+196) . . Homology Modeling of ARS A (→Results)
- 09:29, 13 June 2011 (diff | hist) . . (+60) . . N File:ARSA SWISSMODEL without template.jpg (model for ARSA by SWISS-MODEL without given template -> 1N21) (current)
- 09:26, 13 June 2011 (diff | hist) . . (+63) . . N File:ARSA SWISSMODEL local quality without template.png (quality of the ARSA-model without given template by SWISS-MODEL) (current)
- 09:24, 13 June 2011 (diff | hist) . . (+216) . . Homology Modeling of ARS A (→SWISS-MODEL)
- 09:23, 13 June 2011 (diff | hist) . . (+49) . . N File:ARSA SWISSMODEL without template QMEAN slider.png (Z-score for ARSA-model by SWISS-MODEL by category) (current)
- 09:21, 13 June 2011 (diff | hist) . . (+64) . . N File:ARSA SWISSMODEL without template QMEAN density plot.png (density plot of ARSA Model by SWISS-MODEL without given template) (current)
- 09:17, 13 June 2011 (diff | hist) . . (+127) . . Homology Modeling of ARS A (→SWISS-MODEL)
- 09:15, 13 June 2011 (diff | hist) . . (+33) . . N File:ARSA SWISSMODEL without template QMEAN plot.png (plot of QMEAN on nonredundant PDB) (current)
- 08:51, 13 June 2011 (diff | hist) . . (+3,809) . . Homology Modeling of ARS A (→SWISS-MODEL)
- 10:25, 12 June 2011 (diff | hist) . . (+230) . . Homology Modeling of ARS A (→SWISS-MODEL)
- 10:22, 12 June 2011 (diff | hist) . . (+1,021) . . Homology Modeling of ARS A (→Swissmodel)
- 09:59, 12 June 2011 (diff | hist) . . (-23) . . Homology Modeling of ARS A (→iTasser)
- 09:57, 12 June 2011 (diff | hist) . . (+117) . . Homology Modeling of ARS A (→iTasser)
- 09:55, 12 June 2011 (diff | hist) . . (+33) . . Homology Modeling of ARS A
- 09:55, 12 June 2011 (diff | hist) . . (+775) . . Homology Modeling of ARS A (→iTasser)
- 09:52, 12 June 2011 (diff | hist) . . (+93) . . N File:I-TASSER workflow.jpg (workflow of iTasser; source:[http://zhanglab.ccmb.med.umich.edu/I-TASSER/about.html zhanglab]) (current)
- 09:34, 12 June 2011 (diff | hist) . . (+33) . . Homology Modeling of ARS A
- 15:56, 8 June 2011 (diff | hist) . . (+9) . . Homology Modeling of ARS A (→Proteins used as templates)
- 15:53, 8 June 2011 (diff | hist) . . (0) . . Homology Modeling of ARS A (→Proteins used as templates)
- 11:28, 7 June 2011 (diff | hist) . . (+941) . . N Rebecca Kaßner (Created page with "thumb|right|Rebecca Kaßner =Person= '''Rebecca Kaßner''' is a bioinformatics student in 8th semester (or 2nd Master semester). =Group= Rebecca wor…")
- 11:28, 7 June 2011 (diff | hist) . . (-912) . . User:Kassner (Redirected page to Rebecca Kaßner) (current)
- 17:27, 6 June 2011 (diff | hist) . . (+167) . . Sequence-based analyses of ARS A (→Prediction of GO Terms)
- 17:18, 6 June 2011 (diff | hist) . . (+194) . . Sequence-based analyses of ARS A (→Prediction of GO Terms)
- 17:16, 6 June 2011 (diff | hist) . . (+91) . . Sequence-based analyses of ARS A (→ProtFun 2.2)
- 17:13, 6 June 2011 (diff | hist) . . (+4) . . Sequence-based analyses of ARS A (→Prediction of GO Terms)
- 17:05, 6 June 2011 (diff | hist) . . (+1,083) . . Sequence-based analyses of ARS A (→Prediction of GO Terms)
- 16:35, 6 June 2011 (diff | hist) . . (+334) . . Sequence-based analyses of ARS A (→Prediction of GO Terms)
- 16:22, 6 June 2011 (diff | hist) . . (+2,502) . . Sequence-based analyses of ARS A (→Prediction of GO Terms)
- 11:37, 6 June 2011 (diff | hist) . . (-2) . . Sequence-based analyses of ARS A (→Prediction of GO Terms)
- 11:37, 6 June 2011 (diff | hist) . . (+41) . . Sequence-based analyses of ARS A (→Prediction of GO Terms)
- 11:34, 6 June 2011 (diff | hist) . . (+432) . . Sequence-based analyses of ARS A (→Prediction of GO Terms)
- 11:10, 6 June 2011 (diff | hist) . . (+2) . . Sequence-based analyses of ARS A (→Meta-Disorder)
- 11:06, 6 June 2011 (diff | hist) . . (+17) . . Sequence-based analyses of ARS A (→Prediction of Disordered Regions)
- 11:05, 6 June 2011 (diff | hist) . . (+9) . . Sequence-based analyses of ARS A (→Prediction of Disordered Regions)
- 11:04, 6 June 2011 (diff | hist) . . (+446) . . Sequence-based analyses of ARS A (→Prediction of Disordered Regions)
- 10:35, 6 June 2011 (diff | hist) . . (+216) . . Sequence-based analyses of ARS A (→Prediction of Disordered Regions)
- 14:43, 5 June 2011 (diff | hist) . . (+13) . . N File:RET4 PFAM alignment.jpg (image by PFAM) (current)
- 14:41, 5 June 2011 (diff | hist) . . (+13) . . N File:LAMP1 PFAM alignment.jpg (image by PFAM) (current)
- 12:52, 5 June 2011 (diff | hist) . . (-10) . . Sequence-based analyses of ARS A (→Pfam)
- 12:50, 5 June 2011 (diff | hist) . . (+245) . . Sequence-based analyses of ARS A (→Pfam)
- 12:48, 5 June 2011 (diff | hist) . . (+13) . . N File:RET4 PFAM.png (image by PFAM) (current)
- 12:48, 5 June 2011 (diff | hist) . . (+13) . . N File:LAMP1 PFAM.png (image by PFAM) (current)
- 12:46, 5 June 2011 (diff | hist) . . (+13) . . N File:INSL5 PFAM alignment.jpg (image by PFAM) (current)
- 12:45, 5 June 2011 (diff | hist) . . (+13) . . N File:INSL5 PFAM.png (image by PFAM) (current)
- 12:45, 5 June 2011 (diff | hist) . . (+13) . . N File:BACR HALSA PFAM alignment.jpg (image by PFAM) (current)
- 12:42, 5 June 2011 (diff | hist) . . (0) . . File:BACR HALSA PFAM.png (uploaded a new version of "File:BACR HALSA PFAM.png": image by PFAM) (current)
- 12:41, 5 June 2011 (diff | hist) . . (+63) . . N File:BACR HALSA PFAM.png (Image:A4_PFAM.png Image:A4_PFAM_significant_matches.jpg)
- 12:40, 5 June 2011 (diff | hist) . . (+13) . . N File:A4 PFAM alignment.jpg (image by PFAM) (current)
- 12:38, 5 June 2011 (diff | hist) . . (+57) . . Sequence-based analyses of ARS A (→Pfam)
- 12:36, 5 June 2011 (diff | hist) . . (+13) . . N File:ARSA PFAM alignment.jpg (image by PFAM) (current)
- 12:35, 5 June 2011 (diff | hist) . . (+13) . . N File:ARSA PFAM.png (image by PFAM) (current)
- 12:33, 5 June 2011 (diff | hist) . . (+10,726) . . Sequence-based analyses of ARS A (→ProtFun 2.2)
- 12:30, 5 June 2011 (diff | hist) . . (+2,144) . . Sequence-based analyses of ARS A (→ProtFun 2.2)
- 16:41, 3 June 2011 (diff | hist) . . (+63) . . Sequence-based analyses of ARS A (→Pfam)
- 16:39, 3 June 2011 (diff | hist) . . (+40) . . N File:A4 PFAM significant matches.jpg (significant matches found by PFAM Server) (current)
- 16:38, 3 June 2011 (diff | hist) . . (+32) . . N File:A4 PFAM.png (Image generated by PFAM homepage) (current)
- 16:38, 3 June 2011 (diff | hist) . . (+248) . . Sequence-based analyses of ARS A (→Prediction of GO Terms)
- 15:43, 3 June 2011 (diff | hist) . . (+4) . . Sequence-based analyses of ARS A (→GOPET)
- 15:42, 3 June 2011 (diff | hist) . . (+88) . . Sequence-based analyses of ARS A (→RET 4)
- 15:38, 3 June 2011 (diff | hist) . . (+16) . . Sequence-based analyses of ARS A (→INSL 5)
- 15:38, 3 June 2011 (diff | hist) . . (+16) . . Sequence-based analyses of ARS A (→BACR_HALSA)
- 15:36, 3 June 2011 (diff | hist) . . (+107) . . Sequence-based analyses of ARS A (→ARS A)
- 15:32, 3 June 2011 (diff | hist) . . (+189) . . Sequence-based analyses of ARS A (→GOPET)
- 15:29, 3 June 2011 (diff | hist) . . (+121) . . Sequence-based analyses of ARS A (→A4)
- 15:22, 3 June 2011 (diff | hist) . . (+2,204) . . Sequence-based analyses of ARS A (→Prediction of GO Terms)
- 15:12, 3 June 2011 (diff | hist) . . (-12) . . User:Kassner
- 15:06, 3 June 2011 (diff | hist) . . (+114) . . N File:Short talk zacher kassner.pdf (short talk of Benedikt Zacher and Rebecca Kaßner on Metachromatic Leukodystrophy) (current)
- 14:58, 3 June 2011 (diff | hist) . . (+953) . . N User:Kassner (Created page with "thumb|right|Rebecca Kaßner =Person= '''Rebecca Kaßner''' is a bioinformatics student in 8th semester (or 2nd Master semester). =Group= Rebecca wor…")
- 14:55, 3 June 2011 (diff | hist) . . (+23) . . N File:RebeccaKassner.jpg (Picture of User Kassner) (current)
- 14:47, 3 June 2011 (diff | hist) . . (+3,613) . . Sequence-based analyses of ARS A (→Prediction of GO Terms)
- 14:09, 3 June 2011 (diff | hist) . . (+150) . . Sequence-based analyses of ARS A (→Prediction of Disordered Regions)
- 14:07, 3 June 2011 (diff | hist) . . (+256) . . Sequence-based analyses of ARS A (→IUPred)
- 14:02, 3 June 2011 (diff | hist) . . (+101) . . Sequence-based analyses of ARS A (→Meta-Disorder)
- 13:54, 3 June 2011 (diff | hist) . . (0) . . Sequence-based analyses of ARS A (→Prediction of Disordered Regions)
- 13:54, 3 June 2011 (diff | hist) . . (+27) . . Sequence-based analyses of ARS A (→Prediction of Disordered Regions)
- 13:51, 3 June 2011 (diff | hist) . . (+551) . . Sequence-based analyses of ARS A (→Prediction of Disordered Regions)
- 13:42, 3 June 2011 (diff | hist) . . (+73) . . N File:ARSA POODLE small.png (prediction of disorderd regions of ARSA by POODLE scaled to fit into page) (current)
- 13:35, 3 June 2011 (diff | hist) . . (-52) . . Sequence-based analyses of ARS A (→Prediction of Disordered Regions)
- 13:30, 3 June 2011 (diff | hist) . . (+33) . . Sequence-based analyses of ARS A
- 13:29, 3 June 2011 (diff | hist) . . (+1,640) . . Sequence-based analyses of ARS A (→Prediction of Disordered Regions)
- 13:13, 3 June 2011 (diff | hist) . . (+77) . . N File:ARSA IUPRED structured.png (prediction of disordered regions of ARSA by IUPRED with the structured option) (current)
- 13:12, 3 June 2011 (diff | hist) . . (+81) . . N File:ARSA IUPRED short.png (prediction of disordered regions of ARSA by IUPRED with the short disorder option) (current)
- 13:11, 3 June 2011 (diff | hist) . . (+80) . . N File:ARSA IUPRED long.png (prediction of disordered regions of ARSA by IUPRED with the long disorder option) (current)
- 12:37, 3 June 2011 (diff | hist) . . (0) . . Sequence-based analyses of ARS A (→Prediction of Disordered Regions)
- 12:36, 3 June 2011 (diff | hist) . . (-7) . . Sequence-based analyses of ARS A (→POODLE)
- 12:36, 3 June 2011 (diff | hist) . . (+7) . . Sequence-based analyses of ARS A (→POODLE)
- 12:32, 3 June 2011 (diff | hist) . . (+116) . . Sequence-based analyses of ARS A (→POODLE)
- 12:31, 3 June 2011 (diff | hist) . . (+121) . . Sequence-based analyses of ARS A (→Prediction of Disordered Regions)
- 12:30, 3 June 2011 (diff | hist) . . (+50) . . N File:ARSA POODLE.png (prediction of disordered regions of ARSA by POODLE) (current)
- 12:09, 3 June 2011 (diff | hist) . . (0) . . Sequence-based analyses of ARS A (→Prediction of Disordered Regions)
- 12:05, 3 June 2011 (diff | hist) . . (+341) . . Sequence-based analyses of ARS A (→DISOPRED)
- 11:55, 3 June 2011 (diff | hist) . . (+66) . . N File:ARSA Disopred.pdf (prediction of disordered regions of ARSA by Disopred (text output)) (current)
- 11:50, 3 June 2011 (diff | hist) . . (+51) . . N File:ARSA Disopred.png (prediction of disordered Regions of ARSA by Dispred) (current)
- 11:42, 3 June 2011 (diff | hist) . . (-284) . . Sequence-based analyses of ARS A (→DISOPRED)
- 11:34, 3 June 2011 (diff | hist) . . (+289) . . Sequence-based analyses of ARS A (→Prediction of Disordered Regions)
- 11:30, 3 June 2011 (diff | hist) . . (+2,543) . . Sequence-based analyses of ARS A (→Prediction of Disordered Regions)
- 11:12, 3 June 2011 (diff | hist) . . (-582) . . Sequence-based analyses of ARS A (→Additional Proteins)
- 11:00, 3 June 2011 (diff | hist) . . (+803) . . Sequence-based analyses of ARS A (→Additional Proteins)
- 09:00, 3 June 2011 (diff | hist) . . (+926) . . Sequence-based analyses of ARS A (→Additional Proteins)
- 08:41, 3 June 2011 (diff | hist) . . (+4) . . Sequence-based analyses of ARS A
- 08:41, 3 June 2011 (diff | hist) . . (+602) . . Sequence-based analyses of ARS A
- 08:31, 3 June 2011 (diff | hist) . . (+52) . . Sequence-based analyses of ARS A
- 14:46, 25 May 2011 (diff | hist) . . (-1) . . Sequence-based analyses of ARS A
- 14:46, 25 May 2011 (diff | hist) . . (+57) . . Sequence-based analyses of ARS A
- 13:51, 25 May 2011 (diff | hist) . . (+57) . . Sequence-based analyses of ARS A (→Prediction of Disordered Regions)
- 13:29, 25 May 2011 (diff | hist) . . (+92) . . Sequence-based analyses of ARS A
- 13:27, 25 May 2011 (diff | hist) . . (+225) . . Sequence-based analyses of ARS A (→Prediction of GO Terms)
- 13:26, 25 May 2011 (diff | hist) . . (+152) . . Sequence-based analyses of ARS A (→Prediction of Disordered Regions)
- 13:23, 25 May 2011 (diff | hist) . . (+180) . . Sequence-based analyses of ARS A
- 13:20, 25 May 2011 (diff | hist) . . (+74) . . Sequence-based analyses of ARS A
- 11:34, 24 May 2011 (diff | hist) . . (-45) . . Metachromatic leukodystrophy reference aminoacids (→Conservation of active sites)
- 11:31, 24 May 2011 (diff | hist) . . (+247) . . Metachromatic leukodystrophy reference aminoacids (→Conservation of active sites)
- 11:16, 24 May 2011 (diff | hist) . . (+143) . . Metachromatic leukodystrophy reference aminoacids (→Conservation of active sites)
- 05:51, 24 May 2011 (diff | hist) . . (+911) . . Metachromatic leukodystrophy reference aminoacids (→Conservation of active sites)
- 21:36, 23 May 2011 (diff | hist) . . (+292) . . Metachromatic leukodystrophy reference aminoacids (→T-Coffee)
- 21:35, 23 May 2011 (diff | hist) . . (+115) . . Metachromatic leukodystrophy reference aminoacids (→Muscle)
- 21:34, 23 May 2011 (diff | hist) . . (+2) . . Metachromatic leukodystrophy reference aminoacids (→ClustalW)
- 21:33, 23 May 2011 (diff | hist) . . (+117) . . Metachromatic leukodystrophy reference aminoacids (→ClustalW)
- 21:33, 23 May 2011 (diff | hist) . . (-26) . . Metachromatic leukodystrophy reference aminoacids (→Result)
- 21:30, 23 May 2011 (diff | hist) . . (+140) . . Metachromatic leukodystrophy reference aminoacids (→Cobalt)
- 21:27, 23 May 2011 (diff | hist) . . (+91) . . Metachromatic leukodystrophy reference aminoacids (→Command)
- 21:26, 23 May 2011 (diff | hist) . . (+91) . . Metachromatic leukodystrophy reference aminoacids (→Command)
- 21:26, 23 May 2011 (diff | hist) . . (+91) . . Metachromatic leukodystrophy reference aminoacids (→Command)
- 21:26, 23 May 2011 (diff | hist) . . (+90) . . Metachromatic leukodystrophy reference aminoacids (→Command)
- 21:25, 23 May 2011 (diff | hist) . . (+91) . . Metachromatic leukodystrophy reference aminoacids (→Command)
- 21:23, 23 May 2011 (diff | hist) . . (0) . . N File:MSA Arylsulfatase tcoffee-3D.png (current)
- 21:23, 23 May 2011 (diff | hist) . . (0) . . N File:MSA Arylsulfatase tcoffee-standard.png (current)
- 21:22, 23 May 2011 (diff | hist) . . (0) . . N File:MSA Arylsulfatase muscle.png (current)
- 21:21, 23 May 2011 (diff | hist) . . (0) . . N File:MSA Arylsulfatase cobalt.png (current)
- 21:21, 23 May 2011 (diff | hist) . . (0) . . N File:MSA Arylsulfatase clustalW.png (current)
- 20:14, 23 May 2011 (diff | hist) . . (+757) . . Metachromatic leukodystrophy reference aminoacids (→Multiple Alignments)
- 19:09, 23 May 2011 (diff | hist) . . (+164) . . Metachromatic leukodystrophy reference aminoacids (→Multiple Alignments)
- 18:25, 23 May 2011 (diff | hist) . . (+108) . . Metachromatic leukodystrophy reference aminoacids (→Multiple Alignments)
- 18:06, 23 May 2011 (diff | hist) . . (+675) . . Metachromatic leukodystrophy reference aminoacids (→Multiple Alignments)
- 13:37, 21 May 2011 (diff | hist) . . (+184) . . Metachromatic leukodystrophy reference aminoacids
- 13:34, 21 May 2011 (diff | hist) . . (+368) . . Metachromatic leukodystrophy reference aminoacids
- 12:47, 21 May 2011 (diff | hist) . . (+280) . . Metachromatic leukodystrophy reference aminoacids
- 09:26, 21 May 2011 (diff | hist) . . (+242) . . Metachromatic leukodystrophy reference aminoacids
- 16:01, 19 May 2011 (diff | hist) . . (+17) . . Metachromatic leukodystrophy reference aminoacids
- 15:52, 19 May 2011 (diff | hist) . . (+906) . . Metachromatic leukodystrophy reference aminoacids
- 22:38, 15 May 2011 (diff | hist) . . (0) . . m Metachromatic leukodystrophy 2011
- 22:34, 15 May 2011 (diff | hist) . . (0) . . File:Sphingolipid Metabolism Arylsulfatase.png (uploaded a new version of "Image:Sphingolipid Metabolism Arylsulfatase.png") (current)
- 22:30, 15 May 2011 (diff | hist) . . (+26) . . Metachromatic leukodystrophy 2011
- 22:28, 15 May 2011 (diff | hist) . . (+96) . . Metachromatic leukodystrophy 2011
- 22:24, 15 May 2011 (diff | hist) . . (+249) . . Metachromatic leukodystrophy 2011
- 22:21, 15 May 2011 (diff | hist) . . (+53) . . N File:Arylsulfatase reaction.gif (the reaction that is catalysed by the arylsulfatase A) (current)
- 22:00, 15 May 2011 (diff | hist) . . (+156) . . Metachromatic leukodystrophy 2011
- 21:57, 15 May 2011 (diff | hist) . . (+205) . . Metachromatic leukodystrophy reference aminoacids
- 21:50, 15 May 2011 (diff | hist) . . (+424) . . Metachromatic leukodystrophy reference nucleotide
- 21:42, 15 May 2011 (diff | hist) . . (+102) . . Metachromatic leukodystrophy reference nucleotide
- 21:41, 15 May 2011 (diff | hist) . . (+5,587) . . N Metachromatic leukodystrophy reference nucleotide (New page: >gi|315573165:5007-10426 Homo sapiens arylsulfatase A (ARSA), RefSeqGene on chromosome 22 CACAGGTCACGGGGCGGGGCCGAGGCGGAAGCGCCCGCAGCCCGGTACCGGCTCCTCCTGGGCTCCCTCT AGCGCCTTCCCCCCGGCCCGACTCCGC...)
- 21:36, 15 May 2011 (diff | hist) . . (+52) . . N File:Chromosome22 gene location ARSA.jpeg (location of the ARSA gene on the human chromosome 22) (current)
- 21:26, 15 May 2011 (diff | hist) . . (+524) . . N Metachromatic leukodystrophy reference aminoacids (New page: >1AUK:A|PDBID|CHAIN|SEQUENCE RPPNIVLIFADDLGYGDLGCYGHPSSTTPNLDQLAAGGLRFTDFYVPVSLGTPSRAALLTGRLPVRMGMYPGVLVPSSRG GLPLEEVTVAEVLAARGYLTGMAGKWHLGVGPEGAFLPPHQGFHRFLGIPYSHDQGPCQNLTCFPPATPCDGGCDQGL...)
- 21:24, 15 May 2011 (diff | hist) . . (+659) . . Metachromatic leukodystrophy 2011
- 21:00, 15 May 2011 (diff | hist) . . (-783) . . Metachromatic leukodystrophy 2011
- 20:58, 15 May 2011 (diff | hist) . . (+1,308) . . Metachromatic leukodystrophy 2011
- 20:44, 15 May 2011 (diff | hist) . . (+51) . . N File:Sphingolipid Metabolism Arylsulfatase.png (sphingolipid_metabolism with marked arylsulfatase A)
- 20:40, 15 May 2011 (diff | hist) . . (+69) . . N File:Sphingolipid Metabolism.png (sphingolipid metabolism taken from kegg -> 3.1.6.8 is arylsulfatase A) (current)
- 20:38, 15 May 2011 (diff | hist) . . (+44) . . N File:ArylsulfataseA structure.jpg (structure of arylsulfatase A; taken from PDB) (current)
- 20:33, 15 May 2011 (diff | hist) . . (-22) . . Metachromatic leukodystrophy 2011
- 23:11, 13 May 2011 (diff | hist) . . (+98) . . Metachromatic leukodystrophy 2011
- 23:04, 13 May 2011 (diff | hist) . . (0) . . Metachromatic leukodystrophy 2011
- 23:03, 13 May 2011 (diff | hist) . . (+4,153) . . N Metachromatic leukodystrophy 2011 (New page: == Summary == Metachromatic leukodistrophy (MLD) is an incurable, autosomal recessive inherited disease, which is caused by a mutation in the enzyme Arylsulfatase A (ARS A) and belongs to ...)
- 23:03, 13 May 2011 (diff | hist) . . (0) . . Protein Structure and Function Analysis (version: SS 2011)
- 23:02, 13 May 2011 (diff | hist) . . (-4,153) . . Metachromatic leukodistrophy (Removing all content from page) (current)
- 23:01, 13 May 2011 (diff | hist) . . (+3) . . Disease list 2011
- 23:01, 13 May 2011 (diff | hist) . . (+73) . . Metachromatic leukodistrophy
- 22:51, 13 May 2011 (diff | hist) . . (+4,080) . . N Metachromatic leukodistrophy (New page: == Summary == Metachromatic leukodistrophy (MLD) is an incurable, autosomal recessive inherited disease, which is caused by a mutation in the enzyme Arylsulfatase A (ARS A) and belongs to ...)
- 22:49, 13 May 2011 (diff | hist) . . (+39) . . Protein Structure and Function Analysis (version: SS 2011)