User contributions

From Bioinformatikpedia

For Brunners (talk | block log | uploads | logs)

Search for contributions

 Show contributions of new accounts only
 IP address or username:

Namespace:  all (Main) Talk User User talk Bioinformatikpedia Bioinformatikpedia talk File File talk MediaWiki MediaWiki talk Template Template talk Help Help talk Category Category talk   Invert selection  Associated namespace 

Tag filter: 

 Only show edits that are latest revisions Only show edits that are page creations Hide minor edits

From date:

To date:

(newest | oldest) View (newer 250 | older 250) (20 | 50 | 100 | 250 | 500)

• 13:26, 22 September 2011 (diff | hist) . . (-3)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Wildtype compared to Mutation 10)
• 13:26, 22 September 2011 (diff | hist) . . (+30)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Wildtype compared to Mutation 10)
• 13:22, 22 September 2011 (diff | hist) . . (-4)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Wildtype compared to Mutation 7)
• 13:18, 22 September 2011 (diff | hist) . . (+4)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Root mean square fluctuations)
• 13:17, 22 September 2011 (diff | hist) . . (0)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Density)
• 13:16, 22 September 2011 (diff | hist) . . (0)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Volume)
• 13:14, 22 September 2011 (diff | hist) . . (+12)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Root mean square fluctuations)
• 13:12, 22 September 2011 (diff | hist) . . (0)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Density)
• 13:12, 22 September 2011 (diff | hist) . . (0)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Volume)
• 13:12, 22 September 2011 (diff | hist) . . (0)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Volume)
• 13:09, 22 September 2011 (diff | hist) . . (-10)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Hydrogen bonds)
• 13:06, 22 September 2011 (diff | hist) . . (0)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Root mean square fluctuations)
• 13:05, 22 September 2011 (diff | hist) . . (-1)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Minimum distances between periodic images)
• 13:05, 22 September 2011 (diff | hist) . . (-4)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Interaction Energy: van der Waals)
• 13:04, 22 September 2011 (diff | hist) . . (0)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Density)
• 13:02, 22 September 2011 (diff | hist) . . (0)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Visualization of results)
• 19:10, 16 September 2011 (diff | hist) . . (0)‎ . . File:Glucocerebrosidase vdw.png ‎ (uploaded a new version of "File:Glucocerebrosidase vdw.png") (current)
• 19:08, 16 September 2011 (diff | hist) . . (+16)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Interaction Energy: van der Waals)
• 19:06, 16 September 2011 (diff | hist) . . (0)‎ . . File:Glucocerebrosidase coulomb.png ‎ (uploaded a new version of "File:Glucocerebrosidase coulomb.png") (current)
• 19:04, 16 September 2011 (diff | hist) . . (+9)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Interaction Energy: Coulomb)
• 19:00, 16 September 2011 (diff | hist) . . (-39)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Salt bridges)
• 19:00, 16 September 2011 (diff | hist) . . (-39)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Salt bridges)
• 19:00, 16 September 2011 (diff | hist) . . (-39)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Salt bridges)
• 19:00, 16 September 2011 (diff | hist) . . (+5,151)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Wildtype compared to Mutation 10)
• 18:40, 16 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase md movie site470 mut10.gif ‎ (current)
• 18:39, 16 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase md movie site470 wt.gif ‎ (current)
• 17:50, 16 September 2011 (diff | hist) . . (+4,046)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Wildtype compared to Mutation 7)
• 14:05, 16 September 2011 (diff | hist) . . (+687)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Wildtype compared to Mutation 7)
• 14:05, 16 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase md movie site370 mut7.gif ‎ (current)
• 14:03, 16 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase md movie site370 wt.gif ‎ (current)
• 13:21, 16 September 2011 (diff | hist) . . (+150)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Root mean square fluctuations)
• 13:20, 16 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase bfactors rmsf wt.png ‎ (current)
• 13:16, 16 September 2011 (diff | hist) . . (0)‎ . . File:Active site.png ‎ (uploaded a new version of "File:Active site.png") (current)
• 13:10, 16 September 2011 (diff | hist) . . (0)‎ . . File:Active site mut10.png ‎ (uploaded a new version of "File:Active site mut10.png") (current)
• 13:02, 16 September 2011 (diff | hist) . . (+73)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Mutation 10)
• 12:55, 16 September 2011 (diff | hist) . . (+1)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Visualization of results)
• 12:51, 16 September 2011 (diff | hist) . . (+171)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Visualization of results)
• 12:51, 16 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase md cartoon movie mut10.gif ‎ (current)
• 12:50, 16 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase md movie mut10.gif ‎ (current)
• 12:49, 16 September 2011 (diff | hist) . . (+2)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Visualization of results)
• 12:48, 16 September 2011 (diff | hist) . . (+2)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Visualization of results)
• 12:47, 16 September 2011 (diff | hist) . . (+170)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Visualization of results)
• 12:42, 16 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase md cartoon movie mut7.gif ‎ (current)
• 12:39, 16 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase md movie mut7.gif ‎ (current)
• 12:37, 16 September 2011 (diff | hist) . . (+162)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Visualization of results)
• 12:34, 16 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase wt cartoon movie.gif ‎ (current)
• 21:32, 11 September 2011 (diff | hist) . . (+553)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Distance RMSD)
• 21:32, 11 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase distance rmsd mut10.png ‎ (current)
• 21:11, 11 September 2011 (diff | hist) . . (+567)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Distance RMSD)
• 21:10, 11 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase distance rmsd mut7.png ‎ (current)
• 07:22, 11 September 2011 (diff | hist) . . (+16)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Salt bridges)
• 07:22, 11 September 2011 (diff | hist) . . (+16)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Salt bridges)
• 07:22, 11 September 2011 (diff | hist) . . (0)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Salt bridges)
• 07:21, 11 September 2011 (diff | hist) . . (-30)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Secondary structure)
• 07:21, 11 September 2011 (diff | hist) . . (-30)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Secondary structure)
• 07:20, 11 September 2011 (diff | hist) . . (+1,134)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Cluster analysis)
• 07:17, 11 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase rmsd distribution mut10.png ‎ (current)
• 07:17, 11 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase clusters mut10.png ‎ (current)
• 07:14, 11 September 2011 (diff | hist) . . (+962)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Cluster analysis)
• 07:10, 11 September 2011 (diff | hist) . . (+3)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Cluster analysis)
• 07:09, 11 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase rmsd distribution mut7.png ‎ (current)
• 07:09, 11 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase clusters mut7.png ‎ (current)
• 07:02, 11 September 2011 (diff | hist) . . (+710)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Root mean square deviations again)
• 06:59, 11 September 2011 (diff | hist) . . (+799)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Root mean square deviations again)
• 06:57, 11 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase rmsd matrix mut10.png ‎ (current)
• 06:57, 11 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase rmsd matrix mut7.png ‎ (current)
• 06:53, 11 September 2011 (diff | hist) . . (+101)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Distance RMSD)
• 06:52, 11 September 2011 (diff | hist) . . (+1,001)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Ramachandran (phi/psi) plots)
• 06:50, 11 September 2011 (diff | hist) . . (+984)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Ramachandran (phi/psi) plots)
• 06:48, 11 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase ramachandran mut7.png ‎ (current)
• 06:47, 11 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase ramachandran mut10.png ‎ (current)
• 06:39, 11 September 2011 (diff | hist) . . (+77)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Hydrogen bonds)
• 06:38, 11 September 2011 (diff | hist) . . (+34)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Hydrogen bonds)
• 06:36, 11 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase hydrogen bonds prot water mut10.png ‎ (current)
• 06:36, 11 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase hydrogen bonds prot water mut7.png ‎ (current)
• 06:36, 11 September 2011 (diff | hist) . . (0)‎ . . File:Glucocerebrosidase hydrogen bonds prot water.png ‎ (uploaded a new version of "File:Glucocerebrosidase hydrogen bonds prot water.png") (current)
• 06:34, 11 September 2011 (diff | hist) . . (0)‎ . . File:Glucocerebrosidase hydrogen bonds prot water.png ‎ (uploaded a new version of "File:Glucocerebrosidase hydrogen bonds prot water.png")
• 15:42, 10 September 2011 (diff | hist) . . (+1,294)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Hydrogen bonds)
• 15:41, 10 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase hydrogen bonds inter mut10.png ‎ (current)
• 15:41, 10 September 2011 (diff | hist) . . (+1,292)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Hydrogen bonds)
• 15:39, 10 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase hydrogen bonds inter mut7.png ‎ (current)
• 15:35, 10 September 2011 (diff | hist) . . (+901)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Solvent accessible surface area)
• 15:32, 10 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase solvent accessability mut10.png ‎ (current)
• 15:32, 10 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase residue sas mut10.png ‎ (current)
• 15:32, 10 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase atomic sas mit10.png ‎ (current)
• 15:31, 10 September 2011 (diff | hist) . . (+905)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Solvent accessible surface area)
• 15:29, 10 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase solvent accessable surface mut7.png ‎ (current)
• 15:29, 10 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase residue sas mut7.png ‎ (current)
• 15:29, 10 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase atomic sas mut7.png ‎ (current)
• 08:12, 10 September 2011 (diff | hist) . . (+758)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Convergence of radius of gyration)
• 08:10, 10 September 2011 (diff | hist) . . (+2)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Convergence of RMSD)
• 08:09, 10 September 2011 (diff | hist) . . (+2,629)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Convergence of RMSD)
• 08:06, 10 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase rmsd backbone start mut10.png ‎ (current)
• 08:06, 10 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase rmsd backbone average mut10.png ‎ (current)
• 08:06, 10 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase rmsd all atom start mut10.png ‎ (current)
• 08:06, 10 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase rmsd all atom average mut10.png ‎ (current)
• 08:06, 10 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase radius gyration mut10.png ‎ (current)
• 08:02, 10 September 2011 (diff | hist) . . (+1)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Convergence of RMSD)
• 08:01, 10 September 2011 (diff | hist) . . (+1)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Convergence of RMSD)
• 08:01, 10 September 2011 (diff | hist) . . (+727)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Convergence of radius of gyration)
• 07:59, 10 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase radius gyration mut7.png ‎ (current)
• 07:57, 10 September 2011 (diff | hist) . . (+2,640)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Convergence of RMSD)
• 07:54, 10 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase rmsd backbone start mut7.png ‎ (current)
• 07:54, 10 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase rmsd backbone average mut7.png ‎ (current)
• 07:54, 10 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase rmsd all atom average mut7.png ‎ (current)
• 07:54, 10 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase all atom start mut7.png ‎ (current)
• 07:23, 10 September 2011 (diff | hist) . . (+1,624)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Root mean square fluctuations)
• 07:20, 10 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase rmsf per residue mut10.png ‎ (current)
• 07:19, 10 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase bfactors rmsf mut10.png ‎ (current)
• 07:19, 10 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase average rmsf mut10.png ‎ (current)
• 07:15, 10 September 2011 (diff | hist) . . (+1,555)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Root mean square fluctuations)
• 07:12, 10 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase rmsf per residue mut7.png ‎ (current)
• 07:12, 10 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase bfactors rmsf mut7.png ‎ (current)
• 07:12, 10 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase average rmsf mut7.png ‎ (current)
• 06:58, 10 September 2011 (diff | hist) . . (+1,516)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Minimum distances between periodic images)
• 06:58, 10 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase minimal periodic distance mut10.png ‎ (current)
• 06:58, 10 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase minimal periodic distance calpha mut10.png ‎ (current)
• 06:50, 10 September 2011 (diff | hist) . . (+1,467)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Minimum distances between periodic images)
• 06:50, 10 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase minimal periodic distance mut7.png ‎ (current)
• 06:50, 10 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase minimal periodic distance calpha mut7.png ‎ (current)
• 21:26, 9 September 2011 (diff | hist) . . (+6,252)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Quality assurance)
• 21:11, 9 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase volume mut10.png ‎ (current)
• 21:11, 9 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase vdw mut10.png ‎ (current)
• 21:11, 9 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase temperature mut10.png ‎ (current)
• 21:11, 9 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase pressure mut10.png ‎ (current)
• 21:11, 9 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase energy mut10.png ‎ (current)
• 21:10, 9 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase density mut10.png ‎ (current)
• 21:10, 9 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase coulumb mut10.png ‎ (current)
• 21:10, 9 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase box mut10.png ‎ (current)
• 20:58, 9 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase density mut7.png ‎ (current)
• 20:57, 9 September 2011 (diff | hist) . . (+6,272)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Quality assurance)
• 20:40, 9 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase volume mut7.png ‎ (current)
• 20:40, 9 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase vdw mut7.png ‎ (current)
• 20:40, 9 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase temperature mut7.png ‎ (current)
• 20:40, 9 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase pressure mut7.png ‎ (current)
• 20:40, 9 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase energy mut7.png ‎ (current)
• 20:40, 9 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase coulomb mut7.png ‎ (current)
• 20:40, 9 September 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase box mut7.png ‎ (current)
• 19:29, 9 September 2011 (diff | hist) . . (0)‎ . . N File:Active site mut7.png ‎ (current)
• 19:26, 9 September 2011 (diff | hist) . . (0)‎ . . N File:Spectrum mut7.png ‎ (current)
• 19:26, 9 September 2011 (diff | hist) . . (0)‎ . . N File:Show cell mut7.png ‎ (current)
• 19:26, 9 September 2011 (diff | hist) . . (0)‎ . . N File:Cartoon mut7.png ‎ (current)
• 19:26, 9 September 2011 (diff | hist) . . (0)‎ . . N File:Spectrum mut10.png ‎ (current)
• 19:26, 9 September 2011 (diff | hist) . . (0)‎ . . N File:Show cell mut10.png ‎ (current)
• 19:26, 9 September 2011 (diff | hist) . . (0)‎ . . N File:Cartoon mut10.png ‎ (current)
• 19:25, 9 September 2011 (diff | hist) . . (0)‎ . . N File:Active site mut10.png ‎
• 19:02, 9 September 2011 (diff | hist) . . (+860)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Visualization of results)
• 19:01, 9 September 2011 (diff | hist) . . (+858)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Visualization of results)
• 18:56, 9 September 2011 (diff | hist) . . (+563)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Mutation 10)
• 18:55, 9 September 2011 (diff | hist) . . (+561)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Mutation 7)
• 12:08, 30 August 2011 (diff | hist) . . (+2,977)‎ . . Normal Mode Analysis of Glucocerebrosidase ‎ (→‎Discussion)
• 11:30, 30 August 2011 (diff | hist) . . (+1,051)‎ . . Normal Mode Analysis of Glucocerebrosidase ‎ (→‎Comparison of All-atom NMA to Elastic Network NMA)
• 11:23, 30 August 2011 (diff | hist) . . (+383)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Visualization of results)
• 11:19, 30 August 2011 (diff | hist) . . (+218)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Root mean square deviations again)
• 11:16, 30 August 2011 (diff | hist) . . (+53)‎ . . Sequence based mutation analysis of GBA ‎ (→‎Physicochemical Properties and Changes)
• 11:14, 30 August 2011 (diff | hist) . . (+570)‎ . . Sequence based mutation analysis of GBA ‎ (→‎Physicochemical Properties and Changes)
• 15:21, 23 August 2011 (diff | hist) . . (+111)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Visualization of results)
• 15:19, 23 August 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase md movie.gif ‎ (current)
• 12:06, 23 August 2011 (diff | hist) . . (+623)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Distance RMSD)
• 12:04, 23 August 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase distance-rmsd.png ‎ (current)
• 12:01, 23 August 2011 (diff | hist) . . (+786)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Cluster analysis)
• 11:59, 23 August 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase rmsd-distribution.png ‎ (current)
• 11:55, 23 August 2011 (diff | hist) . . (+441)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Root mean square deviations again)
• 11:53, 23 August 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase rmsd matrix.png ‎ (current)
• 11:48, 23 August 2011 (diff | hist) . . (+674)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Ramachandran (phi/psi) plots)
• 11:40, 23 August 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase ramachandran.png ‎ (current)
• 11:37, 23 August 2011 (diff | hist) . . (-30)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Structural analysis: properties derived from configurations)
• 11:36, 23 August 2011 (diff | hist) . . (+16)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Salt bridges)
• 11:35, 23 August 2011 (diff | hist) . . (+1,276)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Hydrogen bonds)
• 11:35, 23 August 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase hydrogen bonds prot water.png ‎
• 11:35, 23 August 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase hydrogen bonds intra protein.png ‎ (current)
• 11:25, 23 August 2011 (diff | hist) . . (+895)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Solvent accessible surface area)
• 11:17, 23 August 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase solvent accessable surface.png ‎ (current)
• 11:16, 23 August 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase residue sas.png ‎ (current)
• 11:16, 23 August 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase atomic sas.png ‎ (current)
• 11:07, 23 August 2011 (diff | hist) . . (+608)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Convergence of radius of gyration)
• 11:05, 23 August 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase radius gyration.png ‎ (current)
• 10:59, 23 August 2011 (diff | hist) . . (+2,513)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Convergence of RMSD)
• 10:49, 23 August 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase rmsd backbone average.png ‎ (current)
• 10:49, 23 August 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase rmsd backbone.png ‎ (current)
• 10:49, 23 August 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase rmsd average.png ‎ (current)
• 10:49, 23 August 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase rmsd.png ‎ (current)
• 10:39, 23 August 2011 (diff | hist) . . (+1,330)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Root mean square fluctuations)
• 10:33, 23 August 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase rmsf pymol.png ‎ (current)
• 10:33, 23 August 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase rmsf.png ‎ (current)
• 10:15, 23 August 2011 (diff | hist) . . (+129)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Minimum distances between periodic images)
• 10:14, 23 August 2011 (diff | hist) . . (+1,231)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Minimum distances between periodic images)
• 10:06, 23 August 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase minimal periodic distance.png ‎ (current)
• 10:06, 23 August 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase minimal periodic dictance calpha.png ‎ (current)
• 09:59, 23 August 2011 (diff | hist) . . (+328)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Interaction Energy: van der Waals)
• 09:56, 23 August 2011 (diff | hist) . . (+316)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Interaction Energy: Coulomb)
• 09:51, 23 August 2011 (diff | hist) . . (+131)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Box)
• 09:48, 23 August 2011 (diff | hist) . . (+181)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Density)
• 09:46, 23 August 2011 (diff | hist) . . (-15)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Volume)
• 09:46, 23 August 2011 (diff | hist) . . (-15)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Energy)
• 09:46, 23 August 2011 (diff | hist) . . (+214)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Volume)
• 09:43, 23 August 2011 (diff | hist) . . (+219)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Energy)
• 09:39, 23 August 2011 (diff | hist) . . (+286)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Pressure)
• 09:36, 23 August 2011 (diff | hist) . . (+37)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Temperature)
• 09:34, 23 August 2011 (diff | hist) . . (+255)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Temperature)
• 09:32, 23 August 2011 (diff | hist) . . (+491)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Convergence of energy terms)
• 09:27, 23 August 2011 (diff | hist) . . (+919)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Convergence of energy terms)
• 09:26, 23 August 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase coulomb.png ‎
• 09:26, 23 August 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase vdw.png ‎
• 09:22, 23 August 2011 (diff | hist) . . (+2,823)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Quality assurance)
• 09:16, 23 August 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase volume.png ‎ (current)
• 09:16, 23 August 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase temperature.png ‎ (current)
• 09:16, 23 August 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase pressure.png ‎ (current)
• 09:16, 23 August 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase energy.png ‎ (current)
• 09:16, 23 August 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase density.png ‎ (current)
• 09:16, 23 August 2011 (diff | hist) . . (0)‎ . . N File:Glucocerebrosidase box.png ‎ (current)
• 09:05, 23 August 2011 (diff | hist) . . (+715)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎Visualization of results)
• 09:01, 23 August 2011 (diff | hist) . . (0)‎ . . N File:Spectrum.png ‎ (current)
• 09:01, 23 August 2011 (diff | hist) . . (0)‎ . . N File:Show cell.png ‎ (current)
• 09:01, 23 August 2011 (diff | hist) . . (0)‎ . . N File:Active site.png ‎
• 09:01, 23 August 2011 (diff | hist) . . (0)‎ . . N File:Cartoon.png ‎ (current)
• 08:54, 23 August 2011 (diff | hist) . . (+585)‎ . . Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (→‎A brief check of results)
• 08:45, 23 August 2011 (diff | hist) . . (+2,313)‎ . . N Molecular Dynamics Simulations Analysis of Glucocerebrosidase ‎ (Created page with "== Introduction == To analyze our Molecular Dynamics Simulations we followed the tutorial described here: http://md.chem.rug.nl/~mdcourse/analysis1.html == Wildtype == === A b…")
• 08:39, 23 August 2011 (diff | hist) . . (+144)‎ . . Glucocerebrosidase Molecular Dynamics Simulation ‎ (→‎Analysis)
• 08:38, 23 August 2011 (diff | hist) . . (+117)‎ . . User:Brunners ‎ (→‎Tasks) (current)
• 08:38, 23 August 2011 (diff | hist) . . (+117)‎ . . User:Braunt ‎ (→‎Tasks) (current)
• 08:37, 23 August 2011 (diff | hist) . . (+118)‎ . . Gaucher Disease 2011 ‎ (→‎Tasks)
• 09:09, 20 August 2011 (diff | hist) . . (+1,158)‎ . . N User:Brunners ‎ (Created page with "=Person= '''Sabine Brunner''' is a bioinformatics student in her 8th semester (2nd Master semester). =Group= Sabine works together with Tatjana Braun on [[Gauche…")
• 09:29, 19 August 2011 (diff | hist) . . (-36)‎ . . Normal Mode Analysis of Glucocerebrosidase ‎
• 09:28, 19 August 2011 (diff | hist) . . (+3)‎ . . Normal Mode Analysis of Glucocerebrosidase ‎ (→‎Elastic Network NMA)
• 09:28, 19 August 2011 (diff | hist) . . (+4)‎ . . Normal Mode Analysis of Glucocerebrosidase ‎ (→‎1BPT at 2000 K)
• 09:28, 19 August 2011 (diff | hist) . . (+4)‎ . . Normal Mode Analysis of Glucocerebrosidase ‎ (→‎1BPT at 600 K)
• 09:27, 19 August 2011 (diff | hist) . . (-350)‎ . . Supplementary data normal mode glucocerebrosidase ‎ (→‎Anisotropic Network Model) (current)
• 22:23, 18 August 2011 (diff | hist) . . (-1)‎ . . Normal Mode Analysis of Glucocerebrosidase ‎ (→‎NOMAD-Ref)
• 22:22, 18 August 2011 (diff | hist) . . (+1,452)‎ . . Normal Mode Analysis of Glucocerebrosidase ‎ (→‎NOMAD-Ref)
• 11:40, 18 August 2011 (diff | hist) . . (+2,200)‎ . . Normal Mode Analysis of Glucocerebrosidase ‎ (→‎oGNM)
• 11:19, 18 August 2011 (diff | hist) . . (+186)‎ . . Normal Mode Analysis of Glucocerebrosidase ‎ (→‎oGNM)
• 11:15, 18 August 2011 (diff | hist) . . (+114)‎ . . Normal Mode Analysis of Glucocerebrosidase ‎ (→‎Anisotropic Network Model)
• 11:11, 18 August 2011 (diff | hist) . . (+182)‎ . . Normal Mode Analysis of Glucocerebrosidase ‎ (→‎Anisotropic Network Model)
• 11:08, 18 August 2011 (diff | hist) . . (+2,384)‎ . . Normal Mode Analysis of Glucocerebrosidase ‎ (→‎Anisotropic Network Model)
• 10:44, 18 August 2011 (diff | hist) . . (+267)‎ . . Sequence and structure based mutation analysis of GBA ‎ (→‎Introduction)
• 10:31, 18 August 2011 (diff | hist) . . (-10)‎ . . Supplementary data normal mode glucocerebrosidase ‎ (→‎Nomad-Ref)
• 10:27, 18 August 2011 (diff | hist) . . (+319)‎ . . Normal Mode Analysis of Glucocerebrosidase ‎ (→‎Anisotropic Network Model)
• 10:25, 18 August 2011 (diff | hist) . . (-644)‎ . . Supplementary data normal mode glucocerebrosidase ‎ (→‎Anisotropic Network Model)
• 10:25, 18 August 2011 (diff | hist) . . (+643)‎ . . Normal Mode Analysis of Glucocerebrosidase ‎ (→‎Anisotropic Network Model)
• 09:51, 18 August 2011 (diff | hist) . . (+223)‎ . . Glucocerebrosidase sequence alignments ‎ (→‎Gaps in secondary structure elements)
• 09:43, 18 August 2011 (diff | hist) . . (+589)‎ . . Glucocerebrosidase sequence alignments ‎ (→‎Gaps in secondary structure elements)
• 09:39, 18 August 2011 (diff | hist) . . (0)‎ . . N File:T coffee 3d gap02.png ‎ (current)
• 09:38, 18 August 2011 (diff | hist) . . (0)‎ . . N File:T coffee 3d gap01.png ‎ (current)
• 09:27, 18 August 2011 (diff | hist) . . (+11)‎ . . Glucocerebrosidase sequence alignments ‎ (→‎Functionally important residues)
• 09:24, 18 August 2011 (diff | hist) . . (+8,280)‎ . . Glucocerebrosidase disease causing mutations ‎ (current)
• 09:23, 18 August 2011 (diff | hist) . . (+9,030)‎ . . N Glucocerebrosidase disease causing mutations ‎ (Created page with "<code> >sp|P04062|GLCM_HUMAN Glucosylceramidase OS=Homo sapiens GN=GBA PE=1 SV=3<br/> MEFSSPSREECP<span style="color:#ff0000">K</span>PLSRVSIMAGSLTGLLLLQAVS<span style="color:#ff…")
• 09:22, 18 August 2011 (diff | hist) . . (-1)‎ . . Glucocerebrosidase mapping snps ‎ (→‎Positions where mutations occur)
• 09:21, 18 August 2011 (diff | hist) . . (+1,917)‎ . . N Glucocerebrosidase neutral mutations ‎ (Created page with "<code> >sp|P04062|GLCM_HUMAN Glucosylceramidase OS=Homo sapiens GN=GBA PE=1 SV=3<br/> MEFSSPSREECPKPLSRVSIMAGSLTGLLLLQAVSWASGARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSR<span style="c…") (current)
• 09:20, 18 August 2011 (diff | hist) . . (+90)‎ . . Gaucher Disease 2011 ‎ (→‎Disease causing mutations)

(newest | oldest) View (newer 250 | older 250) (20 | 50 | 100 | 250 | 500)