User contributions
From Bioinformatikpedia
(newest | oldest) View (newer 500 | older 500) (20 | 50 | 100 | 250 | 500)
- 20:52, 3 June 2013 (diff | hist) . . (+540) . . Gaucher Disease: Task 04 - Structural Alignment (→SSAP (CATH used))
- 20:41, 3 June 2013 (diff | hist) . . (+7) . . Gaucher Disease: Task 04 - Structural Alignment (→CATH used)
- 19:44, 3 June 2013 (diff | hist) . . (+15) . . Gaucher Disease: Task 04 - Structural Alignment (→Sequences of Data Set)
- 19:43, 3 June 2013 (diff | hist) . . (+230) . . Gaucher Disease: Task 04 - Structural Alignment (→Sequences of Data Set)
- 19:36, 3 June 2013 (diff | hist) . . (+24) . . Gaucher Disease: Task 04 - Structural Alignment (→Sequences of Data Set)
- 19:34, 3 June 2013 (diff | hist) . . (+582) . . Gaucher Disease: Task 04 - Structural Alignment (→Sequences of Data Set)
- 19:20, 3 June 2013 (diff | hist) . . (-3) . . Gaucher Disease: Task 04 - Structural Alignment (→Sequences of Data Set)
- 19:20, 3 June 2013 (diff | hist) . . (+390) . . Gaucher Disease: Task 04 - Structural Alignment (→Sequences of Data Set)
- 19:14, 3 June 2013 (diff | hist) . . (+99) . . Gaucher Disease: Task 04 - Structural Alignment (→Exploring Structural Alignments)
- 19:11, 3 June 2013 (diff | hist) . . (+103) . . N Gaucher Disease: Task 04 - Structural Alignment (Created page with "==Exploring Structural Alignments== == Evaluation of structural alignments and sequence alignments ==")
- 19:10, 3 June 2013 (diff | hist) . . (+92) . . Gaucher Disease
- 00:11, 28 May 2013 (diff | hist) . . (+118) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Aeropyrum pernix Voltage-gated potassium channel)
- 00:09, 28 May 2013 (diff | hist) . . (+417) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Aeropyrum pernix Voltage-gated potassium channel)
- 00:01, 28 May 2013 (diff | hist) . . (+48) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Aeropyrum pernix Voltage-gated potassium channel)
- 23:58, 27 May 2013 (diff | hist) . . (+85) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Aeropyrum pernix Voltage-gated potassium channel)
- 23:56, 27 May 2013 (diff | hist) . . (+270) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Aeropyrum pernix Voltage-gated potassium channel)
- 23:52, 27 May 2013 (diff | hist) . . (+574) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Aeropyrum pernix Voltage-gated potassium channel)
- 23:15, 27 May 2013 (diff | hist) . . (+325) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Human Lysosome-associated membrane glycoprotein 1)
- 23:09, 27 May 2013 (diff | hist) . . (+258) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Human Lysosome-associated membrane glycoprotein 1)
- 23:05, 27 May 2013 (diff | hist) . . (+318) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Human Lysosome-associated membrane glycoprotein 1)
- 22:40, 27 May 2013 (diff | hist) . . (+73) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Human Lysosome-associated membrane glycoprotein 1)
- 22:38, 27 May 2013 (diff | hist) . . (+556) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Human Glucosylceramidase)
- 22:14, 27 May 2013 (diff | hist) . . (+179) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 22:11, 27 May 2013 (diff | hist) . . (+712) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Lysosome-associated membrane glycoprotein 1 (P47863))
- 22:06, 27 May 2013 (diff | hist) . . (+61) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Lysosome-associated membrane glycoprotein 1 (P47863))
- 22:02, 27 May 2013 (diff | hist) . . (+328) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Aquaporin 4 (P11279))
- 21:53, 27 May 2013 (diff | hist) . . (0) . . N File:Hydropathy P11279.png (current)
- 21:53, 27 May 2013 (diff | hist) . . (+588) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Aquaporin 4 (P11279))
- 21:52, 27 May 2013 (diff | hist) . . (+156) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Aquaporin 4 (P11279))
- 21:45, 27 May 2013 (diff | hist) . . (+39) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Glucosylceramidase (P04062))
- 21:44, 27 May 2013 (diff | hist) . . (+201) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Other available methods)
- 21:34, 27 May 2013 (diff | hist) . . (+90) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Other available methods)
- 21:33, 27 May 2013 (diff | hist) . . (+311) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Other available methods)
- 21:27, 27 May 2013 (diff | hist) . . (-270) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Other available methods)
- 21:25, 27 May 2013 (diff | hist) . . (-47) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Other available methods)
- 21:24, 27 May 2013 (diff | hist) . . (+1) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Other available methods)
- 21:23, 27 May 2013 (diff | hist) . . (+2) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Other available methods)
- 21:21, 27 May 2013 (diff | hist) . . (+6) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Other available methods)
- 21:21, 27 May 2013 (diff | hist) . . (0) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Other available methods)
- 21:20, 27 May 2013 (diff | hist) . . (+210) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Other available methods)
- 21:16, 27 May 2013 (diff | hist) . . (+54) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Other available methods)
- 21:14, 27 May 2013 (diff | hist) . . (-1) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Aquaporin 4 (P11279))
- 21:07, 27 May 2013 (diff | hist) . . (+86) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Serum albumin (P02768))
- 21:06, 27 May 2013 (diff | hist) . . (+47) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Glucosylceramidase (P04062))
- 21:04, 27 May 2013 (diff | hist) . . (+10) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Glucosylceramidase (P04062))
- 21:03, 27 May 2013 (diff | hist) . . (+197) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Glucosylceramidase (P04062))
- 20:54, 27 May 2013 (diff | hist) . . (+214) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Serum albumin (P02768))
- 20:48, 27 May 2013 (diff | hist) . . (0) . . N File:Hydropathy P02768.png (current)
- 20:48, 27 May 2013 (diff | hist) . . (+33) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Serum albumin (P02768))
- 20:47, 27 May 2013 (diff | hist) . . (+1) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Serum albumin (P02768))
- 20:47, 27 May 2013 (diff | hist) . . (+553) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Serum albumin (P02768))
- 20:44, 27 May 2013 (diff | hist) . . (+150) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Serum albumin (P02768))
- 20:39, 27 May 2013 (diff | hist) . . (+96) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Glucosylceramidase (P04062))
- 20:38, 27 May 2013 (diff | hist) . . (+331) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Glucosylceramidase (P04062))
- 20:29, 27 May 2013 (diff | hist) . . (+209) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Glucosylceramidase (P04062))
- 20:21, 27 May 2013 (diff | hist) . . (+399) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Glucosylceramidase (P04062))
- 20:15, 27 May 2013 (diff | hist) . . (+204) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Glucosylceramidase (P04062))
- 20:08, 27 May 2013 (diff | hist) . . (0) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Glucosylceramidase (P04062))
- 20:08, 27 May 2013 (diff | hist) . . (+22) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Glucosylceramidase (P04062))
- 20:06, 27 May 2013 (diff | hist) . . (-15) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Glucosylceramidase (P04062))
- 20:05, 27 May 2013 (diff | hist) . . (+10) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Glucosylceramidase (P04062))
- 20:05, 27 May 2013 (diff | hist) . . (+24) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Glucosylceramidase (P04062))
- 19:58, 27 May 2013 (diff | hist) . . (+2) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Glucosylceramidase (P04062))
- 19:58, 27 May 2013 (diff | hist) . . (+5) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Glucosylceramidase (P04062))
- 19:56, 27 May 2013 (diff | hist) . . (0) . . N File:Hydropathy P04062.png (current)
- 19:56, 27 May 2013 (diff | hist) . . (0) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Glucosylceramidase (P04062))
- 19:54, 27 May 2013 (diff | hist) . . (-15) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Glucosylceramidase (P04062))
- 19:51, 27 May 2013 (diff | hist) . . (-6) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Glucosylceramidase (P04062))
- 19:51, 27 May 2013 (diff | hist) . . (+116) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Glucosylceramidase (P04062))
- 19:45, 27 May 2013 (diff | hist) . . (+309) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Signal Peptides)
- 19:28, 27 May 2013 (diff | hist) . . (+83) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 19:23, 27 May 2013 (diff | hist) . . (+53) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 19:22, 27 May 2013 (diff | hist) . . (+34) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 19:21, 27 May 2013 (diff | hist) . . (+249) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Signal Peptides)
- 16:52, 27 May 2013 (diff | hist) . . (+7) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 16:52, 27 May 2013 (diff | hist) . . (+6) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 16:51, 27 May 2013 (diff | hist) . . (+38) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 16:48, 27 May 2013 (diff | hist) . . (-6) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 16:46, 27 May 2013 (diff | hist) . . (-4) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 16:44, 27 May 2013 (diff | hist) . . (0) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 16:38, 27 May 2013 (diff | hist) . . (+264) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 16:27, 27 May 2013 (diff | hist) . . (-9) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 16:15, 27 May 2013 (diff | hist) . . (+198) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 16:03, 27 May 2013 (diff | hist) . . (+11) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 16:01, 27 May 2013 (diff | hist) . . (0) . . N File:Cartoon P35462.png (current)
- 16:01, 27 May 2013 (diff | hist) . . (+376) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 15:53, 27 May 2013 (diff | hist) . . (+56) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 15:50, 27 May 2013 (diff | hist) . . (+132) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 15:49, 27 May 2013 (diff | hist) . . (+175) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 15:35, 27 May 2013 (diff | hist) . . (0) . . N File:Cartoon P47863.png (current)
- 15:34, 27 May 2013 (diff | hist) . . (+50) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 15:32, 27 May 2013 (diff | hist) . . (+78) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 15:29, 27 May 2013 (diff | hist) . . (+223) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 15:08, 27 May 2013 (diff | hist) . . (+115) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 15:05, 27 May 2013 (diff | hist) . . (+107) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 21:52, 26 May 2013 (diff | hist) . . (0) . . N File:Graphik P35462.png (current)
- 21:52, 26 May 2013 (diff | hist) . . (+46) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 21:51, 26 May 2013 (diff | hist) . . (+106) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 21:47, 26 May 2013 (diff | hist) . . (0) . . N File:Graphik P47863.png (current)
- 21:46, 26 May 2013 (diff | hist) . . (+109) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 21:44, 26 May 2013 (diff | hist) . . (+10) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 21:43, 26 May 2013 (diff | hist) . . (+141) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 21:33, 26 May 2013 (diff | hist) . . (+92) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 21:29, 26 May 2013 (diff | hist) . . (+6) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 21:28, 26 May 2013 (diff | hist) . . (+160) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 21:22, 26 May 2013 (diff | hist) . . (+130) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 21:18, 26 May 2013 (diff | hist) . . (+94) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 21:16, 26 May 2013 (diff | hist) . . (0) . . N File:1ogs.png (current)
- 21:16, 26 May 2013 (diff | hist) . . (+73) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 21:13, 26 May 2013 (diff | hist) . . (0) . . N File:Graphik P04062.png (current)
- 21:13, 26 May 2013 (diff | hist) . . (-1) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 21:12, 26 May 2013 (diff | hist) . . (0) . . N File:Cartoon P04062.png (current)
- 21:11, 26 May 2013 (diff | hist) . . (+606) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 20:00, 26 May 2013 (diff | hist) . . (+2,530) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 19:53, 26 May 2013 (diff | hist) . . (-2) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 19:50, 26 May 2013 (diff | hist) . . (+27) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 19:49, 26 May 2013 (diff | hist) . . (+1) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 19:49, 26 May 2013 (diff | hist) . . (+30) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 19:43, 26 May 2013 (diff | hist) . . (+148) . . File:1ors lm.png (current)
- 19:42, 26 May 2013 (diff | hist) . . (0) . . N File:1ors lm.png
- 19:41, 26 May 2013 (diff | hist) . . (+82) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 19:34, 26 May 2013 (diff | hist) . . (+7) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 19:22, 26 May 2013 (diff | hist) . . (0) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 19:22, 26 May 2013 (diff | hist) . . (+82) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 19:19, 26 May 2013 (diff | hist) . . (+6) . . File:1ors-Q9YDF.png (current)
- 19:19, 26 May 2013 (diff | hist) . . (+140) . . N File:1ors-Q9YDF.png (Visualisation of the transmembrane helices of 1ORS on OPM. The blue dots represent the cytoplasmic side, the red dots the extracellular side)
- 19:17, 26 May 2013 (diff | hist) . . (+84) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 18:39, 26 May 2013 (diff | hist) . . (+57) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 18:29, 26 May 2013 (diff | hist) . . (+1) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 18:29, 26 May 2013 (diff | hist) . . (+82) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 18:28, 26 May 2013 (diff | hist) . . (-2) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 18:27, 26 May 2013 (diff | hist) . . (-34) . . File:Graphik Q9YDF8.png (Blanked the page) (current)
- 18:27, 26 May 2013 (diff | hist) . . (+34) . . N File:Graphik Q9YDF8.png (Q9YDF8 prediction with Polyphobius)
- 18:26, 26 May 2013 (diff | hist) . . (+45) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 18:25, 26 May 2013 (diff | hist) . . (+6) . . File:Cartoon Q9YDF8.png (current)
- 18:24, 26 May 2013 (diff | hist) . . (+61) . . File:Cartoon Q9YDF8.png
- 18:23, 26 May 2013 (diff | hist) . . (-61) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 18:22, 26 May 2013 (diff | hist) . . (-101) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 18:22, 26 May 2013 (diff | hist) . . (+137) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 18:20, 26 May 2013 (diff | hist) . . (0) . . N File:Cartoon Q9YDF8.png
- 18:20, 26 May 2013 (diff | hist) . . (+107) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 18:15, 26 May 2013 (diff | hist) . . (+72) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 18:15, 26 May 2013 (diff | hist) . . (+100) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 18:12, 26 May 2013 (diff | hist) . . (+18) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 18:12, 26 May 2013 (diff | hist) . . (+6) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 18:11, 26 May 2013 (diff | hist) . . (+73) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 18:10, 26 May 2013 (diff | hist) . . (+253) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 18:05, 26 May 2013 (diff | hist) . . (+623) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 17:55, 26 May 2013 (diff | hist) . . (+57) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 17:52, 26 May 2013 (diff | hist) . . (+36) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 17:51, 26 May 2013 (diff | hist) . . (-4) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 17:51, 26 May 2013 (diff | hist) . . (+5) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 17:50, 26 May 2013 (diff | hist) . . (+63) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 17:49, 26 May 2013 (diff | hist) . . (+66) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 17:47, 26 May 2013 (diff | hist) . . (-63) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 17:46, 26 May 2013 (diff | hist) . . (+52) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 17:46, 26 May 2013 (diff | hist) . . (+1) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 17:45, 26 May 2013 (diff | hist) . . (+9) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 17:45, 26 May 2013 (diff | hist) . . (+28) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 17:42, 26 May 2013 (diff | hist) . . (+24) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 17:24, 26 May 2013 (diff | hist) . . (+130) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 17:20, 26 May 2013 (diff | hist) . . (+4) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 19:06, 25 May 2013 (diff | hist) . . (+45) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 19:05, 25 May 2013 (diff | hist) . . (+207) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 19:01, 25 May 2013 (diff | hist) . . (+346) . . Gaucher Disease: Task 03 - Sequence-based predictions (→Transmembrane Helices)
- 18:55, 25 May 2013 (diff | hist) . . (+103) . . N Gaucher Disease: Task 03 - Sequence-based predictions (Created page with "==Secondary Structure== ==Disorder== ==Transmembrane Helices== ==Signal Peptides== ==GO Terms==")
- 22:53, 6 May 2013 (diff | hist) . . (+16) . . Gaucher Disease: Task 02 - Alignments (→Description)
- 22:52, 6 May 2013 (diff | hist) . . (+14) . . Gaucher Disease: Task 02 - Alignments (→Description)
- 22:34, 6 May 2013 (diff | hist) . . (+148) . . Gaucher Disease: Task 02 - Alignments (→For future research)
- 22:31, 6 May 2013 (diff | hist) . . (+94) . . Gaucher Disease: Task 02 - Alignments (→ClustalW)
- 22:24, 6 May 2013 (diff | hist) . . (+1) . . Gaucher Disease: Task 02 - Alignments (→For future research)
- 22:23, 6 May 2013 (diff | hist) . . (+222) . . Gaucher Disease: Task 02 - Alignments (→For future research)
- 22:19, 6 May 2013 (diff | hist) . . (-81) . . Gaucher Disease: Task 02 - Alignments (→Alignment Comparison)
- 22:18, 6 May 2013 (diff | hist) . . (+88) . . Gaucher Disease: Task 02 - Alignments (→ClustalW)
- 22:06, 6 May 2013 (diff | hist) . . (+32) . . Gaucher Disease: Task 02 - Alignments (→Espresso)
- 22:01, 6 May 2013 (diff | hist) . . (+77) . . Gaucher Disease: Task 02 - Alignments (→Espresso)
- 21:50, 6 May 2013 (diff | hist) . . (+120) . . Gaucher Disease: Task 02 - Alignments (→For future research)
- 21:48, 6 May 2013 (diff | hist) . . (+12) . . Gaucher Disease: Task 02 - Alignments (→Espresso)
- 21:47, 6 May 2013 (diff | hist) . . (+12) . . Gaucher Disease: Task 02 - Alignments (→T-Coffee)
- 21:46, 6 May 2013 (diff | hist) . . (+12) . . Gaucher Disease: Task 02 - Alignments (→Muscle)
- 21:44, 6 May 2013 (diff | hist) . . (+12) . . Gaucher Disease: Task 02 - Alignments (→ClustalW)
- 21:37, 6 May 2013 (diff | hist) . . (+160) . . Gaucher Disease: Task 02 - Alignments (→Multiple Sequence Alignment)
- 21:02, 6 May 2013 (diff | hist) . . (+301) . . Gaucher Disease: Task 02 - Alignments (→For future research)
- 20:37, 6 May 2013 (diff | hist) . . (+47) . . Gaucher Disease: Task 02 - Alignments (→Alignment Comparison)
- 20:34, 6 May 2013 (diff | hist) . . (0) . . Gaucher Disease: Task 02 - Alignments (→Espresso)
- 20:33, 6 May 2013 (diff | hist) . . (0) . . Gaucher Disease: Task 02 - Alignments (→T-Coffee)
- 19:22, 6 May 2013 (diff | hist) . . (+172) . . Gaucher Disease: Task 02 - Alignments (→Multiple Sequence Alignment)
- 19:18, 6 May 2013 (diff | hist) . . (+570) . . Gaucher Disease: Task 02 - Alignments (→Alignment Comparison)
- 19:08, 6 May 2013 (diff | hist) . . (-1) . . Gaucher Disease: Task 02 - Alignments (→Espresso)
- 19:07, 6 May 2013 (diff | hist) . . (+60) . . Gaucher Disease: Task 02 - Alignments (→Espresso)
- 19:05, 6 May 2013 (diff | hist) . . (+3) . . Gaucher Disease: Task 02 - Alignments (→Espresso)
- 19:04, 6 May 2013 (diff | hist) . . (+289) . . Gaucher Disease: Task 02 - Alignments (→Espresso)
- 18:54, 6 May 2013 (diff | hist) . . (+10) . . Gaucher Disease: Task 02 - Alignments (→Multiple Sequence Alignment)
- 18:54, 6 May 2013 (diff | hist) . . (+254) . . Gaucher Disease: Task 02 - Alignments (→Alignment Comparison)
- 18:15, 6 May 2013 (diff | hist) . . (+131) . . Gaucher Disease: Task 02 - Alignments (→Alignment Comparison)
- 18:08, 6 May 2013 (diff | hist) . . (+358) . . Gaucher Disease: Task 02 - Alignments (→Espresso)
- 17:49, 6 May 2013 (diff | hist) . . (+324) . . Gaucher Disease: Task 02 - Alignments (→Espresso)
- 17:38, 6 May 2013 (diff | hist) . . (-153) . . Gaucher Disease: Task 02 - Alignments (→Espresso)
- 17:37, 6 May 2013 (diff | hist) . . (+9) . . Gaucher Disease: Task 02 - Alignments (→Espresso)
- 17:30, 6 May 2013 (diff | hist) . . (+114) . . Gaucher Disease: Task 02 - Alignments (→Espresso)
- 17:28, 6 May 2013 (diff | hist) . . (+57) . . Gaucher Disease: Task 02 - Alignments (→Espresso)
- 17:20, 6 May 2013 (diff | hist) . . (+19) . . Multiple Sequence Alignment: Espresso - set 1 (current)
- 17:16, 6 May 2013 (diff | hist) . . (+38,806) . . N Multiple Sequence Alignment: Espresso - set 1 (Created page with "<html><head> <meta http-equiv="content-type" content="text/html; charset=UTF-8"><style> SPAN { font-family: courier new, courier-new, courier, monospace; font-weight: bold; font-…")
- 17:16, 6 May 2013 (diff | hist) . . (+1) . . Gaucher Disease: Task 02 - Alignments (→Espresso)
- 17:15, 6 May 2013 (diff | hist) . . (+747) . . Gaucher Disease: Task 02 - Alignments (→Multiple Sequence Alignment)
- 16:03, 6 May 2013 (diff | hist) . . (+1) . . Gaucher Disease: Task 02 - Alignments (→T-Coffee)
- 16:03, 6 May 2013 (diff | hist) . . (-3) . . Gaucher Disease: Task 02 - Alignments (→T-Coffee)
- 16:02, 6 May 2013 (diff | hist) . . (+428) . . Gaucher Disease: Task 02 - Alignments (→T-Coffee)
- 16:02, 6 May 2013 (diff | hist) . . (+45) . . Multiple Sequence Alignment: T-Coffee - set 3 (current)
- 16:01, 6 May 2013 (diff | hist) . . (+490) . . Multiple Sequence Alignment: T-Coffee - set 3
- 15:58, 6 May 2013 (diff | hist) . . (+665) . . Multiple Sequence Alignment: T-Coffee - set 3
- 15:44, 6 May 2013 (diff | hist) . . (+3) . . Gaucher Disease: Task 02 - Alignments (→T-Coffee)
- 15:41, 6 May 2013 (diff | hist) . . (+27,286) . . Multiple Sequence Alignment: T-Coffee - set 3
- 15:38, 6 May 2013 (diff | hist) . . (+730) . . Gaucher Disease: Task 02 - Alignments (→T-Coffee)
- 15:00, 6 May 2013 (diff | hist) . . (+4) . . Gaucher Disease: Task 02 - Alignments (→T-Coffee)
- 14:56, 6 May 2013 (diff | hist) . . (+20,778) . . Multiple Sequence Alignment: T-Coffee - set 2 (current)
- 14:53, 6 May 2013 (diff | hist) . . (+51) . . N Multiple Sequence Alignment: T-Coffee - set 3 (Created page with "The native protein is colored red in the Alignment.")
- 14:53, 6 May 2013 (diff | hist) . . (+51) . . N Multiple Sequence Alignment: T-Coffee - set 2 (Created page with "The native protein is colored red in the Alignment.")
- 14:52, 6 May 2013 (diff | hist) . . (+12) . . Multiple Sequence Alignment: T-Coffee - set 1
- 14:52, 6 May 2013 (diff | hist) . . (+267) . . Multiple Sequence Alignment: T-Coffee - set 1
- 14:47, 6 May 2013 (diff | hist) . . (+35) . . Multiple Sequence Alignment: T-Coffee - set 1
- 14:46, 6 May 2013 (diff | hist) . . (+35) . . Multiple Sequence Alignment: T-Coffee - set 1
- 14:43, 6 May 2013 (diff | hist) . . (+1,505) . . Multiple Sequence Alignment: T-Coffee - set 1
- 14:37, 6 May 2013 (diff | hist) . . (+257) . . Gaucher Disease: Task 02 - Alignments (→T-Coffee)
- 14:30, 6 May 2013 (diff | hist) . . (+644) . . Gaucher Disease: Task 02 - Alignments (→T-Coffee)
- 14:20, 6 May 2013 (diff | hist) . . (+11,156) . . N Multiple Sequence Alignment: T-Coffee - set 1 (Created page with "The native protein is colored red in the Alignment. CLUSTAL FORMAT for T-COFFEE Version_8.47 [http://www.tcoffee.org] [MODE: ], CPU=0.12 sec, SCORE=98, Nseq=10, Len=621 <…")
- 14:19, 6 May 2013 (diff | hist) . . (+433) . . Gaucher Disease: Task 02 - Alignments (→T-Coffee)
- 14:14, 6 May 2013 (diff | hist) . . (+300) . . Gaucher Disease: Task 02 - Alignments (→T-Coffee)
- 14:13, 6 May 2013 (diff | hist) . . (+392) . . Gaucher Disease: Task 02 - Alignments (→Muscle)
- 14:03, 6 May 2013 (diff | hist) . . (+24,498) . . N Multiple Sequence Alignment: Muscle - set 3 (Created page with "The native protein is colored red in the Alignment. MUSCLE (3.8) multiple sequence alignment tr|E5UPZ0|E5UPZ0_9BACE -------------------------------------------------…") (current)
- 13:53, 6 May 2013 (diff | hist) . . (+55) . . Multiple Sequence Alignment: Muscle - set 2 (current)
- 13:51, 6 May 2013 (diff | hist) . . (+643) . . Gaucher Disease: Task 02 - Alignments (→Muscle)
- 13:37, 6 May 2013 (diff | hist) . . (+19,225) . . N Multiple Sequence Alignment: Muscle - set 2 (Created page with "MUSCLE (3.8) multiple sequence alignment tr|I9HH59|I9HH59_BACOV ----------------MKTQ----SCMNRLLWITLLVIGLSGC-------------SEES <span style="color:#a30909">P04062 …")
- 13:34, 6 May 2013 (diff | hist) . . (+712) . . Gaucher Disease: Task 02 - Alignments (→Muscle)
- 13:31, 6 May 2013 (diff | hist) . . (-1) . . Multiple Sequence Alignment: Muscle - set 1 (current)
- 13:31, 6 May 2013 (diff | hist) . . (+179) . . Multiple Sequence Alignment: Muscle - set 1
- 13:29, 6 May 2013 (diff | hist) . . (+280) . . Multiple Sequence Alignment: Muscle - set 1
- 12:41, 6 May 2013 (diff | hist) . . (-3) . . Gaucher Disease: Task 02 - Alignments (→Muscle)
- 12:39, 6 May 2013 (diff | hist) . . (+4) . . Gaucher Disease: Task 02 - Alignments (→Muscle)
- 12:38, 6 May 2013 (diff | hist) . . (-11) . . Multiple Sequence Alignment: Muscle - set 1
- 12:37, 6 May 2013 (diff | hist) . . (+10,871) . . N Multiple Sequence Alignment: Muscle - set 1 (Created page with " MUSCLE (3.8) multiple sequence alignment tr|B7Z6S9|B7Z6S9_HUMAN MSDRLFSNPGPAPTPQGCFSRGCGWSGCILPSESYCAGPQSPVPPRRLCRLRWDFVLPPV tr|F5H241|F5H241_HUMAN -------------…")
- 12:27, 6 May 2013 (diff | hist) . . (+432) . . Gaucher Disease: Task 02 - Alignments (→Muscle)
- 12:26, 6 May 2013 (diff | hist) . . (+286) . . Gaucher Disease: Task 02 - Alignments (→Muscle)
- 12:25, 6 May 2013 (diff | hist) . . (+1) . . Gaucher Disease: Task 02 - Alignments (→ClustalW)
- 12:17, 6 May 2013 (diff | hist) . . (+18) . . Gaucher Disease: Task 02 - Alignments (→ClustalW)
- 11:21, 6 May 2013 (diff | hist) . . (+47) . . Gaucher Disease: Task 02 - Alignments (→ClustalW)
- 11:17, 6 May 2013 (diff | hist) . . (+257) . . Gaucher Disease: Task 02 - Alignments (→ClustalW)
- 11:11, 6 May 2013 (diff | hist) . . (+11) . . Gaucher Disease: Task 02 - Alignments (→ClustalW)
- 11:10, 6 May 2013 (diff | hist) . . (+145) . . Multiple Sequence Alignment: ClustalW - set 3 (current)
- 11:09, 6 May 2013 (diff | hist) . . (+197) . . Multiple Sequence Alignment: ClustalW - set 1 (current)
- 11:07, 6 May 2013 (diff | hist) . . (+54) . . Multiple Sequence Alignment: ClustalW - set 2 (current)
- 11:05, 6 May 2013 (diff | hist) . . (+3,640) . . Multiple Sequence Alignment: ClustalW - set 3
- 10:58, 6 May 2013 (diff | hist) . . (+35) . . Multiple Sequence Alignment: ClustalW - set 3
- 10:54, 6 May 2013 (diff | hist) . . (+25,156) . . N Multiple Sequence Alignment: ClustalW - set 3 (Created page with "CLUSTAL 2.1 multiple sequence alignment tr|J2STU0|J2STU0_9FLAO -------------------------------------------------- tr|D4SV88|D4SV88_9XANT -------------------------…")
- 10:49, 6 May 2013 (diff | hist) . . (+147) . . Multiple Sequence Alignment: ClustalW - set 2
- 10:48, 6 May 2013 (diff | hist) . . (+622) . . Multiple Sequence Alignment: ClustalW - set 2
- 10:42, 6 May 2013 (diff | hist) . . (+525) . . Multiple Sequence Alignment: ClustalW - set 1
- 10:40, 6 May 2013 (diff | hist) . . (0) . . m Multiple Sequence Alignment: ClustalW - set 1
- 10:39, 6 May 2013 (diff | hist) . . (+37) . . Multiple Sequence Alignment: ClustalW - set 1
- 10:34, 6 May 2013 (diff | hist) . . (+19,157) . . N Multiple Sequence Alignment: ClustalW - set 2 (Created page with " CLUSTAL 2.1 multiple sequence alignment tr|E2LY19|E2LY19_MONPE ----------------------------------------MRPLAFSILL tr|K9HBW2|K9HBW2_AGABB ------------------------…")
- 10:34, 6 May 2013 (diff | hist) . . (+216) . . Gaucher Disease: Task 02 - Alignments (→ClustalW)
- 23:47, 5 May 2013 (diff | hist) . . (+210) . . Gaucher Disease: Task 02 - Alignments (→ClustalW)
- 23:46, 5 May 2013 (diff | hist) . . (+1) . . Multiple Sequence Alignment: ClustalW - set 1
- 23:34, 5 May 2013 (diff | hist) . . (+270) . . Gaucher Disease: Task 02 - Alignments (→ClustalW)
- 23:20, 5 May 2013 (diff | hist) . . (+43) . . Multiple Sequence Alignment: ClustalW - set 1
- 23:19, 5 May 2013 (diff | hist) . . (+700) . . Multiple Sequence Alignment: ClustalW - set 1
- 23:17, 5 May 2013 (diff | hist) . . (+40) . . Multiple Sequence Alignment: ClustalW - set 1
- 23:16, 5 May 2013 (diff | hist) . . (+1) . . Multiple Sequence Alignment: ClustalW - set 1
- 23:15, 5 May 2013 (diff | hist) . . (+156) . . Multiple Sequence Alignment: ClustalW - set 1
- 23:11, 5 May 2013 (diff | hist) . . (+11) . . Multiple Sequence Alignment: ClustalW - set 1
- 23:05, 5 May 2013 (diff | hist) . . (+352) . . Gaucher Disease: Task 02 - Alignments (→ClustalW)
- 22:58, 5 May 2013 (diff | hist) . . (+54) . . Gaucher Disease: Task 02 - Alignments (→ClustalW)
- 22:52, 5 May 2013 (diff | hist) . . (+302) . . Gaucher Disease: Task 02 - Alignments (→Multiple Sequence Alignment)
- 22:47, 5 May 2013 (diff | hist) . . (+2) . . Gaucher Disease: Task 02 - Alignments (→ClustalW)
- 22:41, 5 May 2013 (diff | hist) . . (+2) . . Gaucher Disease: Task 02 - Alignments (→ClustalW)
- 22:41, 5 May 2013 (diff | hist) . . (+48) . . Gaucher Disease: Task 02 - Alignments (→ClustalW)
- 22:40, 5 May 2013 (diff | hist) . . (+352) . . Gaucher Disease: Task 02 - Alignments (→Multiple Sequence Alignment)
- 22:34, 5 May 2013 (diff | hist) . . (+27) . . Gaucher Disease: Task 02 - Alignments (→ClustalW)
- 22:32, 5 May 2013 (diff | hist) . . (-26) . . Gaucher Disease: Task 02 - Alignments (→ClustalW)
- 22:31, 5 May 2013 (diff | hist) . . (+13,501) . . N Multiple Sequence Alignment: ClustalW - set 1 (Created page with "CLUSTAL 2.1 multiple sequence alignment tr|A9UD35|A9UD35_DELDE -------------------------------------------------- tr|F5CB27|F5CB27_DELCA -----------------------------…")
- 22:31, 5 May 2013 (diff | hist) . . (+7) . . Gaucher Disease: Task 02 - Alignments (→ClustalW)
- 22:30, 5 May 2013 (diff | hist) . . (+77) . . Gaucher Disease: Task 02 - Alignments (→ClustalW)
- 22:25, 5 May 2013 (diff | hist) . . (0) . . Gaucher Disease: Task 02 - Alignments (→Multiple Sequence Alignment)
- 22:25, 5 May 2013 (diff | hist) . . (+4) . . Gaucher Disease: Task 02 - Alignments (→Multiple Sequence Alignment)
- 22:24, 5 May 2013 (diff | hist) . . (+680) . . Gaucher Disease: Task 02 - Alignments (→Multiple Sequence Alignment)
- 22:10, 5 May 2013 (diff | hist) . . (+426) . . Gaucher Disease: Task 02 - Alignments (→Multiple Sequence Alignment)
- 22:04, 5 May 2013 (diff | hist) . . (-2) . . Gaucher Disease: Task 02 - Alignments (→Multiple Sequence Alignment)
- 22:03, 5 May 2013 (diff | hist) . . (+429) . . Gaucher Disease: Task 02 - Alignments (→Multiple Sequence Alignment)
- 21:51, 5 May 2013 (diff | hist) . . (+337) . . Gaucher Disease: Task 02 - Alignments (→Multiple Sequence Alignment)
- 21:46, 5 May 2013 (diff | hist) . . (+32) . . Gaucher Disease: Task 02 - Alignments (→Description)
- 21:28, 5 May 2013 (diff | hist) . . (+20) . . Gaucher Disease: Task 02 - Alignments (→Description)
- 21:27, 5 May 2013 (diff | hist) . . (0) . . Gaucher Disease: Task 02 - Alignments (→Description)
- 21:25, 5 May 2013 (diff | hist) . . (+360) . . Gaucher Disease: Task 02 - Alignments (→Description)
- 21:19, 5 May 2013 (diff | hist) . . (+280) . . Gaucher Disease: Task 02 - Alignments (→Theoretical Background)
- 23:15, 3 May 2013 (diff | hist) . . (+8) . . Gaucher Disease: Task 02 - Alignments
- 23:08, 3 May 2013 (diff | hist) . . (+59) . . Gaucher Disease: Task 02 - Alignments
- 23:00, 3 May 2013 (diff | hist) . . (+73) . . Gaucher Disease: Task 02 - Alignments
- 22:58, 3 May 2013 (diff | hist) . . (+230) . . Gaucher Disease: Task 02 - Alignments
- 22:51, 3 May 2013 (diff | hist) . . (+4) . . N Gaucher Disease: Task 02 - Alignments (Created page with "blub")
- 22:49, 3 May 2013 (diff | hist) . . (+72) . . Gaucher Disease (→Tasks)
- 22:49, 3 May 2013 (diff | hist) . . (-2) . . Gaucher Disease
- 22:48, 3 May 2013 (diff | hist) . . (+13) . . Gaucher Disease
- 21:17, 29 April 2013 (diff | hist) . . (+21) . . Talk:Hemochromatosis
- 21:02, 29 April 2013 (diff | hist) . . (+1) . . Talk:Hemochromatosis
- 21:02, 29 April 2013 (diff | hist) . . (+581) . . Talk:Hemochromatosis
- 07:23, 29 April 2013 (diff | hist) . . (0) . . N File:1ogs bio r 500.jpeg (current)
- 07:22, 29 April 2013 (diff | hist) . . (+154) . . Gaucher Disease (→Gene and Protein Causing the Disease)
- 21:51, 27 April 2013 (diff | hist) . . (-68) . . Gaucher Disease (→Treatment)
- 21:51, 27 April 2013 (diff | hist) . . (+160) . . Gaucher Disease (→Treatment)
- 21:37, 27 April 2013 (diff | hist) . . (-50) . . Gaucher Disease (→Future Treatments)
- 21:36, 27 April 2013 (diff | hist) . . (-9) . . Gaucher Disease (→Treatment)
- 21:35, 27 April 2013 (diff | hist) . . (+578) . . Gaucher Disease (→Treatment)
- 21:10, 27 April 2013 (diff | hist) . . (-28) . . Gaucher Disease (→Treatment)
- 21:08, 27 April 2013 (diff | hist) . . (+4) . . Gaucher Disease (→Phenotypic description of the disease)
- 20:55, 27 April 2013 (diff | hist) . . (+17) . . Gaucher Disease (→Diagnosis)
- 20:49, 27 April 2013 (diff | hist) . . (+845) . . Gaucher Disease (→Eigenschaften)
- 20:49, 27 April 2013 (diff | hist) . . (+19) . . Gaucher Disease
- 20:48, 27 April 2013 (diff | hist) . . (-837) . . Gaucher Disease (→Gene and mutations associated with the disease)
- 13:38, 27 April 2013 (diff | hist) . . (+271) . . Gaucher Disease (→Treatment)
- 12:57, 27 April 2013 (diff | hist) . . (+340) . . Gaucher Disease (→Treatment)
- 12:35, 27 April 2013 (diff | hist) . . (+184) . . Gaucher Disease (→Treatment)
- 12:27, 27 April 2013 (diff | hist) . . (-1) . . Gaucher Disease (→Classification of types and symptoms)
- 12:27, 27 April 2013 (diff | hist) . . (-1) . . Gaucher Disease (→Biochemical disease mechanism)
- 12:26, 27 April 2013 (diff | hist) . . (-21) . . Gaucher Disease (→Biochemical disease mechanism)
- 12:26, 27 April 2013 (diff | hist) . . (+15) . . Gaucher Disease (→Biochemical disease mechanism)
- 12:24, 27 April 2013 (diff | hist) . . (-239) . . Gaucher Disease (→Biochemical disease mechanism)
- 12:23, 27 April 2013 (diff | hist) . . (+113) . . Gaucher Disease (→Biochemical disease mechanism)
- 12:18, 27 April 2013 (diff | hist) . . (0) . . Gaucher Disease (→Biochemical disease mechanism)
- 12:17, 27 April 2013 (diff | hist) . . (-407) . . Gaucher Disease (→Biochemical disease mechanism)
- 12:17, 27 April 2013 (diff | hist) . . (0) . . Gaucher Disease (→Classification of types and symptoms)
- 12:16, 27 April 2013 (diff | hist) . . (0) . . N File:Gaucher-cell.gif (current)
- 12:15, 27 April 2013 (diff | hist) . . (+761) . . Gaucher Disease (→Biochemical disease mechanism)
- 12:14, 27 April 2013 (diff | hist) . . (+149) . . Gaucher Disease (→Biochemical disease mechanism)
- 10:47, 27 April 2013 (diff | hist) . . (-4) . . Gaucher Disease (→Biochemical disease mechanism)
- 10:45, 27 April 2013 (diff | hist) . . (0) . . N File:Pathway bearbeitet.jpg (current)
- 10:45, 27 April 2013 (diff | hist) . . (+153) . . Gaucher Disease (→Biochemical disease mechanism)
- 10:22, 27 April 2013 (diff | hist) . . (-3) . . Gaucher Disease (→Phenotypic description of the disease)
- 10:21, 27 April 2013 (diff | hist) . . (+5) . . Gaucher Disease (→Phenotypic description of the disease)
- 10:21, 27 April 2013 (diff | hist) . . (+145) . . Gaucher Disease (→Phenotypic description of the disease)
- 10:07, 27 April 2013 (diff | hist) . . (+1) . . Gaucher Disease (→References)
- 10:01, 27 April 2013 (diff | hist) . . (+43) . . Gaucher Disease
- 14:18, 23 April 2013 (diff | hist) . . (+6) . . Gaucher Disease (→Classification of types and symptoms)
- 14:15, 23 April 2013 (diff | hist) . . (+45) . . Gaucher Disease (→Type II: acute infantile neuropathic)
- 14:10, 23 April 2013 (diff | hist) . . (+4) . . Gaucher Disease (→Phenotypic description of the disease)
- 14:09, 23 April 2013 (diff | hist) . . (0) . . Gaucher Disease (→Phenotypic description of the disease)
- 14:07, 23 April 2013 (diff | hist) . . (0) . . N File:Gaucher-types-002.gif (current)
- 14:06, 23 April 2013 (diff | hist) . . (+10) . . Gaucher Disease (→Classification of types and symptoms)
- 14:01, 23 April 2013 (diff | hist) . . (+22) . . Gaucher Disease (→Classification of types and symptoms)
- 13:41, 23 April 2013 (diff | hist) . . (+6) . . Gaucher Disease (→Type I: non-neuropathic)
- 13:41, 23 April 2013 (diff | hist) . . (+47) . . Gaucher Disease (→Type I: non-neuropathic)