User contributions
From Bioinformatikpedia
(newest | oldest) View (newer 500 | older 500) (20 | 50 | 100 | 250 | 500)
- 06:22, 11 September 2011 (diff | hist) . . (+16) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Salt bridges)
- 06:22, 11 September 2011 (diff | hist) . . (+16) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Salt bridges)
- 06:22, 11 September 2011 (diff | hist) . . (0) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Salt bridges)
- 06:21, 11 September 2011 (diff | hist) . . (-30) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Secondary structure)
- 06:21, 11 September 2011 (diff | hist) . . (-30) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Secondary structure)
- 06:20, 11 September 2011 (diff | hist) . . (+1,134) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Cluster analysis)
- 06:17, 11 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase rmsd distribution mut10.png (current)
- 06:17, 11 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase clusters mut10.png (current)
- 06:14, 11 September 2011 (diff | hist) . . (+962) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Cluster analysis)
- 06:10, 11 September 2011 (diff | hist) . . (+3) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Cluster analysis)
- 06:09, 11 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase rmsd distribution mut7.png (current)
- 06:09, 11 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase clusters mut7.png (current)
- 06:02, 11 September 2011 (diff | hist) . . (+710) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Root mean square deviations again)
- 05:59, 11 September 2011 (diff | hist) . . (+799) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Root mean square deviations again)
- 05:57, 11 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase rmsd matrix mut10.png (current)
- 05:57, 11 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase rmsd matrix mut7.png (current)
- 05:53, 11 September 2011 (diff | hist) . . (+101) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Distance RMSD)
- 05:52, 11 September 2011 (diff | hist) . . (+1,001) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Ramachandran (phi/psi) plots)
- 05:50, 11 September 2011 (diff | hist) . . (+984) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Ramachandran (phi/psi) plots)
- 05:48, 11 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase ramachandran mut7.png (current)
- 05:47, 11 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase ramachandran mut10.png (current)
- 05:39, 11 September 2011 (diff | hist) . . (+77) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Hydrogen bonds)
- 05:38, 11 September 2011 (diff | hist) . . (+34) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Hydrogen bonds)
- 05:36, 11 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase hydrogen bonds prot water mut10.png (current)
- 05:36, 11 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase hydrogen bonds prot water mut7.png (current)
- 05:36, 11 September 2011 (diff | hist) . . (0) . . File:Glucocerebrosidase hydrogen bonds prot water.png (uploaded a new version of "File:Glucocerebrosidase hydrogen bonds prot water.png") (current)
- 05:34, 11 September 2011 (diff | hist) . . (0) . . File:Glucocerebrosidase hydrogen bonds prot water.png (uploaded a new version of "File:Glucocerebrosidase hydrogen bonds prot water.png")
- 14:42, 10 September 2011 (diff | hist) . . (+1,294) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Hydrogen bonds)
- 14:41, 10 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase hydrogen bonds inter mut10.png (current)
- 14:41, 10 September 2011 (diff | hist) . . (+1,292) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Hydrogen bonds)
- 14:39, 10 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase hydrogen bonds inter mut7.png (current)
- 14:35, 10 September 2011 (diff | hist) . . (+901) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Solvent accessible surface area)
- 14:32, 10 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase solvent accessability mut10.png (current)
- 14:32, 10 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase residue sas mut10.png (current)
- 14:32, 10 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase atomic sas mit10.png (current)
- 14:31, 10 September 2011 (diff | hist) . . (+905) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Solvent accessible surface area)
- 14:29, 10 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase solvent accessable surface mut7.png (current)
- 14:29, 10 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase residue sas mut7.png (current)
- 14:29, 10 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase atomic sas mut7.png (current)
- 07:12, 10 September 2011 (diff | hist) . . (+758) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Convergence of radius of gyration)
- 07:10, 10 September 2011 (diff | hist) . . (+2) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Convergence of RMSD)
- 07:09, 10 September 2011 (diff | hist) . . (+2,629) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Convergence of RMSD)
- 07:06, 10 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase rmsd backbone start mut10.png (current)
- 07:06, 10 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase rmsd backbone average mut10.png (current)
- 07:06, 10 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase rmsd all atom start mut10.png (current)
- 07:06, 10 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase rmsd all atom average mut10.png (current)
- 07:06, 10 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase radius gyration mut10.png (current)
- 07:02, 10 September 2011 (diff | hist) . . (+1) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Convergence of RMSD)
- 07:01, 10 September 2011 (diff | hist) . . (+1) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Convergence of RMSD)
- 07:01, 10 September 2011 (diff | hist) . . (+727) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Convergence of radius of gyration)
- 06:59, 10 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase radius gyration mut7.png (current)
- 06:57, 10 September 2011 (diff | hist) . . (+2,640) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Convergence of RMSD)
- 06:54, 10 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase rmsd backbone start mut7.png (current)
- 06:54, 10 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase rmsd backbone average mut7.png (current)
- 06:54, 10 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase rmsd all atom average mut7.png (current)
- 06:54, 10 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase all atom start mut7.png (current)
- 06:23, 10 September 2011 (diff | hist) . . (+1,624) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Root mean square fluctuations)
- 06:20, 10 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase rmsf per residue mut10.png (current)
- 06:19, 10 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase bfactors rmsf mut10.png (current)
- 06:19, 10 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase average rmsf mut10.png (current)
- 06:15, 10 September 2011 (diff | hist) . . (+1,555) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Root mean square fluctuations)
- 06:12, 10 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase rmsf per residue mut7.png (current)
- 06:12, 10 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase bfactors rmsf mut7.png (current)
- 06:12, 10 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase average rmsf mut7.png (current)
- 05:58, 10 September 2011 (diff | hist) . . (+1,516) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Minimum distances between periodic images)
- 05:58, 10 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase minimal periodic distance mut10.png (current)
- 05:58, 10 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase minimal periodic distance calpha mut10.png (current)
- 05:50, 10 September 2011 (diff | hist) . . (+1,467) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Minimum distances between periodic images)
- 05:50, 10 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase minimal periodic distance mut7.png (current)
- 05:50, 10 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase minimal periodic distance calpha mut7.png (current)
- 20:26, 9 September 2011 (diff | hist) . . (+6,252) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Quality assurance)
- 20:11, 9 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase volume mut10.png (current)
- 20:11, 9 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase vdw mut10.png (current)
- 20:11, 9 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase temperature mut10.png (current)
- 20:11, 9 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase pressure mut10.png (current)
- 20:11, 9 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase energy mut10.png (current)
- 20:10, 9 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase density mut10.png (current)
- 20:10, 9 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase coulumb mut10.png (current)
- 20:10, 9 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase box mut10.png (current)
- 19:58, 9 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase density mut7.png (current)
- 19:57, 9 September 2011 (diff | hist) . . (+6,272) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Quality assurance)
- 19:40, 9 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase volume mut7.png (current)
- 19:40, 9 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase vdw mut7.png (current)
- 19:40, 9 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase temperature mut7.png (current)
- 19:40, 9 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase pressure mut7.png (current)
- 19:40, 9 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase energy mut7.png (current)
- 19:40, 9 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase coulomb mut7.png (current)
- 19:40, 9 September 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase box mut7.png (current)
- 18:29, 9 September 2011 (diff | hist) . . (0) . . N File:Active site mut7.png (current)
- 18:26, 9 September 2011 (diff | hist) . . (0) . . N File:Spectrum mut7.png (current)
- 18:26, 9 September 2011 (diff | hist) . . (0) . . N File:Show cell mut7.png (current)
- 18:26, 9 September 2011 (diff | hist) . . (0) . . N File:Cartoon mut7.png (current)
- 18:26, 9 September 2011 (diff | hist) . . (0) . . N File:Spectrum mut10.png (current)
- 18:26, 9 September 2011 (diff | hist) . . (0) . . N File:Show cell mut10.png (current)
- 18:26, 9 September 2011 (diff | hist) . . (0) . . N File:Cartoon mut10.png (current)
- 18:25, 9 September 2011 (diff | hist) . . (0) . . N File:Active site mut10.png
- 18:02, 9 September 2011 (diff | hist) . . (+860) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Visualization of results)
- 18:01, 9 September 2011 (diff | hist) . . (+858) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Visualization of results)
- 17:56, 9 September 2011 (diff | hist) . . (+563) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Mutation 10)
- 17:55, 9 September 2011 (diff | hist) . . (+561) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Mutation 7)
- 11:08, 30 August 2011 (diff | hist) . . (+2,977) . . Normal Mode Analysis of Glucocerebrosidase (→Discussion)
- 10:30, 30 August 2011 (diff | hist) . . (+1,051) . . Normal Mode Analysis of Glucocerebrosidase (→Comparison of All-atom NMA to Elastic Network NMA)
- 10:23, 30 August 2011 (diff | hist) . . (+383) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Visualization of results)
- 10:19, 30 August 2011 (diff | hist) . . (+218) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Root mean square deviations again)
- 10:16, 30 August 2011 (diff | hist) . . (+53) . . Sequence based mutation analysis of GBA (→Physicochemical Properties and Changes)
- 10:14, 30 August 2011 (diff | hist) . . (+570) . . Sequence based mutation analysis of GBA (→Physicochemical Properties and Changes)
- 14:21, 23 August 2011 (diff | hist) . . (+111) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Visualization of results)
- 14:19, 23 August 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase md movie.gif (current)
- 11:06, 23 August 2011 (diff | hist) . . (+623) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Distance RMSD)
- 11:04, 23 August 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase distance-rmsd.png (current)
- 11:01, 23 August 2011 (diff | hist) . . (+786) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Cluster analysis)
- 10:59, 23 August 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase rmsd-distribution.png (current)
- 10:55, 23 August 2011 (diff | hist) . . (+441) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Root mean square deviations again)
- 10:53, 23 August 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase rmsd matrix.png (current)
- 10:48, 23 August 2011 (diff | hist) . . (+674) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Ramachandran (phi/psi) plots)
- 10:40, 23 August 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase ramachandran.png (current)
- 10:37, 23 August 2011 (diff | hist) . . (-30) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Structural analysis: properties derived from configurations)
- 10:36, 23 August 2011 (diff | hist) . . (+16) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Salt bridges)
- 10:35, 23 August 2011 (diff | hist) . . (+1,276) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Hydrogen bonds)
- 10:35, 23 August 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase hydrogen bonds prot water.png
- 10:35, 23 August 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase hydrogen bonds intra protein.png (current)
- 10:25, 23 August 2011 (diff | hist) . . (+895) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Solvent accessible surface area)
- 10:17, 23 August 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase solvent accessable surface.png (current)
- 10:16, 23 August 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase residue sas.png (current)
- 10:16, 23 August 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase atomic sas.png (current)
- 10:07, 23 August 2011 (diff | hist) . . (+608) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Convergence of radius of gyration)
- 10:05, 23 August 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase radius gyration.png (current)
- 09:59, 23 August 2011 (diff | hist) . . (+2,513) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Convergence of RMSD)
- 09:49, 23 August 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase rmsd backbone average.png (current)
- 09:49, 23 August 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase rmsd backbone.png (current)
- 09:49, 23 August 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase rmsd average.png (current)
- 09:49, 23 August 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase rmsd.png (current)
- 09:39, 23 August 2011 (diff | hist) . . (+1,330) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Root mean square fluctuations)
- 09:33, 23 August 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase rmsf pymol.png (current)
- 09:33, 23 August 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase rmsf.png (current)
- 09:15, 23 August 2011 (diff | hist) . . (+129) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Minimum distances between periodic images)
- 09:14, 23 August 2011 (diff | hist) . . (+1,231) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Minimum distances between periodic images)
- 09:06, 23 August 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase minimal periodic distance.png (current)
- 09:06, 23 August 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase minimal periodic dictance calpha.png (current)
- 08:59, 23 August 2011 (diff | hist) . . (+328) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Interaction Energy: van der Waals)
- 08:56, 23 August 2011 (diff | hist) . . (+316) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Interaction Energy: Coulomb)
- 08:51, 23 August 2011 (diff | hist) . . (+131) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Box)
- 08:48, 23 August 2011 (diff | hist) . . (+181) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Density)
- 08:46, 23 August 2011 (diff | hist) . . (-15) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Volume)
- 08:46, 23 August 2011 (diff | hist) . . (-15) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Energy)
- 08:46, 23 August 2011 (diff | hist) . . (+214) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Volume)
- 08:43, 23 August 2011 (diff | hist) . . (+219) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Energy)
- 08:39, 23 August 2011 (diff | hist) . . (+286) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Pressure)
- 08:36, 23 August 2011 (diff | hist) . . (+37) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Temperature)
- 08:34, 23 August 2011 (diff | hist) . . (+255) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Temperature)
- 08:32, 23 August 2011 (diff | hist) . . (+491) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Convergence of energy terms)
- 08:27, 23 August 2011 (diff | hist) . . (+919) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Convergence of energy terms)
- 08:26, 23 August 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase coulomb.png
- 08:26, 23 August 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase vdw.png
- 08:22, 23 August 2011 (diff | hist) . . (+2,823) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Quality assurance)
- 08:16, 23 August 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase volume.png (current)
- 08:16, 23 August 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase temperature.png (current)
- 08:16, 23 August 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase pressure.png (current)
- 08:16, 23 August 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase energy.png (current)
- 08:16, 23 August 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase density.png (current)
- 08:16, 23 August 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase box.png (current)
- 08:05, 23 August 2011 (diff | hist) . . (+715) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→Visualization of results)
- 08:01, 23 August 2011 (diff | hist) . . (0) . . N File:Spectrum.png (current)
- 08:01, 23 August 2011 (diff | hist) . . (0) . . N File:Show cell.png (current)
- 08:01, 23 August 2011 (diff | hist) . . (0) . . N File:Active site.png
- 08:01, 23 August 2011 (diff | hist) . . (0) . . N File:Cartoon.png (current)
- 07:54, 23 August 2011 (diff | hist) . . (+585) . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase (→A brief check of results)
- 07:45, 23 August 2011 (diff | hist) . . (+2,313) . . N Molecular Dynamics Simulations Analysis of Glucocerebrosidase (Created page with "== Introduction == To analyze our Molecular Dynamics Simulations we followed the tutorial described here: http://md.chem.rug.nl/~mdcourse/analysis1.html == Wildtype == === A b…")
- 07:39, 23 August 2011 (diff | hist) . . (+144) . . Glucocerebrosidase Molecular Dynamics Simulation (→Analysis)
- 07:38, 23 August 2011 (diff | hist) . . (+117) . . User:Brunners (→Tasks) (current)
- 07:38, 23 August 2011 (diff | hist) . . (+117) . . User:Braunt (→Tasks) (current)
- 07:37, 23 August 2011 (diff | hist) . . (+118) . . Gaucher Disease 2011 (→Tasks)
- 08:09, 20 August 2011 (diff | hist) . . (+1,158) . . N User:Brunners (Created page with "=Person= '''Sabine Brunner''' is a bioinformatics student in her 8th semester (2nd Master semester). =Group= Sabine works together with Tatjana Braun on [[Gauche…")
- 08:29, 19 August 2011 (diff | hist) . . (-36) . . Normal Mode Analysis of Glucocerebrosidase
- 08:28, 19 August 2011 (diff | hist) . . (+3) . . Normal Mode Analysis of Glucocerebrosidase (→Elastic Network NMA)
- 08:28, 19 August 2011 (diff | hist) . . (+4) . . Normal Mode Analysis of Glucocerebrosidase (→1BPT at 2000 K)
- 08:28, 19 August 2011 (diff | hist) . . (+4) . . Normal Mode Analysis of Glucocerebrosidase (→1BPT at 600 K)
- 08:27, 19 August 2011 (diff | hist) . . (-350) . . Supplementary data normal mode glucocerebrosidase (→Anisotropic Network Model) (current)
- 21:23, 18 August 2011 (diff | hist) . . (-1) . . Normal Mode Analysis of Glucocerebrosidase (→NOMAD-Ref)
- 21:22, 18 August 2011 (diff | hist) . . (+1,452) . . Normal Mode Analysis of Glucocerebrosidase (→NOMAD-Ref)
- 10:40, 18 August 2011 (diff | hist) . . (+2,200) . . Normal Mode Analysis of Glucocerebrosidase (→oGNM)
- 10:19, 18 August 2011 (diff | hist) . . (+186) . . Normal Mode Analysis of Glucocerebrosidase (→oGNM)
- 10:15, 18 August 2011 (diff | hist) . . (+114) . . Normal Mode Analysis of Glucocerebrosidase (→Anisotropic Network Model)
- 10:11, 18 August 2011 (diff | hist) . . (+182) . . Normal Mode Analysis of Glucocerebrosidase (→Anisotropic Network Model)
- 10:08, 18 August 2011 (diff | hist) . . (+2,384) . . Normal Mode Analysis of Glucocerebrosidase (→Anisotropic Network Model)
- 09:44, 18 August 2011 (diff | hist) . . (+267) . . Sequence and structure based mutation analysis of GBA (→Introduction)
- 09:31, 18 August 2011 (diff | hist) . . (-10) . . Supplementary data normal mode glucocerebrosidase (→Nomad-Ref)
- 09:27, 18 August 2011 (diff | hist) . . (+319) . . Normal Mode Analysis of Glucocerebrosidase (→Anisotropic Network Model)
- 09:25, 18 August 2011 (diff | hist) . . (-644) . . Supplementary data normal mode glucocerebrosidase (→Anisotropic Network Model)
- 09:25, 18 August 2011 (diff | hist) . . (+643) . . Normal Mode Analysis of Glucocerebrosidase (→Anisotropic Network Model)
- 08:51, 18 August 2011 (diff | hist) . . (+223) . . Glucocerebrosidase sequence alignments (→Gaps in secondary structure elements)
- 08:43, 18 August 2011 (diff | hist) . . (+589) . . Glucocerebrosidase sequence alignments (→Gaps in secondary structure elements)
- 08:39, 18 August 2011 (diff | hist) . . (0) . . N File:T coffee 3d gap02.png (current)
- 08:38, 18 August 2011 (diff | hist) . . (0) . . N File:T coffee 3d gap01.png (current)
- 08:27, 18 August 2011 (diff | hist) . . (+11) . . Glucocerebrosidase sequence alignments (→Functionally important residues)
- 08:24, 18 August 2011 (diff | hist) . . (+8,280) . . Glucocerebrosidase disease causing mutations (current)
- 08:23, 18 August 2011 (diff | hist) . . (+9,030) . . N Glucocerebrosidase disease causing mutations (Created page with "<code> >sp|P04062|GLCM_HUMAN Glucosylceramidase OS=Homo sapiens GN=GBA PE=1 SV=3<br/> MEFSSPSREECP<span style="color:#ff0000">K</span>PLSRVSIMAGSLTGLLLLQAVS<span style="color:#ff…")
- 08:22, 18 August 2011 (diff | hist) . . (-1) . . Glucocerebrosidase mapping snps (→Positions where mutations occur)
- 08:21, 18 August 2011 (diff | hist) . . (+1,917) . . N Glucocerebrosidase neutral mutations (Created page with "<code> >sp|P04062|GLCM_HUMAN Glucosylceramidase OS=Homo sapiens GN=GBA PE=1 SV=3<br/> MEFSSPSREECPKPLSRVSIMAGSLTGLLLLQAVSWASGARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSR<span style="c…") (current)
- 08:20, 18 August 2011 (diff | hist) . . (+90) . . Gaucher Disease 2011 (→Disease causing mutations)
- 08:20, 18 August 2011 (diff | hist) . . (+74) . . Gaucher Disease 2011 (→Neutral mutations)
- 08:17, 18 August 2011 (diff | hist) . . (+385) . . Glucocerebrosidase mapping snps (→Non-synonymous mutations)
- 08:11, 18 August 2011 (diff | hist) . . (+1,798) . . Glucocerebrosidase mapping snps (→Non-synonymous mutations)
- 07:46, 18 August 2011 (diff | hist) . . (+29) . . Glucocerebrosidase mapping snps (→Synonymous mutations)
- 11:14, 17 August 2011 (diff | hist) . . (+298) . . Glucocerebrosidase mapping snps (→Non-synonymous mutations)
- 11:09, 17 August 2011 (diff | hist) . . (+31) . . Glucocerebrosidase mapping snps (→Synonymous mutations)
- 11:03, 17 August 2011 (diff | hist) . . (+1,656) . . Glucocerebrosidase mapping snps (→Non-synonymous mutations)
- 10:43, 17 August 2011 (diff | hist) . . (+1) . . Glucocerebrosidase mapping snps (→Statistical analyses)
- 10:41, 17 August 2011 (diff | hist) . . (+96) . . Glucocerebrosidase mapping snps (→Statistical analyses)
- 10:39, 17 August 2011 (diff | hist) . . (+1,801) . . Glucocerebrosidase mapping snps (→Synonymous mutations)
- 10:24, 17 August 2011 (diff | hist) . . (+191) . . Glucocerebrosidase mapping snps (→Statistical analyses)
- 10:21, 17 August 2011 (diff | hist) . . (+751) . . Glucocerebrosidase mapping snps (→Statistical analyses)
- 10:21, 17 August 2011 (diff | hist) . . (0) . . N File:Which position in codon.png (current)
- 10:21, 17 August 2011 (diff | hist) . . (0) . . N File:How often which aa syn mutation.png (current)
- 10:21, 17 August 2011 (diff | hist) . . (0) . . N File:How often which aa occured.png (current)
- 10:20, 17 August 2011 (diff | hist) . . (0) . . N File:How often which aa mutated.png (current)
- 10:20, 17 August 2011 (diff | hist) . . (0) . . N File:Heatmap amino acid replacement.png (current)
- 10:14, 17 August 2011 (diff | hist) . . (+28) . . Glucocerebrosidase mapping snps (→Mutation map)
- 19:15, 15 August 2011 (diff | hist) . . (+408) . . Sequence and structure based mutation analysis of GBA (→Discussion)
- 19:13, 15 August 2011 (diff | hist) . . (+47) . . Sequence and structure based mutation analysis of GBA (→Mutation 1)
- 19:04, 15 August 2011 (diff | hist) . . (-28) . . Structure based mutation analysis of GBA (→Clashes or Holes)
- 19:03, 15 August 2011 (diff | hist) . . (+1,359) . . Structure based mutation analysis of GBA (→Clashes or Holes)
- 18:52, 15 August 2011 (diff | hist) . . (+954) . . Structure based mutation analysis of GBA (→Results of the different Force Fields)
- 16:46, 15 August 2011 (diff | hist) . . (+942) . . Sequence and structure based mutation analysis of GBA (→Summary)
- 16:39, 15 August 2011 (diff | hist) . . (+188) . . Sequence and structure based mutation analysis of GBA (→Mutation 2)
- 16:36, 15 August 2011 (diff | hist) . . (-1) . . Sequence and structure based mutation analysis of GBA (→Mutation 10)
- 16:36, 15 August 2011 (diff | hist) . . (+6) . . Sequence and structure based mutation analysis of GBA (→Mutation 10)
- 16:35, 15 August 2011 (diff | hist) . . (+7) . . Sequence and structure based mutation analysis of GBA (→Mutation 9)
- 16:33, 15 August 2011 (diff | hist) . . (+196) . . Sequence and structure based mutation analysis of GBA (→Mutation 7)
- 16:30, 15 August 2011 (diff | hist) . . (+75) . . Sequence and structure based mutation analysis of GBA (→Mutation 6)
- 16:28, 15 August 2011 (diff | hist) . . (+59) . . Structure based mutation analysis of GBA (→Discussion)
- 15:11, 15 August 2011 (diff | hist) . . (+6) . . Sequence and structure based mutation analysis of GBA (→Predictions of sequence-based and structure-based mutation analysis)
- 15:07, 15 August 2011 (diff | hist) . . (0) . . Sequence and structure based mutation analysis of GBA (→Summary)
- 15:06, 15 August 2011 (diff | hist) . . (0) . . Sequence and structure based mutation analysis of GBA (→Summary)
- 15:05, 15 August 2011 (diff | hist) . . (+316) . . Sequence and structure based mutation analysis of GBA (→Predictions of sequence-based and structure-based mutation analysis)
- 15:00, 15 August 2011 (diff | hist) . . (+17) . . Sequence and structure based mutation analysis of GBA (→Discussion)
- 15:00, 15 August 2011 (diff | hist) . . (+754) . . Sequence and structure based mutation analysis of GBA (→Mutation 10)
- 14:55, 15 August 2011 (diff | hist) . . (+726) . . Sequence and structure based mutation analysis of GBA (→Mutation 9)
- 14:51, 15 August 2011 (diff | hist) . . (+280) . . Sequence and structure based mutation analysis of GBA (→Mutation 8)
- 14:49, 15 August 2011 (diff | hist) . . (+682) . . Sequence and structure based mutation analysis of GBA (→Mutation 7)
- 14:44, 15 August 2011 (diff | hist) . . (+821) . . Sequence and structure based mutation analysis of GBA (→Mutation 6)
- 14:40, 15 August 2011 (diff | hist) . . (+2,807) . . Sequence and structure based mutation analysis of GBA (→Discussion)
- 14:16, 15 August 2011 (diff | hist) . . (+5,744) . . N Sequence and structure based mutation analysis of GBA (Created page with "== Introduction == In this section we want to combine the results of sequence- and structure-based mutation analysis. Therefore we use the results of [[Sequence_based_mutation a…")
- 14:10, 15 August 2011 (diff | hist) . . (+6) . . Sequence based mutation analysis of GBA (→Mutation 10: Leu - Pro (Pos. 509/470))
- 14:09, 15 August 2011 (diff | hist) . . (+6) . . Sequence based mutation analysis of GBA (→Mutation 9: Met - Val (Pos. 455/416))
- 14:09, 15 August 2011 (diff | hist) . . (+6) . . Sequence based mutation analysis of GBA (→Mutation 8: His - Arg (Pos. 350/311))
- 14:09, 15 August 2011 (diff | hist) . . (+6) . . Sequence based mutation analysis of GBA (→Mutation 7: Asn - Ser (Pos. 409/370))
- 14:08, 15 August 2011 (diff | hist) . . (+6) . . Sequence based mutation analysis of GBA (→Mutation 6: Ser - Asn (Pos. 310/271))
- 14:08, 15 August 2011 (diff | hist) . . (+6) . . Sequence based mutation analysis of GBA (→Mutation 5: Pro - Leu (Pos. 221/182))
- 14:07, 15 August 2011 (diff | hist) . . (+6) . . Sequence based mutation analysis of GBA (→Mutation 4: Arg - Gln (Pos. 159/120))
- 14:06, 15 August 2011 (diff | hist) . . (+6) . . Sequence based mutation analysis of GBA (→Mutation 3: His - Arg (Pos. 99/60))
- 14:05, 15 August 2011 (diff | hist) . . (+6) . . Sequence based mutation analysis of GBA (→Mutation 2: Asp - Asn (Pos. 63/24))
- 14:05, 15 August 2011 (diff | hist) . . (+6) . . Sequence based mutation analysis of GBA (→Mutation 1: Gly - Ser (Pos. 49/10))
- 13:58, 15 August 2011 (diff | hist) . . (+136) . . Gaucher Disease 2011 (→Tasks)
- 13:51, 15 August 2011 (diff | hist) . . (+2,071) . . Structure based mutation analysis of GBA (→Discussion)
- 11:38, 15 August 2011 (diff | hist) . . (+820) . . Structure based mutation analysis of GBA (→Discussion)
- 11:24, 15 August 2011 (diff | hist) . . (+1) . . Structure based mutation analysis of GBA (→Mutations)
- 11:23, 15 August 2011 (diff | hist) . . (-1) . . Structure based mutation analysis of GBA (→Correlation between nsteps and runtime of mdrun)
- 11:20, 15 August 2011 (diff | hist) . . (-2) . . Structure based mutation analysis of GBA (→Clashes or Holes)
- 10:58, 15 August 2011 (diff | hist) . . (-1) . . Structure based mutation analysis of GBA (→Introduction)
- 12:22, 14 August 2011 (diff | hist) . . (+65) . . Structure based mutation analysis of GBA (→Clashes or Holes)
- 12:07, 14 August 2011 (diff | hist) . . (+123) . . Structure based mutation analysis of GBA (→Clashes or Holes)
- 11:36, 14 August 2011 (diff | hist) . . (-50) . . Structure based mutation analysis of GBA (→Mutations)
- 11:34, 14 August 2011 (diff | hist) . . (+131) . . Structure based mutation analysis of GBA (→Force Fields: AMBER03, CHARMM27 and OPLS/AA)
- 11:33, 14 August 2011 (diff | hist) . . (0) . . File:2NT0 mut10 nw.png (uploaded a new version of "File:2NT0 mut10 nw.png") (current)
- 11:33, 14 August 2011 (diff | hist) . . (0) . . File:2NT0 mut9 nw.png (uploaded a new version of "File:2NT0 mut9 nw.png") (current)
- 11:32, 14 August 2011 (diff | hist) . . (0) . . File:2NT0 mut8 nw.png (uploaded a new version of "File:2NT0 mut8 nw.png") (current)
- 11:32, 14 August 2011 (diff | hist) . . (0) . . File:2NT0 mut7 nw.png (uploaded a new version of "File:2NT0 mut7 nw.png") (current)
- 11:32, 14 August 2011 (diff | hist) . . (0) . . File:2NT0 mut6 nw.png (uploaded a new version of "File:2NT0 mut6 nw.png") (current)
- 11:32, 14 August 2011 (diff | hist) . . (0) . . File:2NT0 mut4 nw.png (uploaded a new version of "File:2NT0 mut4 nw.png") (current)
- 11:31, 14 August 2011 (diff | hist) . . (0) . . File:2NT0 mut5 nw.png (uploaded a new version of "File:2NT0 mut5 nw.png") (current)
- 11:31, 14 August 2011 (diff | hist) . . (0) . . File:2NT0 mut3 nw.png (uploaded a new version of "File:2NT0 mut3 nw.png") (current)
- 11:30, 14 August 2011 (diff | hist) . . (0) . . File:2NT0 mut2 nw.png (uploaded a new version of "File:2NT0 mut2 nw.png") (current)
- 11:30, 14 August 2011 (diff | hist) . . (0) . . File:2NT0 mut1 nw.png (uploaded a new version of "File:2NT0 mut1 nw.png") (current)
- 11:29, 14 August 2011 (diff | hist) . . (0) . . File:2NT0 A nw oplsaa nstep5000.png (uploaded a new version of "File:2NT0 A nw oplsaa nstep5000.png") (current)
- 11:29, 14 August 2011 (diff | hist) . . (0) . . File:2NT0 A nw oplsaa nstep1000.png (uploaded a new version of "File:2NT0 A nw oplsaa nstep1000.png") (current)
- 11:29, 14 August 2011 (diff | hist) . . (0) . . File:2NT0 A nw oplsaa nstep500.png (uploaded a new version of "File:2NT0 A nw oplsaa nstep500.png") (current)
- 11:29, 14 August 2011 (diff | hist) . . (0) . . File:2NT0 A nw oplsaa nstep100.png (uploaded a new version of "File:2NT0 A nw oplsaa nstep100.png") (current)
- 11:28, 14 August 2011 (diff | hist) . . (0) . . File:2NT0 A nw oplsaa nstep50.png (uploaded a new version of "File:2NT0 A nw oplsaa nstep50.png") (current)
- 11:28, 14 August 2011 (diff | hist) . . (0) . . File:2NT0 A nw oplsaa nstep10.png (uploaded a new version of "File:2NT0 A nw oplsaa nstep10.png") (current)
- 11:27, 14 August 2011 (diff | hist) . . (0) . . File:2NT0 A nw charmm27 nstep10.png (uploaded a new version of "File:2NT0 A nw charmm27 nstep10.png") (current)
- 11:27, 14 August 2011 (diff | hist) . . (0) . . File:2NT0 A nw charmm27 nstep10.png (uploaded a new version of "File:2NT0 A nw charmm27 nstep10.png")
- 11:26, 14 August 2011 (diff | hist) . . (0) . . File:2NT0 A nw charmm27 nstep5000.png (uploaded a new version of "File:2NT0 A nw charmm27 nstep5000.png") (current)
- 11:26, 14 August 2011 (diff | hist) . . (0) . . File:2NT0 A nw charmm27 nstep1000.png (uploaded a new version of "File:2NT0 A nw charmm27 nstep1000.png") (current)
- 11:26, 14 August 2011 (diff | hist) . . (0) . . File:2NT0 A nw charmm27 nstep500.png (uploaded a new version of "File:2NT0 A nw charmm27 nstep500.png") (current)
- 11:25, 14 August 2011 (diff | hist) . . (0) . . File:2NT0 A nw charmm27 nstep100.png (uploaded a new version of "File:2NT0 A nw charmm27 nstep100.png") (current)
- 11:25, 14 August 2011 (diff | hist) . . (0) . . File:2NT0 A nw charmm27 nstep50.png (uploaded a new version of "File:2NT0 A nw charmm27 nstep50.png") (current)
- 11:24, 14 August 2011 (diff | hist) . . (0) . . File:2NT0 A nw amber nstep5000.png (uploaded a new version of "File:2NT0 A nw amber nstep5000.png") (current)
- 11:24, 14 August 2011 (diff | hist) . . (0) . . File:2NT0 A nw amber nstep1000.png (uploaded a new version of "File:2NT0 A nw amber nstep1000.png") (current)
- 11:23, 14 August 2011 (diff | hist) . . (0) . . File:2NT0 A nw amber nstep500.png (uploaded a new version of "File:2NT0 A nw amber nstep500.png") (current)
- 11:19, 14 August 2011 (diff | hist) . . (0) . . File:2NT0 A nw amber nstep100.png (uploaded a new version of "File:2NT0 A nw amber nstep100.png") (current)
- 11:19, 14 August 2011 (diff | hist) . . (0) . . File:2NT0 A nw amber nstep10.png (uploaded a new version of "File:2NT0 A nw amber nstep10.png") (current)
- 10:47, 24 July 2011 (diff | hist) . . (+594) . . Normal Mode Analysis of Glucocerebrosidase (→oGNM)
- 10:38, 24 July 2011 (diff | hist) . . (0) . . N File:Ognm 2nt0 mode5 6 7.png (current)
- 10:38, 24 July 2011 (diff | hist) . . (0) . . N File:Ognm 2nt0 mode5.png (current)
- 10:38, 24 July 2011 (diff | hist) . . (0) . . N File:Ognm 2nt0 mode4.png (current)
- 10:38, 24 July 2011 (diff | hist) . . (0) . . N File:Ognm 2nt0 mode3 4.png (current)
- 10:38, 24 July 2011 (diff | hist) . . (0) . . N File:Ognm 2nt0 mode3.png (current)
- 10:37, 24 July 2011 (diff | hist) . . (0) . . N File:Ognm 2nt0 mode2.png (current)
- 10:37, 24 July 2011 (diff | hist) . . (+802) . . Normal Mode Analysis of Glucocerebrosidase (→oGNM)
- 10:36, 24 July 2011 (diff | hist) . . (0) . . N File:Ognm 2nt0 mode1 2.png (current)
- 10:36, 24 July 2011 (diff | hist) . . (0) . . N File:Ognm 2nt0 mode1.png (current)
- 10:36, 24 July 2011 (diff | hist) . . (0) . . N File:Ognm 2nt0 1 5 cc.jpg (current)
- 10:29, 24 July 2011 (diff | hist) . . (+106) . . Task 3 - Normal Mode Analysis (→oGNM – Gaussian network model)
- 11:53, 19 July 2011 (diff | hist) . . (+845) . . Normal Mode Analysis of Glucocerebrosidase (→Anisotropic Network Model)
- 11:41, 19 July 2011 (diff | hist) . . (+140) . . Normal Mode Analysis of Glucocerebrosidase (→NOMAD-Ref)
- 11:38, 19 July 2011 (diff | hist) . . (+226) . . Normal Mode Analysis of Glucocerebrosidase (→NOMAD-Ref)
- 11:29, 19 July 2011 (diff | hist) . . (+434) . . Normal Mode Analysis of Glucocerebrosidase (→NOMAD-Ref)
- 11:20, 19 July 2011 (diff | hist) . . (-5) . . Normal Mode Analysis of Glucocerebrosidase (→NOMAD-Ref)
- 11:20, 19 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase nomad mode011.png (current)
- 11:17, 19 July 2011 (diff | hist) . . (+308) . . Normal Mode Analysis of Glucocerebrosidase (→NOMAD-Ref)
- 11:11, 19 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase nomad mode11.png (current)
- 11:09, 19 July 2011 (diff | hist) . . (+608) . . Normal Mode Analysis of Glucocerebrosidase (→NOMAD-Ref)
- 11:06, 19 July 2011 (diff | hist) . . (0) . . N File:Nomad ref mode6 glucocerebrosidase.gif (current)
- 11:04, 19 July 2011 (diff | hist) . . (0) . . N File:Nomad ref mode5 glucocerebrosidase.gif (current)
- 11:03, 19 July 2011 (diff | hist) . . (0) . . N File:Nomad ref mode4 glucocerebrosidase.gif (current)
- 11:02, 19 July 2011 (diff | hist) . . (0) . . N File:Nomad ref mode3 glucocerebrosidase.gif (current)
- 11:01, 19 July 2011 (diff | hist) . . (0) . . N File:Nomad ref mode2 glucocerebrosidase.gif (current)
- 11:00, 19 July 2011 (diff | hist) . . (0) . . N File:Nomad ref mode1 glucocerebrosidase.gif (current)
- 10:50, 19 July 2011 (diff | hist) . . (+187) . . Animated Gifs (→NOMAD-Ref)
- 08:48, 18 July 2011 (diff | hist) . . (+90) . . Normal Mode Analysis of Glucocerebrosidase (→NOMAD-Ref)
- 14:16, 16 July 2011 (diff | hist) . . (0) . . File:Glucocerebrosidase 1BPT 600 mode10.gif (uploaded a new version of "File:Glucocerebrosidase 1BPT 600 mode10.gif") (current)
- 14:15, 16 July 2011 (diff | hist) . . (0) . . File:Glucocerebrosidase 1BPT 600 mode9.gif (uploaded a new version of "File:Glucocerebrosidase 1BPT 600 mode9.gif") (current)
- 14:14, 16 July 2011 (diff | hist) . . (0) . . File:Glucocerebrosidase 1BPT 600 mode8.gif (uploaded a new version of "File:Glucocerebrosidase 1BPT 600 mode8.gif") (current)
- 14:11, 16 July 2011 (diff | hist) . . (0) . . File:Glucocerebrosidase 1BPT 600 mode7.gif (uploaded a new version of "File:Glucocerebrosidase 1BPT 600 mode7.gif") (current)
- 14:05, 16 July 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase 1BPT net mode10.png (current)
- 14:04, 16 July 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase 1BPT net mode9.png (current)
- 14:04, 16 July 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase 1BPT net mode8.png (current)
- 14:04, 16 July 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase 1BPT net mode7.png (current)
- 14:01, 16 July 2011 (diff | hist) . . (0) . . Normal Mode Analysis of Glucocerebrosidase (→Elastic Network of 1BPT)
- 13:58, 16 July 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase 1BPT 2000 mode10.gif (current)
- 13:58, 16 July 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase 1BPT 2000 mode9.gif (current)
- 13:57, 16 July 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase 1BPT 2000 mode8.gif (current)
- 13:56, 16 July 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase 1BPT 2000 mode7.gif (current)
- 13:50, 16 July 2011 (diff | hist) . . (+1,023) . . Normal Mode Analysis of Glucocerebrosidase (→All-atom NMA)
- 13:49, 16 July 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase 1BPT 600 mode10.gif
- 13:49, 16 July 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase 1BPT 600 mode9.gif
- 13:48, 16 July 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase 1BPT 600 mode8.gif
- 13:47, 16 July 2011 (diff | hist) . . (0) . . N File:Glucocerebrosidase 1BPT 600 mode7.gif
- 13:26, 16 July 2011 (diff | hist) . . (+169) . . Normal Mode Analysis of Glucocerebrosidase (→NOMAD-Ref)
- 13:20, 16 July 2011 (diff | hist) . . (+1) . . Normal Mode Analysis of Glucocerebrosidase (→NOMAD-Ref)
- 13:20, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase nomad mode010.png (current)
- 13:19, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase nomad mode10.png (current)
- 13:18, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase nomad mode09.png (current)
- 13:18, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase nomad mode08.png (current)
- 13:17, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase nomad mode9.png (current)
- 13:17, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase nomad mode8.png (current)
- 13:17, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase nomad mode07.png (current)
- 13:16, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase nomad mode7.png (current)
- 13:16, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase nomad mode06.png (current)
- 13:15, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase nomad mode6.png (current)
- 13:15, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase nomad mode05.png (current)
- 13:14, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase nomad mode5.png (current)
- 13:14, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase nomad mode04.png (current)
- 13:14, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase nomad mode4.png (current)
- 13:13, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase nomad mode03.png (current)
- 13:13, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase nomad mode3.png (current)
- 13:13, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase nomad mode02.png (current)
- 13:13, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase nomad mode2.png (current)
- 13:13, 16 July 2011 (diff | hist) . . (+2,214) . . Normal Mode Analysis of Glucocerebrosidase (→NOMAD-Ref)
- 13:12, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase nomad mode01.png (current)
- 13:12, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase nomad mode1.png (current)
- 10:51, 16 July 2011 (diff | hist) . . (-5) . . Normal Mode Analysis of Glucocerebrosidase (→Anisotropic Network Model)
- 10:41, 16 July 2011 (diff | hist) . . (+645) . . Normal Mode Analysis of Glucocerebrosidase (→Anisotropic Network Model)
- 10:41, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase temp22.png (current)
- 10:40, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase temp21.png (current)
- 10:40, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase temp12.png (current)
- 10:40, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase temp11.png (current)
- 10:32, 16 July 2011 (diff | hist) . . (+709) . . Normal Mode Analysis of Glucocerebrosidase (→Anisotropic Network Model)
- 10:20, 16 July 2011 (diff | hist) . . (+5,328) . . Normal Mode Analysis of Glucocerebrosidase (→Anisotropic Network Model)
- 10:11, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase bfmode1.png (current)
- 10:10, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase bfmode2.png (current)
- 10:10, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase bfmode3.png (current)
- 10:10, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase bfmode4.png (current)
- 10:10, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase bfmode5.png (current)
- 10:10, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase bfmode6.png (current)
- 10:09, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase bfmode7.png (current)
- 10:09, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase bfmode8.png (current)
- 10:09, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase bfmode9.png (current)
- 10:09, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase bfmode10.png (current)
- 10:09, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase distmapscalar1.png (current)
- 10:09, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase distmapscalar2.png (current)
- 10:08, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase distmapscalar3.png (current)
- 10:08, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase distmapscalar4.png (current)
- 10:08, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase distmapscalar5.png (current)
- 10:08, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase distmapscalar6.png (current)
- 10:07, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase distmapscalar7.png (current)
- 10:07, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase distmapscalar8.png (current)
- 10:07, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase distmapscalar9.png (current)
- 10:07, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase distmapscalar10.png (current)
- 10:06, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase mode0001.gif (current)
- 10:06, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase mode1.png (current)
- 10:05, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase mode0002.gif (current)
- 10:05, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase mode2.png (current)
- 10:05, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase mode0003.gif (current)
- 10:04, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase mode3.png (current)
- 10:04, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase mode0004.gif (current)
- 10:04, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase mode4.png (current)
- 10:04, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase mode0005.gif (current)
- 10:03, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase mode5.png (current)
- 10:03, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase mode0006.gif (current)
- 10:03, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase mode6.png (current)
- 10:02, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase mode0007.gif (current)
- 10:02, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase mode7.png (current)
- 10:01, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase mode0008.gif (current)
- 10:01, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase mode8.png (current)
- 10:01, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase mode0009.gif (current)
- 10:01, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase mode9.png (current)
- 10:00, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase mode0010.gif (current)
- 10:00, 16 July 2011 (diff | hist) . . (0) . . N File:Anm glucocerebrosidase mode10.png (current)
- 09:21, 16 July 2011 (diff | hist) . . (+124) . . Animated Gifs (→Webnma)
- 17:58, 11 July 2011 (diff | hist) . . (+162) . . Structure based mutation analysis of GBA (→Clashes or Holes)
- 17:55, 11 July 2011 (diff | hist) . . (+160) . . Structure based mutation analysis of GBA (→Clashes or Holes)
- 17:39, 11 July 2011 (diff | hist) . . (+703) . . Structure based mutation analysis of GBA (→Polar Interactions)
- 17:07, 11 July 2011 (diff | hist) . . (+16) . . Glucocerebrosidase Molecular Dynamics Simulation
- 17:06, 11 July 2011 (diff | hist) . . (+1,864) . . N Glucocerebrosidase Molecular Dynamics Simulation (Created page with "== Introduction == In this task we used Gromacs and performed a Molecular Dynamics Simulation with the wildtype structure 2NT0 of Glucocerebrosidase as well as with two mutated …")
- 16:48, 11 July 2011 (diff | hist) . . (+94) . . Gaucher Disease 2011 (→Tasks)
- 10:32, 5 July 2011 (diff | hist) . . (+74) . . Task 8 - Molecular Dynamics Simulations 2011 (→Intro)
- 10:30, 5 July 2011 (diff | hist) . . (+53) . . N File:Molecular dynamics talk.pdf (Talk about Molecular Dynamics from Tatjana and Sabine) (current)
- 13:44, 2 July 2011 (diff | hist) . . (0) . . Structure based mutation analysis of GBA (→Mutations)
- 13:44, 2 July 2011 (diff | hist) . . (0) . . Structure based mutation analysis of GBA (→OPLS/AA)
- 13:43, 2 July 2011 (diff | hist) . . (0) . . Structure based mutation analysis of GBA (→CHARMM27)
- 13:43, 2 July 2011 (diff | hist) . . (+2) . . Structure based mutation analysis of GBA (→AMBER03)
- 13:42, 2 July 2011 (diff | hist) . . (0) . . Structure based mutation analysis of GBA (→Correlation between nsteps and runtime of mdrun)
- 13:42, 2 July 2011 (diff | hist) . . (0) . . Structure based mutation analysis of GBA (→Gromacs)
- 13:42, 2 July 2011 (diff | hist) . . (+513) . . Structure based mutation analysis of GBA (→Minimise)
- 13:39, 2 July 2011 (diff | hist) . . (0) . . N File:Mutation mapping 2NT0 minimise.jpg (current)
- 13:23, 2 July 2011 (diff | hist) . . (+13) . . Structure based mutation analysis of GBA (→Polar Interactions)
- 13:20, 2 July 2011 (diff | hist) . . (+383) . . Structure based mutation analysis of GBA (→Polar Interactions)
- 08:56, 2 July 2011 (diff | hist) . . (+1,060) . . Structure based mutation analysis of GBA (→Mutations)
- 08:37, 2 July 2011 (diff | hist) . . (+813) . . Structure based mutation analysis of GBA (→Minimise)
- 08:24, 2 July 2011 (diff | hist) . . (+5,994) . . Structure based mutation analysis of GBA (→Wildtype)
- 08:24, 2 July 2011 (diff | hist) . . (0) . . N File:2NT0 mut10 nw.png
- 08:24, 2 July 2011 (diff | hist) . . (0) . . N File:2NT0 mut9 nw.png
- 08:24, 2 July 2011 (diff | hist) . . (0) . . N File:2NT0 mut8 nw.png
- 08:24, 2 July 2011 (diff | hist) . . (0) . . N File:2NT0 mut7 nw.png
- 08:24, 2 July 2011 (diff | hist) . . (0) . . N File:2NT0 mut6 nw.png
- 08:24, 2 July 2011 (diff | hist) . . (0) . . N File:2NT0 mut5 nw.png
- 08:24, 2 July 2011 (diff | hist) . . (0) . . N File:2NT0 mut4 nw.png
- 08:24, 2 July 2011 (diff | hist) . . (0) . . N File:2NT0 mut3 nw.png
- 08:23, 2 July 2011 (diff | hist) . . (0) . . N File:2NT0 mut2 nw.png
- 08:23, 2 July 2011 (diff | hist) . . (0) . . N File:2NT0 mut1 nw.png
- 08:01, 2 July 2011 (diff | hist) . . (+788) . . Structure based mutation analysis of GBA (→OPLS/AA)
- 08:01, 2 July 2011 (diff | hist) . . (0) . . N File:2NT0 A nw oplsaa nstep5000.png
- 08:01, 2 July 2011 (diff | hist) . . (0) . . N File:2NT0 A nw oplsaa nstep1000.png
- 08:00, 2 July 2011 (diff | hist) . . (0) . . N File:2NT0 A nw oplsaa nstep500.png
- 08:00, 2 July 2011 (diff | hist) . . (0) . . N File:2NT0 A nw oplsaa nstep100.png
- 08:00, 2 July 2011 (diff | hist) . . (0) . . N File:2NT0 A nw oplsaa nstep50.png
- 08:00, 2 July 2011 (diff | hist) . . (0) . . N File:2NT0 A nw oplsaa nstep10.png
- 07:57, 2 July 2011 (diff | hist) . . (+806) . . Structure based mutation analysis of GBA (→CHARMM27)
- 07:57, 2 July 2011 (diff | hist) . . (0) . . N File:2NT0 A nw charmm27 nstep5000.png
- 07:57, 2 July 2011 (diff | hist) . . (0) . . N File:2NT0 A nw charmm27 nstep1000.png
- 07:56, 2 July 2011 (diff | hist) . . (0) . . N File:2NT0 A nw charmm27 nstep500.png
- 07:56, 2 July 2011 (diff | hist) . . (0) . . N File:2NT0 A nw charmm27 nstep100.png
- 07:56, 2 July 2011 (diff | hist) . . (0) . . N File:2NT0 A nw charmm27 nstep50.png
- 07:56, 2 July 2011 (diff | hist) . . (0) . . N File:2NT0 A nw charmm27 nstep10.png
- 07:55, 2 July 2011 (diff | hist) . . (+41) . . Structure based mutation analysis of GBA (→AMBER03)
- 07:51, 2 July 2011 (diff | hist) . . (-1) . . Structure based mutation analysis of GBA (→AMBER03)
- 07:51, 2 July 2011 (diff | hist) . . (+617) . . Structure based mutation analysis of GBA (→AMBER03)
- 07:46, 2 July 2011 (diff | hist) . . (0) . . N File:2NT0 A nw amber nstep5000.png
- 07:45, 2 July 2011 (diff | hist) . . (0) . . N File:2NT0 A nw amber nstep1000.png
- 07:45, 2 July 2011 (diff | hist) . . (0) . . N File:2NT0 A nw amber nstep500.png
- 07:45, 2 July 2011 (diff | hist) . . (0) . . N File:2NT0 A nw amber nstep100.png
- 07:45, 2 July 2011 (diff | hist) . . (0) . . N File:2NT0 A nw amber nstep10.png
- 07:41, 2 July 2011 (diff | hist) . . (+5,362) . . Structure based mutation analysis of GBA (→Wildtype)
- 07:10, 2 July 2011 (diff | hist) . . (+2,352) . . Structure based mutation analysis of GBA (→Gromacs)
- 06:49, 2 July 2011 (diff | hist) . . (+81) . . N File:2nt0 nsteps time.png (The plot shows the correlation of the parameter nsteps and the time mdrum needed.) (current)
- 16:11, 1 July 2011 (diff | hist) . . (+52) . . Workflow structure based mutation analysis GBA (→Gromacs)
- 12:15, 28 June 2011 (diff | hist) . . (+24) . . Structure based mutation analysis of GBA
- 12:09, 28 June 2011 (diff | hist) . . (+387) . . N Structure based mutation analysis of GBA (Created page with "{| border="1" style="text-align:center; border-spacing:0" align="left" cellpadding="3" cellspacing="3" |- !PDB ID !Resolution !R-factor !Coverage !pH !Missing residues chain A c…")
- 11:51, 28 June 2011 (diff | hist) . . (+90) . . Gaucher Disease 2011 (→Tasks)
- 19:20, 27 June 2011 (diff | hist) . . (+1,652) . . Sequence based mutation analysis of GBA (→Summary)
- 19:05, 27 June 2011 (diff | hist) . . (-32) . . Sequence based mutation analysis of GBA (→Overview)
- 19:05, 27 June 2011 (diff | hist) . . (+29) . . Sequence based mutation analysis of GBA (→Mutation 9: Met - Val (Pos. 455/416))
- 19:04, 27 June 2011 (diff | hist) . . (+2) . . Sequence based mutation analysis of GBA (→Mutation 8: His - Arg (Pos. 350/311))
- 19:03, 27 June 2011 (diff | hist) . . (-27) . . Sequence based mutation analysis of GBA (→Mutation 7: Asn - Ser (Pos. 409/370))
- 19:02, 27 June 2011 (diff | hist) . . (+7) . . Sequence based mutation analysis of GBA (→Mutation 6: Ser - Asn (Pos. 310/271))
- 19:01, 27 June 2011 (diff | hist) . . (-8) . . Sequence based mutation analysis of GBA (→Mutation 4: Arg - Gln (Pos. 159/120))
- 19:01, 27 June 2011 (diff | hist) . . (+16) . . Sequence based mutation analysis of GBA (→Mutation 3: His - Arg (Pos. 99/60))
- 19:00, 27 June 2011 (diff | hist) . . (-4) . . Sequence based mutation analysis of GBA (→Mutation 2: Asp - Asn (Pos. 63/24))
- 18:59, 27 June 2011 (diff | hist) . . (-9) . . Sequence based mutation analysis of GBA (→Mutation 1: Gly - Ser (Pos. 49/10))
- 18:57, 27 June 2011 (diff | hist) . . (+4) . . Sequence based mutation analysis of GBA (→Overview)
- 18:56, 27 June 2011 (diff | hist) . . (+4) . . Sequence based mutation analysis of GBA (→Overview)
- 18:55, 27 June 2011 (diff | hist) . . (-4) . . Sequence based mutation analysis of GBA (→Overview)
- 18:52, 27 June 2011 (diff | hist) . . (+4) . . Sequence based mutation analysis of GBA (→Overview)
- 18:51, 27 June 2011 (diff | hist) . . (+147) . . Sequence based mutation analysis of GBA (→Mutation 10: Leu - Pro (Pos. 509/470))
- 18:48, 27 June 2011 (diff | hist) . . (+255) . . Sequence based mutation analysis of GBA (→Mutation 9: Met - Val (Pos. 455/416))
- 18:46, 27 June 2011 (diff | hist) . . (+261) . . Sequence based mutation analysis of GBA (→Mutation 8: His - Arg (Pos. 350/311))
- 18:44, 27 June 2011 (diff | hist) . . (+457) . . Sequence based mutation analysis of GBA (→Mutation 7: Asn - Ser (Pos. 409/370))
- 18:39, 27 June 2011 (diff | hist) . . (+196) . . Sequence based mutation analysis of GBA (→Mutation 6: Ser - Asn (Pos. 310/271))
- 18:37, 27 June 2011 (diff | hist) . . (+60) . . Sequence based mutation analysis of GBA (→Mutation 5: Pro - Leu (Pos. 221/182))
- 18:35, 27 June 2011 (diff | hist) . . (+317) . . Sequence based mutation analysis of GBA (→Mutation 4: Arg - Gln (Pos. 159/120))
- 18:32, 27 June 2011 (diff | hist) . . (-4) . . Sequence based mutation analysis of GBA (→Overview)
- 18:31, 27 June 2011 (diff | hist) . . (+234) . . Sequence based mutation analysis of GBA (→Mutation 3: His - Arg (Pos. 99/60))
- 18:27, 27 June 2011 (diff | hist) . . (+348) . . Sequence based mutation analysis of GBA (→Mutation 2: Asp - Asn (Pos. 63/24))
- 18:24, 27 June 2011 (diff | hist) . . (0) . . Sequence based mutation analysis of GBA (→Mutation 1: Gly - Ser (Pos. 49/10))
- 15:30, 27 June 2011 (diff | hist) . . (+17) . . Sequence based mutation analysis of GBA (→Mutation 10: Leu - Pro (Pos. 509/470))
- 15:29, 27 June 2011 (diff | hist) . . (-50) . . Sequence based mutation analysis of GBA
- 15:27, 27 June 2011 (diff | hist) . . (+133) . . Sequence based mutation analysis of GBA (→Mutation 10: Leu - Pro (Pos. 509/470))
- 15:27, 27 June 2011 (diff | hist) . . (+133) . . Sequence based mutation analysis of GBA (→Mutation 9: Met - Val (Pos. 455/416))