User contributions
From Bioinformatikpedia
(newest | oldest) View (newer 20 | older 20) (20 | 50 | 100 | 250 | 500)
- 13:50, 23 April 2012 (diff | hist) . . (+12) . . Canavan Disease 2012 (→Protein)
- 13:50, 23 April 2012 (diff | hist) . . (-20) . . Canavan Disease 2012 (→Protein)
- 13:46, 23 April 2012 (diff | hist) . . (+356) . . Canavan Disease 2012 (→Effect of mutations)
- 13:42, 23 April 2012 (diff | hist) . . (+306) . . Canavan Disease 2012 (→Effect of mutations)
- 13:13, 23 April 2012 (diff | hist) . . (+409) . . N Isoform CRA a (Created page with ">gi|119610912|gb|EAW90506.1| aspartoacylase (Canavan disease), isoform CRA_a [Homo sapiens] MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLN RIFDLENLGKKMSED…") (current)
- 13:13, 23 April 2012 (diff | hist) . . (+20) . . Canavan Disease 2012 (→Disease causing mutations)
- 13:12, 23 April 2012 (diff | hist) . . (+406) . . N Isoform CRA b (Created page with ">gi|119610913|gb|EAW90507.1| aspartoacylase (Canavan disease), isoform CRA_b [Homo sapiens] MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLN RIFDLENLGKKMSED…") (current)
- 13:12, 23 April 2012 (diff | hist) . . (+20) . . Canavan Disease 2012 (→Disease causing mutations)
- 13:03, 23 April 2012 (diff | hist) . . (+26) . . Canavan Disease 2012 (→Heredity)
- 13:02, 23 April 2012 (diff | hist) . . (-3) . . Canavan Disease 2012 (→Heredity)
- 13:01, 23 April 2012 (diff | hist) . . (+52) . . Canavan Disease 2012
- 12:49, 23 April 2012 (diff | hist) . . (-63) . . Reference Sequence
- 12:48, 23 April 2012 (diff | hist) . . (-7) . . Reference Sequence
- 12:10, 23 April 2012 (diff | hist) . . (+769) . . Reference Sequence
- 12:08, 23 April 2012 (diff | hist) . . (+2) . . Reference Sequence
- 22:23, 22 April 2012 (diff | hist) . . (-491) . . Canavan Disease 2012 (→Mutations)
- 22:21, 22 April 2012 (diff | hist) . . (+67) . . Canavan Disease 2012 (→Mutations)
- 22:18, 22 April 2012 (diff | hist) . . (+240) . . Canavan Disease 2012 (→Mutations)
- 22:16, 22 April 2012 (diff | hist) . . (+81) . . Canavan Disease 2012 (→Mutations)
- 22:06, 22 April 2012 (diff | hist) . . (+66) . . Canavan Disease 2012 (→Heredity)