Difference between revisions of "Multiple Sequence Alignment: T-Coffee - set 3"

From Bioinformatikpedia
 
(One intermediate revision by the same user not shown)
Line 1: Line 1:
The native protein is colored red in the Alignment.
+
The native protein is colored red in the Alignment. Different block patterns are colored violet.
   
 
CLUSTAL FORMAT for T-COFFEE Version_8.47 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=73, Nseq=20, Len=824
 
CLUSTAL FORMAT for T-COFFEE Version_8.47 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=73, Nseq=20, Len=824
Line 92: Line 92:
 
 
 
<span style="color:#a30909">P04062 ----------------NHTGTGLLLTLQP-EQKFQKVKGFGGAMTDAAAL</span>
 
<span style="color:#a30909">P04062 ----------------NHTGTGLLLTLQP-EQKFQKVKGFGGAMTDAAAL</span>
tr|B5DYA3|B5DYA3_DROPS W-LNLASI--PQRLFINASVKTV<span style="color:#9725c4">SVSVKR-DQRYQN</span>VTNFGGALTGTVSH
+
tr|B5DYA3|B5DYA3_DROPS W-LNLASI--PQRLFINASVKTVSVSVKR-DQRYQNVTNFGGALTGTVSH
tr|B4JTN5|B4JTN5_DROGR WDQAIDSIFSQSATPASSITRSV<span style="color:#9725c4">TLKLDR-SKRFQK</span>IEGFGGSFTGAVSY
+
tr|B4JTN5|B4JTN5_DROGR WDQAIDSIFSQSATPASSITRSVTLKLDR-SKRFQKIEGFGGSFTGAVSY
tr|F5CB37|F5CB37_PSECS ----------------NRTGTGL<span style="color:#9725c4">LLTLQP-------</span>--------------
+
tr|F5CB37|F5CB37_PSECS ----------------NRTGTGLLLTLQP---------------------
 
tr|E1ZYU8|E1ZYU8_CAMFO ---------------------SK<span style="color:#9725c4">VLTLDS-NKKHQQ</span>IFGFGGAMTDAAAL
 
tr|E1ZYU8|E1ZYU8_CAMFO ---------------------SK<span style="color:#9725c4">VLTLDS-NKKHQQ</span>IFGFGGAMTDAAAL
 
tr|J2STU0|J2STU0_9FLAO --------------FAQPKENEA<span style="color:#9725c4">CIFVDP-DFKYQK</span>LIGIGGAVTDAAAE
 
tr|J2STU0|J2STU0_9FLAO --------------FAQPKENEA<span style="color:#9725c4">CIFVDP-DFKYQK</span>LIGIGGAVTDAAAE
Line 108: Line 108:
 
pdb|pdb|1y7v_A ----------------NHTGTGL<span style="color:#9725c4">LLTLQP-EQKFQK</span>VKGFGGAMTDAAAL
 
pdb|pdb|1y7v_A ----------------NHTGTGL<span style="color:#9725c4">LLTLQP-EQKFQK</span>VKGFGGAMTDAAAL
 
tr|D4SV88|D4SV88_9XANT --------------GHALTEKEN<span style="color:#9725c4">SIFVNP-QRQFQQ</span>VLGIGGAITDSSAE
 
tr|D4SV88|D4SV88_9XANT --------------GHALTEKEN<span style="color:#9725c4">SIFVNP-QRQFQQ</span>VLGIGGAITDSSAE
tr|A9UD58|A9UD58_INIGE ----------------NRTG---<span style="color:#9725c4">-------------</span>--------------
+
tr|A9UD58|A9UD58_INIGE ----------------NRTG------------------------------
tr|A9UD54|A9UD54_PHOPH ----------------NRTGTGL<span style="color:#9725c4">LLTLQP-------</span>--------------
+
tr|A9UD54|A9UD54_PHOPH ----------------NRTGTGLLLTLQP---------------------
tr|G9MUP6|G9MUP6_HYPVG --------------LTVPTTSAT<span style="color:#9725c4">SIKINT-NSKLQR</span>IDGFGFSQAFGRAS
+
tr|G9MUP6|G9MUP6_HYPVG --------------LTVPTTSATSIKINT-NSKLQRIDGFGFSQAFGRAS
 
 
 
 
<span style="color:#a30909">P04062 NILALSP-PAQNLLLKSYFS-EEGIGYNIIRVPMASCD-FSIRT-YTYAD</span>
+
<span style="color:#a30909">P04062 NILALSP-PAQNLLLKSYFS-<span style="color:#9725c4">EEGIGYNIIRVPMASCD</span>-FSIRT-YTYAD</span>
tr|B5DYA3|B5DYA3_DROPS LLQLLPT-ELQDHVYKSYYH-DDGIAYNSIRTSIGGCD-FDLEP-WAYNE
+
tr|B5DYA3|B5DYA3_DROPS LLQLLPT-ELQDHVYKSYYH-<span style="color:#9725c4">DDGIAYNSIRTSIGGCD</span>-FDLEP-WAYNE
tr|B4JTN5|B4JTN5_DROGR LLNNFKEQDIQDHLYKSYYA-ADGLGFNLLRISIGGCD-FDLNP-WAYNE
+
tr|B4JTN5|B4JTN5_DROGR LLNNFKEQDIQDHLYKSYYA-<span style="color:#9725c4">ADGLGFNLLRISIGGCD</span>-FDLNP-WAYNE
tr|F5CB37|F5CB37_PSECS --------------------------------------------------
+
tr|F5CB37|F5CB37_PSECS ---------------------<span style="color:#9725c4">-----------------</span>------------
tr|E1ZYU8|E1ZYU8_CAMFO NIRTLSN-ETQRQLLESYFG-STGIGYTFSRIPIAGTD-FSTRP-YTYDD
+
tr|E1ZYU8|E1ZYU8_CAMFO NIRTLSN-ETQRQLLESYFG-<span style="color:#9725c4">STGIGYTFSRIPIAGTD</span>-FSTRP-YTYDD
tr|J2STU0|J2STU0_9FLAO TFYKLPK-AKQKEIIDAYYG-KNGLGYTIVRTNMNSCD-FSSDS-YTYVE
+
tr|J2STU0|J2STU0_9FLAO TFYKLPK-AKQKEIIDAYYG-<span style="color:#9725c4">KNGLGYTIVRTNMNSCD</span>-FSSDS-YTYVE
tr|F4E6W5|F4E6W5_BACAM NLSKMSP-GKRKEVLKKLVDPNEGIGMDVMRITIGTSD-FTAQEFYTYDD
+
tr|F4E6W5|F4E6W5_BACAM NLSKMSP-GKRKEVLKKLVDP<span style="color:#9725c4">NEGIGMDVMRITIGTSD</span>-FTAQEFYTYDD
tr|G9BHQ3|G9BHQ3_BALAC --------------------------------------------------
+
tr|G9BHQ3|G9BHQ3_BALAC ---------------------<span style="color:#9725c4">-----------------</span>------------
tr|F4X220|F4X220_ACREC NIKSLSN-NTQQILLESYFG-SKGIGYTFTRIPIAGTD-FSMRP-YTYDD
+
tr|F4X220|F4X220_ACREC NIKSLSN-NTQQILLESYFG-<span style="color:#9725c4">SKGIGYTFTRIPIAGTD</span>-FSMRP-YTYDD
pdb|pdb|2nsx_B NILALSP-PAQNLLLKSYFS-EEGIGYNIIRVPMASCD-FSIRT-YTYAD
+
pdb|pdb|2nsx_B NILALSP-PAQNLLLKSYFS-<span style="color:#9725c4">EEGIGYNIIRVPMASCD</span>-FSIRT-YTYAD
tr|E5UPZ0|E5UPZ0_9BACE LY---AHR-KRQEIMDVMFG-QDGLRLSILRGEVFP-HY-DETT-FNMDE
+
tr|E5UPZ0|E5UPZ0_9BACE LY---AHR-KRQEIMDVMFG-<span style="color:#9725c4">QDGLRLSILRGEVFP-H</span>Y-DETT-FNMDE
tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------
+
tr|G9BHQ5|G9BHQ5_SOUCH ---------------------<span style="color:#9725c4">-----------------</span>------------
tr|C6A5Q0|C6A5Q0_BIFLB LLSKMDS-ATRKEALAQWFG-PAGMDAWFVRVHIDSCD-YSLSE-YQAVE
+
tr|C6A5Q0|C6A5Q0_BIFLB LLSKMDS-ATRKEALAQWFG-<span style="color:#9725c4">PAGMDAWFVRVHIDSCD</span>-YSLSE-YQAVE
tr|D0TIX6|D0TIX6_9BACE NLMRMAP-EDRTAFLKETFSDTEGMGYSYIRISIGCSD-FSLSE-YTCCD
+
tr|D0TIX6|D0TIX6_9BACE NLMRMAP-EDRTAFLKETFSD<span style="color:#9725c4">TEGMGYSYIRISIGCSD</span>-FSLSE-YTCCD
tr|B1QKT0|B1QKT0_CLOBO ALNHLDK-DERNKVLDQLFSIKGDCRFNLCRMPIGASD-YATEW-YSYNE
+
tr|B1QKT0|B1QKT0_CLOBO ALNHLDK-DERNKVLDQLFSI<span style="color:#9725c4">KGDCRFNLCRMPIGASD</span>-YATEW-YSYNE
pdb|pdb|1y7v_A NILALSP-PAQNLLLKSYFS-EEGIGYNIIRVPMASCD-FSIRT-YTYAD
+
pdb|pdb|1y7v_A NILALSP-PAQNLLLKSYFS-<span style="color:#9725c4">EEGIGYNIIRVPMASCD</span>-FSIRT-YTYAD
tr|D4SV88|D4SV88_9XANT TFAKLPK-RAQRALLTAYYDPQQGIGYTLARTTIHSSD-FSSGS-YTYIK
+
tr|D4SV88|D4SV88_9XANT TFAKLPK-RAQRALLTAYYDP<span style="color:#9725c4">QQGIGYTLARTTIHSSD</span>-FSSGS-YTYIK
tr|A9UD58|A9UD58_INIGE --------------------------------------------------
+
tr|A9UD58|A9UD58_INIGE ---------------------<span style="color:#9725c4">-----------------</span>------------
tr|A9UD54|A9UD54_PHOPH --------------------------------------------------
+
tr|A9UD54|A9UD54_PHOPH ---------------------<span style="color:#9725c4">-----------------</span>------------
tr|G9MUP6|G9MUP6_HYPVG QFQAAEP-EMRKKALDLLFDTKTGAGFSIIRNWIPSTTALSIEP-NSPGL
+
tr|G9MUP6|G9MUP6_HYPVG QFQAAEP-EMRKKALDLLFDT<span style="color:#9725c4">KTGAGFSIIRNWIPSTT</span>ALSIEP-NSPGL
 
 
 
 

Latest revision as of 17:02, 6 May 2013

The native protein is colored red in the Alignment. Different block patterns are colored violet.

CLUSTAL FORMAT for T-COFFEE Version_8.47 [1] [MODE:  ], CPU=0.00 sec, SCORE=73, Nseq=20, Len=824 

P04062                  MEFSSPSREECPKPLSRVSIMAGSLTGLLLLQAV-SWA------------
tr|B5DYA3|B5DYA3_DROPS  MKEIW--------------LC--FLFAVAAISAQPGGT------------
tr|B4JTN5|B4JTN5_DROGR  MLKRKS-------------IG--LLGAFVLLIAIIGGQ------------
tr|F5CB37|F5CB37_PSECS  --------------------------------------------------
tr|E1ZYU8|E1ZYU8_CAMFO  M-------------------------------------------------
tr|J2STU0|J2STU0_9FLAO  MKKII--------------VS--CFF----I-SV-AGN------------
tr|F4E6W5|F4E6W5_BACAM  MFFKKG-------------LY--MTLAFLLLSFLLSGS------------
tr|G9BHQ3|G9BHQ3_BALAC  --------------------------------------------------
tr|F4X220|F4X220_ACREC  MATPNE-------------LQ--TR-NFDSLLVIPSAARNNMFSLEERFE
pdb|pdb|2nsx_B          AR------------------------------------------------
tr|E5UPZ0|E5UPZ0_9BACE  MKKLS--------------YL--FAV--AAS-------------------
tr|G9BHQ5|G9BHQ5_SOUCH  --------------------------------------------------
tr|C6A5Q0|C6A5Q0_BIFLB  MMKAL---------------------------------------------
tr|D0TIX6|D0TIX6_9BACE  MVLFSL------------------LMVLICLNAC-SGA------------
tr|B1QKT0|B1QKT0_CLOBO  MKFIQ---------------------------------------------
pdb|pdb|1y7v_A          AR------------------------------------------------
tr|D4SV88|D4SV88_9XANT  MRAST--------------AA--A--------P-----------------
tr|A9UD58|A9UD58_INIGE  --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH  --------------------------------------------------
tr|G9MUP6|G9MUP6_HYPVG  MKAFA--------------LA--AVG----L-------------------
                                                                          

P04062                  ------------SG---------------------------ARPCIPKSF
tr|B5DYA3|B5DYA3_DROPS  ------------AST--------------------------QLPCDLRET
tr|B4JTN5|B4JTN5_DROGR  ------------AK---------------------------TVPCKLKDV
tr|F5CB37|F5CB37_PSECS  --------------------------------------------------
tr|E1ZYU8|E1ZYU8_CAMFO  --------------------------------------------------
tr|J2STU0|J2STU0_9FLAO  ------------AN---------------------------AQNYWKKNA
tr|F4E6W5|F4E6W5_BACAM  ------------MET--------------------------EV-------
tr|G9BHQ3|G9BHQ3_BALAC  --------------------------------------------------
tr|F4X220|F4X220_ACREC  ILKTYFQSQCCVAETVRILKRNMGRDRAPTEGAIRKLVRKVRDECIPRSF
pdb|pdb|2nsx_B          -------------------------------------------PCIPKSF
tr|E5UPZ0|E5UPZ0_9BACE  --------------------------------------------------
tr|G9BHQ5|G9BHQ5_SOUCH  --------------------------------------------------
tr|C6A5Q0|C6A5Q0_BIFLB  --------------------------------------------------
tr|D0TIX6|D0TIX6_9BACE  --------------------------------------------------
tr|B1QKT0|B1QKT0_CLOBO  --------------------------------------------------
pdb|pdb|1y7v_A          -------------------------------------------PCIPKSF
tr|D4SV88|D4SV88_9XANT  --------------------------------------------------
tr|A9UD58|A9UD58_INIGE  --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH  --------------------------------------------------
tr|G9MUP6|G9MUP6_HYPVG  --------------------------------------------------
                                                                          

P04062                  GYSSVVCVCNATYC-DSFDPPTFPALGTFSRYESTRS---G---------
tr|B5DYA3|B5DYA3_DROPS  PHG-SVCVCNSTYC-DYLEQPELNEGSRIVVISSSKD---G---------
tr|B4JTN5|B4JTN5_DROGR  KYG-KVCVCTADYC-DYLDNPTLSKDDDFAIISSSKQ---G---------
tr|F5CB37|F5CB37_PSECS  --------CNATYC-DSLDPLTLPDPGTFSRFESTRS---G---------
tr|E1ZYU8|E1ZYU8_CAMFO  --------------------------------------------------
tr|J2STU0|J2STU0_9FLAO  GKTARVILTNSTTN-EK-----LADKGTV-KF------------------
tr|F4E6W5|F4E6W5_BACAM  ---------YATDR-KAP-----DKNKVRVWYSSEKD---PASRTWYDGP
tr|G9BHQ3|G9BHQ3_BALAC  -------------C-DSLDPLALPDPGTFSRFESTRS---G---------
tr|F4X220|F4X220_ACREC  GNNSIVCVCNSTYC-DTVSKQKLQQ-NQLLWYTSTQD---G---------
pdb|pdb|2nsx_B          GYSSVVCVCNATYC-DSFDPPTFPALGTFSRYESTRS---G---------
tr|E5UPZ0|E5UPZ0_9BACE  ----AACLCACTDVTDVLPAEQI---------------------------
tr|G9BHQ5|G9BHQ5_SOUCH  -------------C-DSLDPLTLPDPGTFSRFESTRS---G---------
tr|C6A5Q0|C6A5Q0_BIFLB  --------------------------KTTVHYDVTAGRTHT---------
tr|D0TIX6|D0TIX6_9BACE  ---------------KTS-------DNVTV-YVTTND---R--------A
tr|B1QKT0|B1QKT0_CLOBO  -------------------------------YKTTKK---D---------
pdb|pdb|1y7v_A          GYSSVVCVCNATYC-DSFDPPTFPALGTFSRYESTRS---G---------
tr|D4SV88|D4SV88_9XANT  -----V--------------------------------------------
tr|A9UD58|A9UD58_INIGE  --------CNATYC-DSLDPLTLPDPGTFSRFESTRS---G---------
tr|A9UD54|A9UD54_PHOPH  --------CNATYC-DSLDPLTLPDPGTFSRFESTRS---G---------
tr|G9MUP6|G9MUP6_HYPVG  -----V--------------------------------------------
                                                                          

P04062                  --------RRMELSMGP--IQA----------------------------
tr|B5DYA3|B5DYA3_DROPS  --------LRFKVTTGD--LSNKAPLVVEDKQSTDENFHAEAIVVDQHRA
tr|B4JTN5|B4JTN5_DROGR  --------LRFELNTGS--FGSKDTYAIEDYVEPASKFAASNDTILSK-L
tr|F5CB37|F5CB37_PSECS  --------RRMELSLGT--IQA----------------------------
tr|E1ZYU8|E1ZYU8_CAMFO  --------------------------------------------------
tr|J2STU0|J2STU0_9FLAO  ---------------E----K-----------------------------
tr|F4E6W5|F4E6W5_BACAM  KEVKYALDEQTPLTL-----------------------------------
tr|G9BHQ3|G9BHQ3_BALAC  --------RRMELSLGT--IQA----------------------------
tr|F4X220|F4X220_ACREC  --------KRMQSSIMN--FSAK---------------------------
pdb|pdb|2nsx_B          --------RRMELSMGP--IQA----------------------------
tr|E5UPZ0|E5UPZ0_9BACE  ------------------P-------------------------------
tr|G9BHQ5|G9BHQ5_SOUCH  --------RRMELSLGT--IQA----------------------------
tr|C6A5Q0|C6A5Q0_BIFLB  --------EQTELSVMDEAMNT----------------------------
tr|D0TIX6|D0TIX6_9BACE  K--DF---VRSEIAL-----------------------------------
tr|B1QKT0|B1QKT0_CLOBO  ---KF-----LKNEI-----------------------------------
pdb|pdb|1y7v_A          --------RRMELSMGP--IQA----------------------------
tr|D4SV88|D4SV88_9XANT  --------------------V-----------------------------
tr|A9UD58|A9UD58_INIGE  --------RRMELSLGT--IQA----------------------------
tr|A9UD54|A9UD54_PHOPH  --------RRMELSLGT--IQA----------------------------
tr|G9MUP6|G9MUP6_HYPVG  --------------------A-----------------------------
                                                                          

P04062                  ----------------NHTGTGLLLTLQP-EQKFQKVKGFGGAMTDAAAL
tr|B5DYA3|B5DYA3_DROPS  W-LNLASI--PQRLFINASVKTVSVSVKR-DQRYQNVTNFGGALTGTVSH
tr|B4JTN5|B4JTN5_DROGR  WDQAIDSIFSQSATPASSITRSVTLKLDR-SKRFQKIEGFGGSFTGAVSY
tr|F5CB37|F5CB37_PSECS  ----------------NRTGTGLLLTLQP---------------------
tr|E1ZYU8|E1ZYU8_CAMFO  ---------------------SKVLTLDS-NKKHQQIFGFGGAMTDAAAL
tr|J2STU0|J2STU0_9FLAO  --------------FAQPKENEACIFVDP-DFKYQKLIGIGGAVTDAAAE
tr|F4E6W5|F4E6W5_BACAM  --------------TKKKASDSTAVYIDP-SHRYQSVLGIGSSLEESTIS
tr|G9BHQ3|G9BHQ3_BALAC  ----------------NRTGTGLLLTLQP-DQKFQK--------------
tr|F4X220|F4X220_ACREC  ----------------NESEIDLVLTVDI-NQKFQKIQGFGGAMTDAAAL
pdb|pdb|2nsx_B          ----------------NHTGTGLLLTLQP-EQKFQKVKGFGGAMTDAAAL
tr|E5UPZ0|E5UPZ0_9BACE  --------------ADARSTLGADVVLQW-NNEEQTIDGFGVAQAGWSDY
tr|G9BHQ5|G9BHQ5_SOUCH  ----------------NRTGTGLLLTLQP-DQKFQK--------------
tr|C6A5Q0|C6A5Q0_BIFLB  ----------------EHIVESNVVGIYP-DYTFQMMEGYGCSLTESACY
tr|D0TIX6|D0TIX6_9BACE  --------------GDKQAASPSVITIDP-SVRYQTMDGFGAAVTGSTCY
tr|B1QKT0|B1QKT0_CLOBO  ----------------NNTTDE-RPTLHVSQIENRIIEGFGSCFNELGMK
pdb|pdb|1y7v_A          ----------------NHTGTGLLLTLQP-EQKFQKVKGFGGAMTDAAAL
tr|D4SV88|D4SV88_9XANT  --------------GHALTEKENSIFVNP-QRQFQQVLGIGGAITDSSAE
tr|A9UD58|A9UD58_INIGE  ----------------NRTG------------------------------
tr|A9UD54|A9UD54_PHOPH  ----------------NRTGTGLLLTLQP---------------------
tr|G9MUP6|G9MUP6_HYPVG  --------------LTVPTTSATSIKINT-NSKLQRIDGFGFSQAFGRAS
                                                                          

P04062                  NILALSP-PAQNLLLKSYFS-EEGIGYNIIRVPMASCD-FSIRT-YTYAD
tr|B5DYA3|B5DYA3_DROPS  LLQLLPT-ELQDHVYKSYYH-DDGIAYNSIRTSIGGCD-FDLEP-WAYNE
tr|B4JTN5|B4JTN5_DROGR  LLNNFKEQDIQDHLYKSYYA-ADGLGFNLLRISIGGCD-FDLNP-WAYNE
tr|F5CB37|F5CB37_PSECS  --------------------------------------------------
tr|E1ZYU8|E1ZYU8_CAMFO  NIRTLSN-ETQRQLLESYFG-STGIGYTFSRIPIAGTD-FSTRP-YTYDD
tr|J2STU0|J2STU0_9FLAO  TFYKLPK-AKQKEIIDAYYG-KNGLGYTIVRTNMNSCD-FSSDS-YTYVE
tr|F4E6W5|F4E6W5_BACAM  NLSKMSP-GKRKEVLKKLVDPNEGIGMDVMRITIGTSD-FTAQEFYTYDD
tr|G9BHQ3|G9BHQ3_BALAC  --------------------------------------------------
tr|F4X220|F4X220_ACREC  NIKSLSN-NTQQILLESYFG-SKGIGYTFTRIPIAGTD-FSMRP-YTYDD
pdb|pdb|2nsx_B          NILALSP-PAQNLLLKSYFS-EEGIGYNIIRVPMASCD-FSIRT-YTYAD
tr|E5UPZ0|E5UPZ0_9BACE  LY---AHR-KRQEIMDVMFG-QDGLRLSILRGEVFP-HY-DETT-FNMDE
tr|G9BHQ5|G9BHQ5_SOUCH  --------------------------------------------------
tr|C6A5Q0|C6A5Q0_BIFLB  LLSKMDS-ATRKEALAQWFG-PAGMDAWFVRVHIDSCD-YSLSE-YQAVE
tr|D0TIX6|D0TIX6_9BACE  NLMRMAP-EDRTAFLKETFSDTEGMGYSYIRISIGCSD-FSLSE-YTCCD
tr|B1QKT0|B1QKT0_CLOBO  ALNHLDK-DERNKVLDQLFSIKGDCRFNLCRMPIGASD-YATEW-YSYNE
pdb|pdb|1y7v_A          NILALSP-PAQNLLLKSYFS-EEGIGYNIIRVPMASCD-FSIRT-YTYAD
tr|D4SV88|D4SV88_9XANT  TFAKLPK-RAQRALLTAYYDPQQGIGYTLARTTIHSSD-FSSGS-YTYIK
tr|A9UD58|A9UD58_INIGE  --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH  --------------------------------------------------
tr|G9MUP6|G9MUP6_HYPVG  QFQAAEP-EMRKKALDLLFDTKTGAGFSIIRNWIPSTTALSIEP-NSPGL
                                                                          

P04062                  TP---DDFQLHN----FSLPE-ED----------TKLKI-PLIHRALQLA
tr|B5DYA3|B5DYA3_DROPS  LPR--NDVALSN----FTELD-PR----------DLQKI-EQLKRLKSVA
tr|B4JTN5|B4JTN5_DROGR  EPQ--NEVVLTG----MDKLH-ER----------DVLRV-GQIKRMKEVS
tr|F5CB37|F5CB37_PSECS  --------------------------------------------------
tr|E1ZYU8|E1ZYU8_CAMFO  VP---NDFTLSN----FSLVG-ED-----------DYKI-EYLHRIKNIM
tr|J2STU0|J2STU0_9FLAO  D----NDTSLKS----FSLAH--D----------EKYKI-PMIKEAQKSI
tr|F4E6W5|F4E6W5_BACAM  MPEGRKDPKLRH----FSIQK-D-----------IDLHITATIKEALAI-
tr|G9BHQ3|G9BHQ3_BALAC  --------------------------------------------------
tr|F4X220|F4X220_ACREC  VP---DDLMLSH----FGLVE-ED-----------DYKI-KYLHNIKKIM
pdb|pdb|2nsx_B          TP---DDFQLHN----FSLPE-ED----------TKLKI-PLIHRALQLA
tr|E5UPZ0|E5UPZ0_9BACE  ------DINLSLDDPFFDIDFNRDENRVAEGIAQRNGQL-WIMKKAKQ--
tr|G9BHQ5|G9BHQ5_SOUCH  --------------------------------------------------
tr|C6A5Q0|C6A5Q0_BIFLB  DPL--ADPELET----FSIDR--D----------RQYIL-PVLKEAMAMA
tr|D0TIX6|D0TIX6_9BACE  TK------GVEN----FALQS-EE----------KEYVI-PILKEILAI-
tr|B1QKT0|B1QKT0_CLOBO  NE---NDFDMEK----FSIQK-D-----------KRLLI-PYIKEALKR-
pdb|pdb|1y7v_A          TP---DDFQLHN----FSLPE-ED----------TKLKI-PLIHRALQLA
tr|D4SV88|D4SV88_9XANT  E----GDAALKS----FSVKH--D----------AKYRI-PMLRQAIAAA
tr|A9UD58|A9UD58_INIGE  --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH  --------------------------------------------------
tr|G9MUP6|G9MUP6_HYPVG  A----S--NKPN----YTWDG--D----------DEGQI-WFTKQAVSY-
                                                                          

P04062                  Q--RPVSLLASPWTSPTWLKTNGAVNG-----------------------
tr|B5DYA3|B5DYA3_DROPS  R-MEELKIMAAAWSAPPWMKTNDRWTG-----------------------
tr|B4JTN5|B4JTN5_DROGR  G-ETNLRIKGAAWSPPKWMKTNNEWTG-----------------------
tr|F5CB37|F5CB37_PSECS  --------------------------------------------------
tr|E1ZYU8|E1ZYU8_CAMFO  SDPETLRIFTTSWSAPAWMKNTNNIK------------------------
tr|J2STU0|J2STU0_9FLAO  G--SSFKLYFSPWSPPAWMKSNKDMLK-----------------------
tr|F4E6W5|F4E6W5_BACAM  --NPKLKIIASPWSPPAWMKTNEN-------------------------L
tr|G9BHQ3|G9BHQ3_BALAC  --------------------------------------------------
tr|F4X220|F4X220_ACREC  SNPDEFRILTTAWSAPAWMKSSKSIT------------------------
pdb|pdb|2nsx_B          Q--RPVSLLASPWTSPTWLKTNGAVNG-----------------------
tr|E5UPZ0|E5UPZ0_9BACE  -EYGVDKLIFSVWSAPAYMKSNGSTS------------------------
tr|G9BHQ5|G9BHQ5_SOUCH  --------------------------------------------------
tr|C6A5Q0|C6A5Q0_BIFLB  G--HPIHVLLSPWSPPAQWKTPPEMTR-NDASVYGGEEGDVIDLSKPGRC
tr|D0TIX6|D0TIX6_9BACE  --SPSIKILGSPWTCPRWMKVDNLKDLRPF-----------------ESW
tr|B1QKT0|B1QKT0_CLOBO  --NPNIILTASPWSPPTWMKTQKA-------------------------Y
pdb|pdb|1y7v_A          Q--RPVSLLASPWTSPTWLKTNGAVNG-----------------------
tr|D4SV88|D4SV88_9XANT  G--GTLTTFASPWSAPAFMKDSKTMLK-----------------------
tr|A9UD58|A9UD58_INIGE  --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH  --------------------------------------------------
tr|G9MUP6|G9MUP6_HYPVG  ---GVKTIYADAWSAPGYMKTNGDEAT-----------------------
                                                                          

P04062                  -KGSLKGQ-----PGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPS
tr|B5DYA3|B5DYA3_DROPS  -FGQLK---------SEYYQTWALYHLKFLELMQSKNMPIWAISTGNEPL
tr|B4JTN5|B4JTN5_DROGR  -FGQLK---------REYYQTWANYHLKWLDLMESNGLPIWAISTGNEPL
tr|F5CB37|F5CB37_PSECS  --------------------------------------------------
tr|E1ZYU8|E1ZYU8_CAMFO  -WGALN---------PEYYQLYADYIKKFFDAYKERGINIWGMTPGNEPI
tr|J2STU0|J2STU0_9FLAO  -GGRLE---------NQYYQTWANYYIKFIQEYEKQGLNIWGLTVQNEPM
tr|F4E6W5|F4E6W5_BACAM  KRGKLK---------DKYISELAVYFRKFIEAYEKQGIPIYAMTLQNEPL
tr|G9BHQ3|G9BHQ3_BALAC  --------------------------------------------------
tr|F4X220|F4X220_ACREC  -WGILK---------SEYYQLYADYIVKFFDAYKERGINIWGITPGNEPL
pdb|pdb|2nsx_B          -KGSLKGQ-----PGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPS
tr|E5UPZ0|E5UPZ0_9BACE  -QGFLK---------RGSYQAFADYLSNFCDAYTAAGLPVYAISPANEPE
tr|G9BHQ5|G9BHQ5_SOUCH  --------------------------------------------------
tr|C6A5Q0|C6A5Q0_BIFLB  FGGRLK---------PEYYSSWARYLVRFISAYMAEGVPVTMLSIQNEAA
tr|D0TIX6|D0TIX6_9BACE  TSGQLN---------PAYYQDYATYFVKWIQAMEAEGIPIEAITPQNEPL
tr|B1QKT0|B1QKT0_CLOBO  NFGTLRF-------EEKVLKVYSLYFVKFVQAYEEEGITIHQVYVQNEVV
pdb|pdb|1y7v_A          -KGSLKGQ-----PGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPS
tr|D4SV88|D4SV88_9XANT  -GGKLL---------PEYAQAWATYYTRFIAAYEKAGIPIWGISLQNEPM
tr|A9UD58|A9UD58_INIGE  --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH  --------------------------------------------------
tr|G9MUP6|G9MUP6_HYPVG  -PGYLCGSTGHTCSTGDWRQAFANYLVQYVKFYKQEGLDITHLGFLNEPD
                                                                          

P04062                  AGLLS--GYPFQCLGFTPEHQ--RDFIARDLGPTLANSTHHN-VRLLML-
tr|B5DYA3|B5DYA3_DROPS  NGVIGFFFVHFMSMGWTPWQQ--AIWLSDHLGPTIRNSTQKP-VLIFGN-
tr|B4JTN5|B4JTN5_DROGR  NGIFFMFFVKFMSLGWTPQMQ--AVWLNDYLGPTIRNSKHKD-IIIFGN-
tr|F5CB37|F5CB37_PSECS  --------------------------------------------------
tr|E1ZYU8|E1ZYU8_CAMFO  DGLVP--FFPFNSMMWLPREG--ADWVVNHLAPTLSKAGYKD-LIYMAM-
tr|J2STU0|J2STU0_9FLAO  ATQ------TWESCLYTAEEE--GNFLKNNLGPTLWKNGYKD-KKIMIW-
tr|F4E6W5|F4E6W5_BACAM  LEI------DYPSMYMPPSQQ--RK-LAQALKKEMKKHLID-T-KIWIY-
tr|G9BHQ3|G9BHQ3_BALAC  --------------------------------------------------
tr|F4X220|F4X220_ACREC  NGFIP--FFTFNSMGWTPNTS--AVWTVKHLAPTLTNAGYNP-LY-IAM-
pdb|pdb|2nsx_B          AGLLS--GYPFQCLGFTPEHQ--RDFIARDLGPTLANSTHHN-VRLLML-
tr|E5UPZ0|E5UPZ0_9BACE  YAA------SWNSCLWLPGTTTLGPFIVNNLGPKLRQTHP-E-TRIIFG-
tr|G9BHQ5|G9BHQ5_SOUCH  --------------------------------------------------
tr|C6A5Q0|C6A5Q0_BIFLB  AAT------SWDSCLWTGDQE--REFLKHHLYPAMEEAGLTDAVKIFIW-
tr|D0TIX6|D0TIX6_9BACE  NRG------NSASLFMGWEEQ--LSFVRDALGPKLKETGLK-T-KIYAFD
tr|B1QKT0|B1QKT0_CLOBO  ADQ------KFPSCRWTGDQL--RDFIKNYLGLAFEKHNIS-S-EIWLGT
pdb|pdb|1y7v_A          AGLLS--GYPFQCLGFTPEHQ--RDFIARDLGPTLANSTHHN-VRLLML-
tr|D4SV88|D4SV88_9XANT  AVQ------TWESMLFSAEEE--RDFLKHHLGPTMASAGYGE-RKIIVW-
tr|A9UD58|A9UD58_INIGE  --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH  --------------------------------------------------
tr|G9MUP6|G9MUP6_HYPVG  YIA------SYSQMQISPSAQEAISFI-PTLYETVKRE-HLD-LRLTCC-
                                                                          

P04062                  -----------DDQRLLLP--------HWAKV-VLTDPEAAKYVHGIAVH
tr|B5DYA3|B5DYA3_DROPS  -----------DDQRYTFP--------SWFRKMRSSRSNSLSYLDGLAVH
tr|B4JTN5|B4JTN5_DROGR  -----------DDQRFTSP--------LWFKMMNRTRPNSVDYIDGVALH
tr|F5CB37|F5CB37_PSECS  --------------------------------------------------
tr|E1ZYU8|E1ZYU8_CAMFO  -----------DDQRMLLP--------WYVET-MFTNQKAKEVFSGTAIH
tr|J2STU0|J2STU0_9FLAO  -----------DHNRDLMF--------QRATT-TLSDPETSKYASGIGYH
tr|F4E6W5|F4E6W5_BACAM  -----------DHNASGAW--------NYIPP-ILDDKKGNQAADGIAFH
tr|G9BHQ3|G9BHQ3_BALAC  --------------------------------------------------
tr|F4X220|F4X220_ACREC  -----------DDQRFEIP--------WFTEL-MFEYPKTKELFSGTAVH
pdb|pdb|2nsx_B          -----------DDQRLLLP--------HWAKV-VLTDPEAAKYVHGIAVH
tr|E5UPZ0|E5UPZ0_9BACE  -----------ENAQWSAILGFIMGSKNYVRDILNLNPKITNFPVIAAGH
tr|G9BHQ5|G9BHQ5_SOUCH  --------------------------------------------------
tr|C6A5Q0|C6A5Q0_BIFLB  -----------DHNKERAI--------EHIDE-FMSDPEAAKEVGGFAYH
tr|D0TIX6|D0TIX6_9BACE  HNYN--Y-----DNMLEQQ--------GYPMK-IYEDENAASFLTGAAYH
tr|B1QKT0|B1QKT0_CLOBO  INAPEPYVEWLEDYTQDFD--------VYAGL-VLRDPKAYKYVKGVGYQ
pdb|pdb|1y7v_A          -----------DDQRLLLP--------HWAKV-VLTDPEAAKYVHGIAVH
tr|D4SV88|D4SV88_9XANT  -----------DHNRDMMV--------HRAHV-IFDDPEAAKYAWGMGFH
tr|A9UD58|A9UD58_INIGE  --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH  --------------------------------------------------
tr|G9MUP6|G9MUP6_HYPVG  -----------DATGW------------------DTQANYTNYLMAAGMQ
                                                                          

P04062                  WYLDFLAPAK--ATLGETHRLFPN--TMLFASEACVGSKF----------
tr|B5DYA3|B5DYA3_DROPS  WYWDELVG-P--QLIDQAHAEMPN--MLLLNTESCIGDKPWQ--------
tr|B4JTN5|B4JTN5_DROGR  WYWDEIFG-N--SFIHKTNKYMEN--KIQIISESCIGDKPWQ--------
tr|F5CB37|F5CB37_PSECS  --------------------------------------------------
tr|E1ZYU8|E1ZYU8_CAMFO  WYADKQFS-P--DRLTRTHNKYPN--KFMLITEACTGTFPTN--------
tr|J2STU0|J2STU0_9FLAO  WYEVWHNKTQLFDNVIETYRAFPD--KFLAFTEGCKEV------------
tr|F4E6W5|F4E6W5_BACAM  DYDGDL------SVMSEIGRRYPD--KSIHLTERSVWG------------
tr|G9BHQ3|G9BHQ3_BALAC  --------------------------------------------------
tr|F4X220|F4X220_ACREC  WYADEIFS-P--IRLSQLHDKYPD--KFILMSEACTGSSPFN--------
pdb|pdb|2nsx_B          WYLDFLAPAK--ATLGETHRLFPN--TMLFASEACVGSKF----------
tr|E5UPZ0|E5UPZ0_9BACE  GYVDPVTG-K--DPAIEPFSKAESKGIPVWLTEISDPTE-----------
tr|G9BHQ5|G9BHQ5_SOUCH  --------------------------------------------------
tr|C6A5Q0|C6A5Q0_BIFLB  WYSGDHF-----EALSMLRGKYPD--KVLMHSESCGLHIPGKVTMLDMTD
tr|D0TIX6|D0TIX6_9BACE  NYGGDR------EELNNVNGKFPD--KELIFTETSIGM------------
tr|B1QKT0|B1QKT0_CLOBO  WAGK--------NAIQRSVEAFPE--KRFIQTENECGN------------
pdb|pdb|1y7v_A          WYLDFLAPAK--ATLGETHRLFPN--TMLFASEACVGSKF----------
tr|D4SV88|D4SV88_9XANT  WYETWAGFEPMVENVAAVAQAYPD--KHLLLTEAAVEK------------
tr|A9UD58|A9UD58_INIGE  --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH  --------------------------------------------------
tr|G9MUP6|G9MUP6_HYPVG  KYLDIISS--HMYSSDATFPLKTN--LPTWLTEAGVETSS----------
                                                                          

P04062                  --------------WE-QSVRLGSWDRGMQYSHSIITNL--------LYH
tr|B5DYA3|B5DYA3_DROPS  ----------------THGPELGSWQRGENYMRAYIQDF--------QHN
tr|B4JTN5|B4JTN5_DROGR  ----------------KAAPLLGSWERGEKMARSMMSHL--------QDG
tr|F5CB37|F5CB37_PSECS  --------------------------------------------------
tr|E1ZYU8|E1ZYU8_CAMFO  -------------PF-EPKVSLGSWSRGELYMLDIIENL--------SHY
tr|J2STU0|J2STU0_9FLAO  --------------FKMS--GIEDVKLGELYGKNMINDF--------NRG
tr|F4E6W5|F4E6W5_BACAM  -------------------------TE---GADRIA--------QYFRNG
tr|G9BHQ3|G9BHQ3_BALAC  --------------------------------------------------
tr|F4X220|F4X220_ACREC  ----------------KEKVILGSWKRGQKYALNIIENL--------SHW
pdb|pdb|2nsx_B          --------------WE-QSVRLGSWDRGMQYSHSIITNL--------LYH
tr|E5UPZ0|E5UPZ0_9BACE  -------------SYD------ATMTSGLKWAKKFHRFL--------CEA
tr|G9BHQ5|G9BHQ5_SOUCH  --------------------------------------------------
tr|C6A5Q0|C6A5Q0_BIFLB  EQIEALPDGDYKTMVQTTTPNEMDFNDATAYAHDIIGDL--------NHG
tr|D0TIX6|D0TIX6_9BACE  ------------------------WNDGRNLEKCLMEDMEETALGTVNNW
tr|B1QKT0|B1QKT0_CLOBO  ------------------------GKNTWIYAEYVFNLFR----HYIVNG
pdb|pdb|1y7v_A          --------------WE-QSVRLGSWDRGMQYSHSIITNL--------LYH
tr|D4SV88|D4SV88_9XANT  --------------FDPA--KLQYWPNGERYGTAIINDL--------NHG
tr|A9UD58|A9UD58_INIGE  --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH  --------------------------------------------------
tr|G9MUP6|G9MUP6_HYPVG  ------------APFTTTWYDDGALNEGMTWASKLATGF-------VDAG
                                                                          

P04062                  VVGWTDWNLALNPEGGPNWVRNFVD--SPIIVDIT-KDTFYKQPMFYHLG
tr|B5DYA3|B5DYA3_DROPS  FNGWLDWNLVLDEKGGPNYVNNFVD--APIIVNATSRSEIYKQPIYYAIG
tr|B4JTN5|B4JTN5_DROGR  FHGWIDWNIILDEEGGPNYVDNFVD--APVIADTITYTEFYKQPMFYVMG
tr|F5CB37|F5CB37_PSECS  --------------------------------------------------
tr|E1ZYU8|E1ZYU8_CAMFO  VSGWVDWNLALNKTGGPNWVENYVD--SPIIVIPE-EDQFYKQPMFYAIA
tr|J2STU0|J2STU0_9FLAO  TALWTDWNVLLDETGGPNHVGNFCF--APIIGDTK-TGEVHYTYEYYYIG
tr|F4E6W5|F4E6W5_BACAM  ASSYNAWVTMLDSQIKTHHWIGTPD-PTLFIQDAKNPDRYWNIPIYHMTG
tr|G9BHQ3|G9BHQ3_BALAC  --------------------------------------------------
tr|F4X220|F4X220_ACREC  MVGWIDWNMALDEYGAPNWAKNYVD--SPIIVMPQ-TDEFYKQPMFYAIS
pdb|pdb|2nsx_B          VVGWTDWNLALNPEGGPNWVRNFVD--SPIIVDIT-KDTFYKQPMFYHLG
tr|E5UPZ0|E5UPZ0_9BACE  NTGAIVWWAGAIPDGGTT------E--GLINIEK-NRVDYEVTKRCEVFG
tr|G9BHQ5|G9BHQ5_SOUCH  --------------------------------------------------
tr|C6A5Q0|C6A5Q0_BIFLB  MQRWIDWNMIVDRQGGPRHTPGGFA--APIVAED--DGRYTLTISYRYIR
tr|D0TIX6|D0TIX6_9BACE  CKAVIVWNLMLDNERGPNREGGCQTCYGAVDIDRSDYKTITRNSHYYIIG
tr|B1QKT0|B1QKT0_CLOBO  VNGYMYWNAVLEPKGMST-WGWEQN--SMITVNPETK-EVMYNPEFYVMK
pdb|pdb|1y7v_A          VVGWTDWNLALNPEGGPNWVRNFVD--SPIIVDIT-KDTFYKQPMFYHLG
tr|D4SV88|D4SV88_9XANT  AVGWTDWNILLDQHGGPNHVGNYCF--APVHADTR-TGEVIYTPSYWYIG
tr|A9UD58|A9UD58_INIGE  --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH  --------------------------------------------------
tr|G9MUP6|G9MUP6_HYPVG  LSAYLFWEGFEISQ-------NQ-S--ASHLVDVL-GQDPEPSSIYYAFT
                                                                          

P04062                  HFSKFIPEGSQRVGLVASQK----NDLDAVALMHPDGSAVVVVLNRSSKD
tr|B5DYA3|B5DYA3_DROPS  HFSKFLPAQSVRIETRIEGENNSFSQLSVVGFQRPDGSVALIVYNGQNLP
tr|B4JTN5|B4JTN5_DROGR  HFSKLVPEGSVHIEAVA-SN----INLDCIAFIRPDNKIVAVLFNSGRAD
tr|F5CB37|F5CB37_PSECS  --------------------------------------------------
tr|E1ZYU8|E1ZYU8_CAMFO  HFSKFVPRNSYVIFSTLEE-RFKEENIKSIAFLTPEQKIVIVIVNKGKNP
tr|J2STU0|J2STU0_9FLAO  HLSKYIKPNAHRVASSTN-E----SGLLSTSFMNENGQLVTVIMNDSDHD
tr|F4E6W5|F4E6W5_BACAM  NFSKFVDRGAKRIESNYGSK----NTVSNVSFLNPDQSIVTVVINQTSAE
tr|G9BHQ3|G9BHQ3_BALAC  --------------------------------------------------
tr|F4X220|F4X220_ACREC  HFSQFVPRNSYRILSTGLE---DNPNIKTIAFLTPENCITVVAVNKAYTP
pdb|pdb|2nsx_B          HFSKFIPEGSQRVGLVASQK----NDLDAVALMHPDGSAVVVVLNRSSKD
tr|E5UPZ0|E5UPZ0_9BACE  NFSRYIPVGSKRISAQYDFE----QGYMVSGYKYGDNGYTVVAINPADHE
tr|G9BHQ5|G9BHQ5_SOUCH  --------------------------------------------------
tr|C6A5Q0|C6A5Q0_BIFLB  EIAQAIKPNAVVLGTSTY-S----RDIEAVSARNADGSIGVVLLNQAERD
tr|D0TIX6|D0TIX6_9BACE  HLSSVVKPGAVRIGSKGYTA----DGIMYSAFENLDGTEALVLLNNTDGT
tr|B1QKT0|B1QKT0_CLOBO  HFSHFVQKGAKRLTTS-G-V----DSVDTVAFKNLDESIIIVISNKNDDS
pdb|pdb|1y7v_A          HFSKFIPEGSQRVGLVASQK----NDLDAVALMHPDGSAVVVVLNRSSKD
tr|D4SV88|D4SV88_9XANT  HFSKFIRPGARRVSAASS-R----SNLATTAFRNTDGSLAMVVMNASDVA
tr|A9UD58|A9UD58_INIGE  --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH  --------------------------------------------------
tr|G9MUP6|G9MUP6_HYPVG  MWSRFIRPGANRVAVSGA-L----PNVITAAFQNTDKSVIVIFTNSGNSS
                                                                          

P04062                  VP--LTIKD------------------------------------PAVG-
tr|B5DYA3|B5DYA3_DROPS  VD--VALND------------------------------------SQSG-
tr|B4JTN5|B4JTN5_DROGR  LD--ITIVD------------------------------------TIRG-
tr|F5CB37|F5CB37_PSECS  --------------------------------------------------
tr|E1ZYU8|E1ZYU8_CAMFO  IP--LTIKD------------------------------------TVRGK
tr|J2STU0|J2STU0_9FLAO  --------------------------------------------------
tr|F4E6W5|F4E6W5_BACAM  QK--FHVVS------------------------------------ED--R
tr|G9BHQ3|G9BHQ3_BALAC  --------------------------------------------------
tr|F4X220|F4X220_ACREC  ST--ITIKN------------------------------------KNKNN
pdb|pdb|2nsx_B          VP--LTIKD------------------------------------PAVG-
tr|E5UPZ0|E5UPZ0_9BACE  VV--ISLALESAQVSGALQGY---------VTDDTRKWELVEAVQPADG-
tr|G9BHQ5|G9BHQ5_SOUCH  --------------------------------------------------
tr|C6A5Q0|C6A5Q0_BIFLB  IP--VNIRM------------------------------------GGLL-
tr|D0TIX6|D0TIX6_9BACE  KN--ITVNS------------------------------------GE--R
tr|B1QKT0|B1QKT0_CLOBO  RI--ANIEF------------------------------------TG--E
pdb|pdb|1y7v_A          VP--LTIKD------------------------------------PAVG-
tr|D4SV88|D4SV88_9XANT  IA--YNLY-------------------------------------VGE-A
tr|A9UD58|A9UD58_INIGE  --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH  --------------------------------------------------
tr|G9MUP6|G9MUP6_HYPVG  QLADVAIPTG---KKSSAQVWLTDNNHRVHE----------TNFKRQS-S
                                                                          

P04062                  FLETISPGYSIHTYLW-----RRQ
tr|B5DYA3|B5DYA3_DROPS  AFNLLLPPRSWHTVL-------YK
tr|B4JTN5|B4JTN5_DROGR  ELKVNVPAKSIHTLY-------YN
tr|F5CB37|F5CB37_PSECS  -----------------------D
tr|E1ZYU8|E1ZYU8_CAMFO  TISVTLPGKSFHTISY------SA
tr|J2STU0|J2STU0_9FLAO  ----------------------TE
tr|F4E6W5|F4E6W5_BACAM  QFEAVIPAKTVATYKW----QHKK
tr|G9BHQ3|G9BHQ3_BALAC  ----------------------VK
tr|F4X220|F4X220_ACREC  VVNVCLPAKSFNTLLY----LAQE
pdb|pdb|2nsx_B          FLETISPGYSIHTYLW-----HRQ
tr|E5UPZ0|E5UPZ0_9BACE  VYTLTLPARSVVSYTGTVLSSSSL
tr|G9BHQ5|G9BHQ5_SOUCH  ----------------------VK
tr|C6A5Q0|C6A5Q0_BIFLB  VADVPLPARTLSTLVF------TE
tr|D0TIX6|D0TIX6_9BACE  SFTYEVPAKAVASFRW-----NLY
tr|B1QKT0|B1QKT0_CLOBO  IFEVELEGHSFNTIV-------LE
pdb|pdb|1y7v_A          FLETISPGYSIHTYLW-----HRQ
tr|D4SV88|D4SV88_9XANT  SSTLQIPAHAIQTVVL------GP
tr|A9UD58|A9UD58_INIGE  -----------------------T
tr|A9UD54|A9UD54_PHOPH  -----------------------D
tr|G9MUP6|G9MUP6_HYPVG  SIEVAVPPNSVVTVKF-----TSR