User contributions

From Bioinformatikpedia

For Demel (talk | block log | uploads | logs)

Search for contributions

 Show contributions of new accounts only
 IP address or username:

Namespace:  all (Main) Talk User User talk Bioinformatikpedia Bioinformatikpedia talk File File talk MediaWiki MediaWiki talk Template Template talk Help Help talk Category Category talk   Invert selection  Associated namespace 

Tag filter: 

 Only show edits that are latest revisions Only show edits that are page creations Hide minor edits

From date:

To date:

(newest | oldest) View (newer 250 | older 250) (20 | 50 | 100 | 250 | 500)

• 20:00, 30 May 2011 (diff | hist) . . (+57)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎ProtFun 2.2)
• 19:59, 30 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA ProtFun BACR HALSA.png ‎ (current)
• 19:45, 30 May 2011 (diff | hist) . . (+611)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎ProtFun 2.2)
• 19:45, 30 May 2011 (diff | hist) . . (0)‎ . . File:BCKDHA 2.PNG ‎ (uploaded a new version of "File:BCKDHA 2.PNG") (current)
• 19:44, 30 May 2011 (diff | hist) . . (0)‎ . . File:BCKDHA 1.PNG ‎ (uploaded a new version of "File:BCKDHA 1.PNG") (current)
• 19:41, 30 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA 2.PNG ‎
• 19:41, 30 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA 1.PNG ‎
• 10:45, 30 May 2011 (diff | hist) . . (+14)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎Phobius and Polyphobius)
• 10:45, 30 May 2011 (diff | hist) . . (+310)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎Pfam)
• 10:41, 30 May 2011 (diff | hist) . . (+56)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎Pfam)
• 10:40, 30 May 2011 (diff | hist) . . (0)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎Pfam)
• 10:38, 30 May 2011 (diff | hist) . . (+462)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎3. Prediction of transmembrane alpha-helices and signal peptides)
• 10:28, 30 May 2011 (diff | hist) . . (+509)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎3. Prediction of transmembrane alpha-helices and signal peptides)
• 10:20, 30 May 2011 (diff | hist) . . (0)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎Phobius and Polyphobius)
• 10:19, 30 May 2011 (diff | hist) . . (+211)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎TargetP)
• 10:17, 30 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA TargetP.PNG ‎ (current)
• 10:16, 30 May 2011 (diff | hist) . . (+918)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎OCTOPUS and SPOCTOPUS)
• 10:04, 30 May 2011 (diff | hist) . . (-4)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎Phobius and Polyphobius)
• 10:03, 30 May 2011 (diff | hist) . . (+39)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎OCTOPUS and SPOCTOPUS)
• 10:02, 30 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA Spoctopus RET4 HUMAN small.png ‎ (current)
• 10:02, 30 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA Spoctopus LAMP1 HUMAN small.png ‎ (current)
• 10:01, 30 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA Spoctopus INSL5 HUMAN small.png ‎ (current)
• 10:01, 30 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA Spoctopus BCKDHA small.png ‎ (current)
• 10:01, 30 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA Spoctopus BACR HALSA small.png ‎ (current)
• 10:00, 30 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA Spoctopus A4 HUMAN small.png ‎ (current)
• 09:59, 30 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA Octopus RET4 HUMAN small.png ‎ (current)
• 09:58, 30 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA Octopus LAMP1 HUMAN small.png ‎ (current)
• 09:58, 30 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA Octopus INSL5 HUMAN small.png ‎ (current)
• 09:58, 30 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA Octopus BCKDHA small.png ‎ (current)
• 09:58, 30 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA Octopus BACR HALSA small.png ‎ (current)
• 09:57, 30 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA Octopus A4 HUMAN small.png ‎ (current)
• 09:47, 30 May 2011 (diff | hist) . . (+110)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎3. Prediction of transmembrane alpha-helices and signal peptides)
• 09:42, 30 May 2011 (diff | hist) . . (+12)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎Phobius and Polyphobius)
• 09:41, 30 May 2011 (diff | hist) . . (-1,102)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎3. Prediction of transmembrane alpha-helices and signal peptides)
• 09:39, 30 May 2011 (diff | hist) . . (-12)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎3. Prediction of transmembrane alpha-helices and signal peptides)
• 09:36, 30 May 2011 (diff | hist) . . (+336)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎Phobius and Polyphobius)
• 09:34, 30 May 2011 (diff | hist) . . (-10)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎3. Prediction of transmembrane alpha-helices and signal peptides)
• 09:32, 30 May 2011 (diff | hist) . . (+104)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎3. Prediction of transmembrane alpha-helices and signal peptides)
• 09:24, 30 May 2011 (diff | hist) . . (+561)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎3. Prediction of transmembrane alpha-helices and signal peptides)
• 09:21, 30 May 2011 (diff | hist) . . (-109)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎Phobius)
• 09:14, 30 May 2011 (diff | hist) . . (+56)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎TMHMM)
• 09:12, 30 May 2011 (diff | hist) . . (+17)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎Pfam)
• 22:51, 29 May 2011 (diff | hist) . . (+618)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎Phobius)
• 22:46, 29 May 2011 (diff | hist) . . (+129)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎TMHMM)
• 22:41, 29 May 2011 (diff | hist) . . (+454)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎SPOCTOPUS)
• 22:37, 29 May 2011 (diff | hist) . . (+636)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎OCTOPUS)
• 22:31, 29 May 2011 (diff | hist) . . (+368)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎Polyphobius)
• 22:27, 29 May 2011 (diff | hist) . . (+385)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎Polyphobius)
• 21:47, 29 May 2011 (diff | hist) . . (+49)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎3. Prediction of transmembrane alpha-helices and signal peptides)
• 21:47, 29 May 2011 (diff | hist) . . (+50)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎4. Prediction of GO terms)
• 21:47, 29 May 2011 (diff | hist) . . (+67)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎Pfam)
• 21:45, 29 May 2011 (diff | hist) . . (0)‎ . . Maple syrup urine disease 2011 ‎ (→‎TASKS)
• 21:43, 29 May 2011 (diff | hist) . . (+250)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎Phobius)
• 21:35, 29 May 2011 (diff | hist) . . (+23)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎Phobius)
• 21:30, 29 May 2011 (diff | hist) . . (+58)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎Phobius)
• 21:28, 29 May 2011 (diff | hist) . . (0)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎Phobius)
• 21:27, 29 May 2011 (diff | hist) . . (+296)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎Phobius)
• 21:25, 29 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA Polyphobius RET4 HUMAN.png ‎ (current)
• 21:24, 29 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA Polyphobius LAMP1 HUMAN.png ‎ (current)
• 21:24, 29 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA Polyphobius INSL5 HUMAN.png ‎ (current)
• 21:24, 29 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA Polyphobius BCKDHA.png ‎ (current)
• 21:24, 29 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA Polyphobius BACR HALSA.png ‎ (current)
• 21:23, 29 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA Polyphobius A4 HUMAN.png ‎ (current)
• 21:22, 29 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA Phobius RET4 HUMAN.png ‎ (current)
• 21:21, 29 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA Phobius LAMP1 HUMAN.png ‎ (current)
• 21:21, 29 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA Phobius INSL5 HUMAN.png ‎ (current)
• 21:21, 29 May 2011 (diff | hist) . . (0)‎ . . N File:Phobius BCKDHA.png ‎ (current)
• 21:20, 29 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA Phobius BACR HALSA.png ‎ (current)
• 21:20, 29 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA Phobius A4 HUMAN.png ‎ (current)
• 21:12, 29 May 2011 (diff | hist) . . (+83)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎SignalP)
• 20:56, 29 May 2011 (diff | hist) . . (+186)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎TargetP)
• 20:52, 29 May 2011 (diff | hist) . . (+1,145)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎3. Prediction of transmembrane alpha-helices and signal peptides)
• 20:31, 29 May 2011 (diff | hist) . . (+544)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎Polyphobius)
• 20:25, 29 May 2011 (diff | hist) . . (+335)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎Phobius)
• 16:36, 24 May 2011 (diff | hist) . . (+996)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎GOPET)
• 16:27, 24 May 2011 (diff | hist) . . (+685)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎GOPET)
• 16:20, 24 May 2011 (diff | hist) . . (+971)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎4. Prediction of GO terms)
• 16:01, 24 May 2011 (diff | hist) . . (+62)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎Pfam)
• 15:59, 24 May 2011 (diff | hist) . . (+523)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎4. Prediction of GO terms)
• 15:35, 24 May 2011 (diff | hist) . . (+36)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎3. Prediction of transmembrane alpha-helices and signal peptides)
• 15:05, 24 May 2011 (diff | hist) . . (+15)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎3. Prediction of transmembrane alpha-helices and signal peptides)
• 15:04, 24 May 2011 (diff | hist) . . (+3)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎Phobius)
• 15:03, 24 May 2011 (diff | hist) . . (+1,460)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎3. Prediction of transmembrane alpha-helices and signal peptides)
• 14:41, 24 May 2011 (diff | hist) . . (+197)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎3. Prediction of transmembrane alpha-helices and signal peptides)
• 14:37, 24 May 2011 (diff | hist) . . (+689)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎Polyphobius)
• 14:31, 24 May 2011 (diff | hist) . . (+688)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎Phobius)
• 14:24, 24 May 2011 (diff | hist) . . (+6)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎3. Prediction of transmembrane alpha-helices and signal peptides)
• 14:22, 24 May 2011 (diff | hist) . . (-3)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎3. Prediction of transmembrane alpha-helices and signal peptides)
• 14:22, 24 May 2011 (diff | hist) . . (+7)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎Polyphobius)
• 14:21, 24 May 2011 (diff | hist) . . (+202)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎Phobius and Polyphobius)
• 14:08, 24 May 2011 (diff | hist) . . (+26)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎Phobius and Polyphobius)
• 14:07, 24 May 2011 (diff | hist) . . (+2)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎Phobius and Polyphobius)
• 14:02, 24 May 2011 (diff | hist) . . (+50)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎Phobius and Polyphobius)
• 14:01, 24 May 2011 (diff | hist) . . (+448)‎ . . Secondary Structure Prediction BCKDHA ‎ (→‎3. Prediction of transmembrane alpha-helices and signal peptides)
• 13:53, 24 May 2011 (diff | hist) . . (+188)‎ . . N Secondary Structure Prediction BCKDHA ‎ (Created page with " == 1. Secondary structure prediction == == 2. Prediction of disordered regions == == 3. Prediction of transmembrane alpha-helices and signal peptides == == 4. Prediction of G…")
• 13:51, 24 May 2011 (diff | hist) . . (+1)‎ . . Maple syrup urine disease 2011 ‎ (→‎TASKS)
• 13:51, 24 May 2011 (diff | hist) . . (+81)‎ . . Maple syrup urine disease 2011 ‎ (→‎TASKS)
• 13:49, 24 May 2011 (diff | hist) . . (+48)‎ . . Reference Sequence BCKDHA ‎ (→‎Sequence)
• 23:08, 23 May 2011 (diff | hist) . . (+76)‎ . . Maple syrup urine disease 2011 ‎ (→‎Reference sequence)
• 23:07, 23 May 2011 (diff | hist) . . (+126)‎ . . Sequence Alignments BCKDHA ‎ (→‎Functionally important residues)
• 23:05, 23 May 2011 (diff | hist) . . (+59)‎ . . Sequence Alignments BCKDHA ‎ (→‎Functionally important residues)
• 23:02, 23 May 2011 (diff | hist) . . (-30)‎ . . Sequence Alignments BCKDHA ‎ (→‎Functionally important residues)
• 23:01, 23 May 2011 (diff | hist) . . (+56)‎ . . Sequence Alignments BCKDHA ‎ (→‎Functionally important residues)
• 22:59, 23 May 2011 (diff | hist) . . (+1,008)‎ . . Sequence Alignments BCKDHA ‎ (→‎Functionally important residues)
• 22:41, 23 May 2011 (diff | hist) . . (0)‎ . . Sequence Alignments BCKDHA ‎ (→‎Sequence searches)
• 22:40, 23 May 2011 (diff | hist) . . (-8)‎ . . Sequence Alignments BCKDHA ‎ (→‎Sequence searches)
• 22:40, 23 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA HSSP.png ‎ (current)
• 22:34, 23 May 2011 (diff | hist) . . (+61)‎ . . Sequence Alignments BCKDHA ‎ (→‎Sequence searches)
• 22:33, 23 May 2011 (diff | hist) . . (-108)‎ . . Sequence Alignments BCKDHA ‎ (→‎Sequence searches)
• 20:14, 23 May 2011 (diff | hist) . . (+495)‎ . . Sequence Alignments BCKDHA ‎ (→‎Functionally important residues)
• 20:13, 23 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA TCoffee3D.PNG ‎ (current)
• 20:13, 23 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA TCoffee.PNG ‎ (current)
• 20:13, 23 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA muscle.PNG ‎ (current)
• 20:12, 23 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA cobalt.PNG ‎ (current)
• 20:12, 23 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHA clustalW.PNG ‎ (current)
• 20:08, 23 May 2011 (diff | hist) . . (+11)‎ . . Sequence Alignments BCKDHA ‎ (→‎Sequence searches)
• 20:07, 23 May 2011 (diff | hist) . . (0)‎ . . Sequence Alignments BCKDHA ‎ (→‎Sequence searches)
• 20:06, 23 May 2011 (diff | hist) . . (0)‎ . . Sequence Alignments BCKDHA ‎ (→‎Sequence searches)
• 20:04, 23 May 2011 (diff | hist) . . (+1,484)‎ . . Sequence Alignments BCKDHA ‎ (→‎Sequence searches)
• 19:59, 23 May 2011 (diff | hist) . . (0)‎ . . N File:BCDKHA ValidateHSSP.png ‎ (current)
• 19:41, 23 May 2011 (diff | hist) . . (-8)‎ . . Sequence Alignments BCKDHA ‎ (→‎Conservation and Gaps)
• 19:38, 23 May 2011 (diff | hist) . . (-8)‎ . . Sequence Alignments BCKDHA ‎ (→‎Sequence searches)
• 19:38, 23 May 2011 (diff | hist) . . (+232)‎ . . Sequence Alignments BCKDHA ‎ (→‎Sequence searches)
• 16:24, 22 May 2011 (diff | hist) . . (0)‎ . . N File:VennDiagram2.png ‎ (current)
• 16:07, 22 May 2011 (diff | hist) . . (0)‎ . . File:EvalueDistribution.png ‎ (uploaded a new version of "File:EvalueDistribution.png") (current)
• 16:06, 22 May 2011 (diff | hist) . . (0)‎ . . File:IdentityDistribution.png ‎ (uploaded a new version of "File:IdentityDistribution.png") (current)
• 13:31, 21 May 2011 (diff | hist) . . (-4)‎ . . Maple syrup urine disease 2011 ‎ (→‎Mutations)
• 13:31, 21 May 2011 (diff | hist) . . (-5)‎ . . Maple syrup urine disease 2011 ‎ (→‎Mutations)
• 13:30, 21 May 2011 (diff | hist) . . (+1)‎ . . Sequence Alignments BCKDHA ‎ (→‎References)
• 13:30, 21 May 2011 (diff | hist) . . (+9,328)‎ . . N Sequence Alignments BCKDHA ‎ (New page: == Sequence Alignments == === Sequence searches === * FASTA ../bin/fasta36 sequence.fasta database > FastaOutput.txt * BLAST blastall -p blastp -d database -i sequence.fasta > BlastOutpu...)
• 13:30, 21 May 2011 (diff | hist) . . (+25)‎ . . Maple syrup urine disease 2011 ‎ (→‎Mutations)
• 13:29, 21 May 2011 (diff | hist) . . (+7)‎ . . Maple syrup urine disease 2011 ‎ (→‎Mutations)
• 12:13, 21 May 2011 (diff | hist) . . (+66)‎ . . Sequence Alignments ‎ (→‎References) (current)
• 12:03, 21 May 2011 (diff | hist) . . (+227)‎ . . Sequence Alignments ‎ (→‎Gaps in secondary structure)
• 11:58, 21 May 2011 (diff | hist) . . (-614)‎ . . Sequence Alignments ‎ (→‎Sequence searches)
• 11:58, 21 May 2011 (diff | hist) . . (+614)‎ . . Sequence Alignments ‎ (→‎Sequence searches)
• 11:57, 21 May 2011 (diff | hist) . . (+1)‎ . . Sequence Alignments ‎ (→‎Sequence searches)
• 11:57, 21 May 2011 (diff | hist) . . (+67)‎ . . Sequence Alignments ‎ (→‎Sequence searches)
• 11:55, 21 May 2011 (diff | hist) . . (+4)‎ . . Sequence Alignments ‎ (→‎Sequence searches)
• 11:55, 21 May 2011 (diff | hist) . . (+77)‎ . . Sequence Alignments ‎ (→‎Sequence searches)
• 11:53, 21 May 2011 (diff | hist) . . (+96)‎ . . Sequence Alignments ‎ (→‎Sequence searches)
• 11:52, 21 May 2011 (diff | hist) . . (0)‎ . . N File:ComparePSI5.png ‎ (current)
• 11:51, 21 May 2011 (diff | hist) . . (+155)‎ . . Sequence Alignments ‎ (→‎Sequence searches)
• 11:49, 21 May 2011 (diff | hist) . . (-476)‎ . . Sequence Alignments ‎ (→‎Sequence searches)
• 11:49, 21 May 2011 (diff | hist) . . (0)‎ . . N File:VennDiagram.png ‎ (current)
• 11:29, 21 May 2011 (diff | hist) . . (-19)‎ . . Sequence Alignments ‎ (→‎Sequence searches)
• 11:26, 21 May 2011 (diff | hist) . . (+19)‎ . . Sequence Alignments ‎ (→‎Sequence searches)
• 11:24, 21 May 2011 (diff | hist) . . (+544)‎ . . Sequence Alignments ‎ (→‎Sequence searches)
• 11:18, 21 May 2011 (diff | hist) . . (-4)‎ . . Sequence Alignments ‎ (→‎Sequence searches)
• 11:17, 21 May 2011 (diff | hist) . . (0)‎ . . Sequence Alignments ‎ (→‎Sequence searches)
• 11:17, 21 May 2011 (diff | hist) . . (-7)‎ . . Sequence Alignments ‎ (→‎Sequence searches)
• 11:16, 21 May 2011 (diff | hist) . . (+7)‎ . . Sequence Alignments ‎ (→‎Sequence searches)
• 11:14, 21 May 2011 (diff | hist) . . (+872)‎ . . Sequence Alignments ‎ (→‎Sequence searches)
• 11:07, 21 May 2011 (diff | hist) . . (+25)‎ . . Sequence Alignments ‎ (→‎Sequence searches)
• 11:06, 21 May 2011 (diff | hist) . . (+269)‎ . . Sequence Alignments ‎ (→‎Sequence searches)
• 11:02, 21 May 2011 (diff | hist) . . (0)‎ . . File:EvalueDistribution.png ‎ (uploaded a new version of "Image:EvalueDistribution.png")
• 11:01, 21 May 2011 (diff | hist) . . (+527)‎ . . Sequence Alignments ‎ (→‎Sequence searches)
• 10:57, 21 May 2011 (diff | hist) . . (+63)‎ . . Sequence Alignments ‎ (→‎Sequence searches)
• 10:56, 21 May 2011 (diff | hist) . . (+489)‎ . . Sequence Alignments ‎ (→‎Sequence searches)
• 10:50, 21 May 2011 (diff | hist) . . (0)‎ . . Sequence Alignments ‎ (→‎Sequence searches)
• 10:50, 21 May 2011 (diff | hist) . . (0)‎ . . Sequence Alignments ‎ (→‎Sequence searches)
• 10:50, 21 May 2011 (diff | hist) . . (+2)‎ . . Sequence Alignments ‎ (→‎Sequence searches)
• 10:49, 21 May 2011 (diff | hist) . . (+11)‎ . . Sequence Alignments ‎ (→‎Sequence searches)
• 10:48, 21 May 2011 (diff | hist) . . (+12)‎ . . Sequence Alignments ‎ (→‎Sequence searches)
• 10:47, 21 May 2011 (diff | hist) . . (-12)‎ . . Sequence Alignments ‎ (→‎Sequence searches)
• 10:47, 21 May 2011 (diff | hist) . . (+68)‎ . . Sequence Alignments ‎ (→‎Sequence searches)
• 10:44, 21 May 2011 (diff | hist) . . (+100)‎ . . Sequence Alignments ‎ (→‎Sequence searches)
• 10:42, 21 May 2011 (diff | hist) . . (+26)‎ . . Maple syrup urine disease 2011 ‎ (→‎Mutations)
• 10:39, 21 May 2011 (diff | hist) . . (0)‎ . . N File:CompAll2.png ‎ (current)
• 10:36, 21 May 2011 (diff | hist) . . (0)‎ . . N File:CompAll.png ‎ (current)
• 10:36, 21 May 2011 (diff | hist) . . (0)‎ . . N File:ComparePSI0.005.png ‎ (current)
• 10:36, 21 May 2011 (diff | hist) . . (0)‎ . . N File:ComparePSI3.png ‎ (current)
• 10:35, 21 May 2011 (diff | hist) . . (0)‎ . . N File:ComparePSI10E6.png ‎ (current)
• 10:35, 21 May 2011 (diff | hist) . . (0)‎ . . N File:IdentityDistribution.png ‎
• 10:35, 21 May 2011 (diff | hist) . . (0)‎ . . N File:EvalueDistribution.png ‎
• 00:16, 21 May 2011 (diff | hist) . . (-241)‎ . . Sequence Alignments ‎ (→‎Conservation and Gaps)
• 00:16, 21 May 2011 (diff | hist) . . (+268)‎ . . Sequence Alignments ‎ (→‎Conservation and Gaps)
• 00:09, 21 May 2011 (diff | hist) . . (+280)‎ . . Sequence Alignments ‎ (→‎Conservation and Gaps)
• 00:04, 21 May 2011 (diff | hist) . . (+60)‎ . . Reference Sequence BCKDHA ‎ (→‎Sequence)
• 00:02, 21 May 2011 (diff | hist) . . (+2,962)‎ . . N Sequence Alignments ‎ (New page: == Sequence Alignments == === Sequence searches === * FASTA ../bin/fasta36 sequence.fasta database > FastaOutput.txt * BLAST blastall -p blastp -d database -i sequence.fasta > BlastOutpu...)
• 00:02, 21 May 2011 (diff | hist) . . (-2,964)‎ . . Reference Sequence BCKDHA ‎ (→‎Sequence Alignments)
• 00:02, 21 May 2011 (diff | hist) . . (+24)‎ . . Reference Sequence BCKDHA ‎ (→‎Sequence)
• 14:56, 19 May 2011 (diff | hist) . . (+21)‎ . . Reference Sequence BCKDHA ‎ (→‎Multiple Alignments)
• 14:25, 19 May 2011 (diff | hist) . . (+281)‎ . . Reference Sequence BCKDHA ‎ (→‎Sequence Alignments)
• 13:43, 19 May 2011 (diff | hist) . . (+126)‎ . . Reference Sequence BCKDHA ‎ (→‎Sequence searches)
• 13:40, 19 May 2011 (diff | hist) . . (+1,110)‎ . . Reference Sequence BCKDHA ‎ (→‎Sequence searches)
• 13:29, 19 May 2011 (diff | hist) . . (+244)‎ . . Reference Sequence BCKDHA ‎ (→‎Sequence searches)
• 13:22, 19 May 2011 (diff | hist) . . (+206)‎ . . Reference Sequence BCKDHA ‎ (→‎Sequence searches)
• 12:59, 19 May 2011 (diff | hist) . . (+9)‎ . . Reference Sequence BCKDHA ‎ (→‎Sequence searches)
• 12:56, 19 May 2011 (diff | hist) . . (+3)‎ . . Reference Sequence BCKDHA ‎ (→‎Sequence searches)
• 12:55, 19 May 2011 (diff | hist) . . (+148)‎ . . Reference Sequence BCKDHA ‎ (→‎Sequence searches)
• 12:48, 19 May 2011 (diff | hist) . . (+2)‎ . . Reference Sequence BCKDHA ‎ (→‎Sequence searches)
• 11:51, 19 May 2011 (diff | hist) . . (+323)‎ . . Reference Sequence BCKDHA ‎ (→‎Sequence searches)
• 11:45, 19 May 2011 (diff | hist) . . (+61)‎ . . Reference Sequence BCKDHA ‎ (→‎Sequence)
• 14:36, 17 May 2011 (diff | hist) . . (+21)‎ . . Maple syrup urine disease 2011 ‎ (→‎Biochemical disease mechanism)
• 14:35, 17 May 2011 (diff | hist) . . (0)‎ . . Maple syrup urine disease 2011 ‎ (→‎Cross References)
• 14:35, 17 May 2011 (diff | hist) . . (+1)‎ . . Maple syrup urine disease 2011 ‎ (→‎Cross References)
• 12:39, 17 May 2011 (diff | hist) . . (+4)‎ . . Reference Sequence BCKDHA ‎ (→‎Sequence)
• 12:38, 17 May 2011 (diff | hist) . . (+18)‎ . . Reference Sequence BCKDHA ‎ (→‎Sequence)
• 12:35, 17 May 2011 (diff | hist) . . (+88)‎ . . Reference Sequence BCKDHA ‎ (→‎Sequence)
• 12:34, 17 May 2011 (diff | hist) . . (+554)‎ . . Reference Sequence BCKDHA ‎ (→‎Sequence)
• 12:18, 17 May 2011 (diff | hist) . . (+1)‎ . . Reference Sequence BCKDHA ‎ (→‎Sequence)
• 20:02, 16 May 2011 (diff | hist) . . (+101)‎ . . Maple syrup urine disease 2011 ‎ (→‎Protein)
• 19:57, 16 May 2011 (diff | hist) . . (+76)‎ . . Maple syrup urine disease 2011 ‎ (→‎Protein)
• 19:55, 16 May 2011 (diff | hist) . . (0)‎ . . Maple syrup urine disease 2011 ‎ (→‎Gene)
• 19:54, 16 May 2011 (diff | hist) . . (+159)‎ . . Maple syrup urine disease 2011 ‎ (→‎BCKDHA)
• 19:51, 16 May 2011 (diff | hist) . . (+7)‎ . . Maple syrup urine disease 2011 ‎ (→‎BCKDHA)
• 19:51, 16 May 2011 (diff | hist) . . (0)‎ . . Maple syrup urine disease 2011 ‎ (→‎BCKDHA)
• 19:50, 16 May 2011 (diff | hist) . . (+54)‎ . . Maple syrup urine disease 2011 ‎ (→‎Biochemical disease mechanism)
• 19:49, 16 May 2011 (diff | hist) . . (+272)‎ . . Maple syrup urine disease 2011 ‎ (→‎Protein)
• 19:48, 16 May 2011 (diff | hist) . . (0)‎ . . N File:MSUDdegradation.jpg ‎ (current)
• 18:46, 16 May 2011 (diff | hist) . . (0)‎ . . N File:1u5b bio r 500.jpg ‎ (current)
• 10:34, 16 May 2011 (diff | hist) . . (+208)‎ . . Maple syrup urine disease 2011 ‎ (→‎Gene)
• 10:32, 16 May 2011 (diff | hist) . . (+361)‎ . . Maple syrup urine disease 2011 ‎ (→‎Gene)
• 10:29, 16 May 2011 (diff | hist) . . (0)‎ . . N File:BCKDHAchromosome.jpeg ‎ (current)
• 10:23, 16 May 2011 (diff | hist) . . (+115)‎ . . Maple syrup urine disease 2011 ‎ (→‎Biochemical disease mechanism)
• 10:18, 16 May 2011 (diff | hist) . . (+12)‎ . . Maple syrup urine disease 2011 ‎ (→‎Biochemical disease mechanism)
• 10:17, 16 May 2011 (diff | hist) . . (-2)‎ . . Maple syrup urine disease 2011 ‎ (→‎Biochemical disease mechanism)
• 10:15, 16 May 2011 (diff | hist) . . (+90)‎ . . Maple syrup urine disease 2011 ‎ (→‎Biochemical disease mechanism)
• 10:14, 16 May 2011 (diff | hist) . . (+98)‎ . . N File:MSUDaminoacids.jpg ‎ (Amino Acids which accumulate when the BCKD complex is defect in Maple Syrup Urine Disease-patients) (current)
• 10:09, 16 May 2011 (diff | hist) . . (+263)‎ . . Maple syrup urine disease 2011 ‎ (→‎Biochemical disease mechanism)
• 23:08, 12 May 2011 (diff | hist) . . (+7)‎ . . MSUD Q80E ‎ (current)
• 23:08, 12 May 2011 (diff | hist) . . (+75)‎ . . MSUD Q80E ‎
• 23:07, 12 May 2011 (diff | hist) . . (+187)‎ . . N MSUD Q80E ‎ (New page: == Sequence == Fasta format with highlighted mutated residue == Mutation == Amino acid mutation:<br> Q80E Codon change:<br> CAG-GAG back to Maple syrup urine disease main page)
• 23:04, 12 May 2011 (diff | hist) . . (-57)‎ . . Maple syrup urine disease 2011 ‎ (→‎Disease causing mutations)
• 23:02, 12 May 2011 (diff | hist) . . (-4)‎ . . Reference Sequence BCKDHA ‎ (→‎Sequence)
• 23:02, 12 May 2011 (diff | hist) . . (+54)‎ . . Reference Sequence BCKDHA ‎ (→‎Sequence)
• 23:00, 12 May 2011 (diff | hist) . . (+570)‎ . . N MapleSyrupDisease disease causing mutations ‎ (New page: >sp|P12694|ODBA_HUMAN 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Homo sapiens GN=BCKDHA PE=1 SV=2 MAVAIAAARVWRLNRGLSQAALLLLRQPGARGLARSHPPRQQQQFSSLDDKPQFPGASAE FIDKLEFIQ...) (current)
• 22:23, 12 May 2011 (diff | hist) . . (-4)‎ . . Maple syrup urine disease 2011 ‎ (→‎Neutral mutations)
• 22:22, 12 May 2011 (diff | hist) . . (-6)‎ . . Maple syrup urine disease 2011 ‎ (→‎Disease causing mutations)
• 22:21, 12 May 2011 (diff | hist) . . (+27)‎ . . Maple syrup urine disease 2011 ‎ (→‎Disease causing mutations)
• 21:59, 12 May 2011 (diff | hist) . . (-34)‎ . . Example sequence ‎ (→‎Sequence)
• 21:57, 12 May 2011 (diff | hist) . . (-27,114)‎ . . Reference Sequence BCKDHA ‎ (→‎Sequence)
• 21:36, 12 May 2011 (diff | hist) . . (+17)‎ . . Example sequence ‎ (→‎Sequence)
• 21:35, 12 May 2011 (diff | hist) . . (+4)‎ . . Example sequence ‎ (→‎Sequence)
• 21:35, 12 May 2011 (diff | hist) . . (+12)‎ . . Example sequence ‎ (→‎Sequence)
• 21:05, 12 May 2011 (diff | hist) . . (-41)‎ . . Maple syrup urine disease 2011 ‎ (→‎Mutations)
• 20:55, 12 May 2011 (diff | hist) . . (-174)‎ . . Maple syrup urine disease 2011 ‎ (→‎Reference sequence)
• 20:54, 12 May 2011 (diff | hist) . . (-1)‎ . . Reference Sequence BCKDHA ‎ (→‎Sequence)
• 20:53, 12 May 2011 (diff | hist) . . (+27,759)‎ . . N Reference Sequence BCKDHA ‎ (Fasta Sequence of the BCKDHA gene)
• 20:47, 12 May 2011 (diff | hist) . . (+59)‎ . . Maple syrup urine disease 2011 ‎ (→‎Reference sequence)
• 20:28, 12 May 2011 (diff | hist) . . (+112)‎ . . Maple syrup urine disease 2011 ‎ (→‎Biochemical disease mechanism)
• 20:21, 12 May 2011 (diff | hist) . . (-5)‎ . . Maple syrup urine disease 2011 ‎ (→‎Biochemical disease mechanism)
• 20:19, 12 May 2011 (diff | hist) . . (+5)‎ . . Maple syrup urine disease 2011 ‎ (→‎Biochemical disease mechanism)
• 20:13, 12 May 2011 (diff | hist) . . (+13)‎ . . Maple syrup urine disease 2011 ‎ (→‎Biochemical disease mechanism)
• 20:11, 12 May 2011 (diff | hist) . . (+7)‎ . . Maple syrup urine disease 2011 ‎ (→‎Biochemical disease mechanism)
• 20:07, 12 May 2011 (diff | hist) . . (-42)‎ . . Maple syrup urine disease 2011 ‎ (→‎Biochemical disease mechanism)
• 20:06, 12 May 2011 (diff | hist) . . (+76)‎ . . N File:Hsa00280.png ‎ (Kegg-pathway 00280, breakdown of Leucine, Isoleucine and Valine by the BCKD.) (current)
• 20:03, 12 May 2011 (diff | hist) . . (+55)‎ . . Maple syrup urine disease 2011 ‎ (→‎Biochemical disease mechanism)
• 20:02, 12 May 2011 (diff | hist) . . (+357)‎ . . Maple syrup urine disease 2011 ‎ (→‎Biochemical disease mechanism)

(newest | oldest) View (newer 250 | older 250) (20 | 50 | 100 | 250 | 500)