Difference between revisions of "Multiple Sequence Alignment: T-Coffee - set 3"

From Bioinformatikpedia
(Created page with "The native protein is colored red in the Alignment.")
 
Line 1: Line 1:
 
The native protein is colored red in the Alignment.
 
The native protein is colored red in the Alignment.
  +
  +
CLUSTAL FORMAT for T-COFFEE Version_8.47 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=73, Nseq=20, Len=824
  +
  +
<span style="color:#a30909">P04062 MEFSSPSREECPKPLSRVSIMAGSLTGLLLLQAV-SWA------------</span>
  +
tr|B5DYA3|B5DYA3_DROPS MKEIW--------------LC--FLFAVAAISAQPGGT------------
  +
tr|B4JTN5|B4JTN5_DROGR MLKRKS-------------IG--LLGAFVLLIAIIGGQ------------
  +
tr|F5CB37|F5CB37_PSECS --------------------------------------------------
  +
tr|E1ZYU8|E1ZYU8_CAMFO M-------------------------------------------------
  +
tr|J2STU0|J2STU0_9FLAO MKKII--------------VS--CFF----I-SV-AGN------------
  +
tr|F4E6W5|F4E6W5_BACAM MFFKKG-------------LY--MTLAFLLLSFLLSGS------------
  +
tr|G9BHQ3|G9BHQ3_BALAC --------------------------------------------------
  +
tr|F4X220|F4X220_ACREC MATPNE-------------LQ--TR-NFDSLLVIPSAARNNMFSLEERFE
  +
pdb|pdb|2nsx_B AR------------------------------------------------
  +
tr|E5UPZ0|E5UPZ0_9BACE MKKLS--------------YL--FAV--AAS-------------------
  +
tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------
  +
tr|C6A5Q0|C6A5Q0_BIFLB MMKAL---------------------------------------------
  +
tr|D0TIX6|D0TIX6_9BACE MVLFSL------------------LMVLICLNAC-SGA------------
  +
tr|B1QKT0|B1QKT0_CLOBO MKFIQ---------------------------------------------
  +
pdb|pdb|1y7v_A AR------------------------------------------------
  +
tr|D4SV88|D4SV88_9XANT MRAST--------------AA--A--------P-----------------
  +
tr|A9UD58|A9UD58_INIGE --------------------------------------------------
  +
tr|A9UD54|A9UD54_PHOPH --------------------------------------------------
  +
tr|G9MUP6|G9MUP6_HYPVG MKAFA--------------LA--AVG----L-------------------
  +
  +
  +
<span style="color:#a30909">P04062 ------------SG---------------------------ARPCIPKSF</span>
  +
tr|B5DYA3|B5DYA3_DROPS ------------AST--------------------------QLPCDLRET
  +
tr|B4JTN5|B4JTN5_DROGR ------------AK---------------------------TVPCKLKDV
  +
tr|F5CB37|F5CB37_PSECS --------------------------------------------------
  +
tr|E1ZYU8|E1ZYU8_CAMFO --------------------------------------------------
  +
tr|J2STU0|J2STU0_9FLAO ------------AN---------------------------AQNYWKKNA
  +
tr|F4E6W5|F4E6W5_BACAM ------------MET--------------------------EV-------
  +
tr|G9BHQ3|G9BHQ3_BALAC --------------------------------------------------
  +
tr|F4X220|F4X220_ACREC ILKTYFQSQCCVAETVRILKRNMGRDRAPTEGAIRKLVRKVRDECIPRSF
  +
pdb|pdb|2nsx_B -------------------------------------------PCIPKSF
  +
tr|E5UPZ0|E5UPZ0_9BACE --------------------------------------------------
  +
tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------
  +
tr|C6A5Q0|C6A5Q0_BIFLB --------------------------------------------------
  +
tr|D0TIX6|D0TIX6_9BACE --------------------------------------------------
  +
tr|B1QKT0|B1QKT0_CLOBO --------------------------------------------------
  +
pdb|pdb|1y7v_A -------------------------------------------PCIPKSF
  +
tr|D4SV88|D4SV88_9XANT --------------------------------------------------
  +
tr|A9UD58|A9UD58_INIGE --------------------------------------------------
  +
tr|A9UD54|A9UD54_PHOPH --------------------------------------------------
  +
tr|G9MUP6|G9MUP6_HYPVG --------------------------------------------------
  +
  +
  +
<span style="color:#a30909">P04062 GYSSVVCVCNATYC-DSFDPPTFPALGTFSRYESTRS---G---------</span>
  +
tr|B5DYA3|B5DYA3_DROPS PHG-SVCVCNSTYC-DYLEQPELNEGSRIVVISSSKD---G---------
  +
tr|B4JTN5|B4JTN5_DROGR KYG-KVCVCTADYC-DYLDNPTLSKDDDFAIISSSKQ---G---------
  +
tr|F5CB37|F5CB37_PSECS --------CNATYC-DSLDPLTLPDPGTFSRFESTRS---G---------
  +
tr|E1ZYU8|E1ZYU8_CAMFO --------------------------------------------------
  +
tr|J2STU0|J2STU0_9FLAO GKTARVILTNSTTN-EK-----LADKGTV-KF------------------
  +
tr|F4E6W5|F4E6W5_BACAM ---------YATDR-KAP-----DKNKVRVWYSSEKD---PASRTWYDGP
  +
tr|G9BHQ3|G9BHQ3_BALAC -------------C-DSLDPLALPDPGTFSRFESTRS---G---------
  +
tr|F4X220|F4X220_ACREC GNNSIVCVCNSTYC-DTVSKQKLQQ-NQLLWYTSTQD---G---------
  +
pdb|pdb|2nsx_B GYSSVVCVCNATYC-DSFDPPTFPALGTFSRYESTRS---G---------
  +
tr|E5UPZ0|E5UPZ0_9BACE ----AACLCACTDVTDVLPAEQI---------------------------
  +
tr|G9BHQ5|G9BHQ5_SOUCH -------------C-DSLDPLTLPDPGTFSRFESTRS---G---------
  +
tr|C6A5Q0|C6A5Q0_BIFLB --------------------------KTTVHYDVTAGRTHT---------
  +
tr|D0TIX6|D0TIX6_9BACE ---------------KTS-------DNVTV-YVTTND---R--------A
  +
tr|B1QKT0|B1QKT0_CLOBO -------------------------------YKTTKK---D---------
  +
pdb|pdb|1y7v_A GYSSVVCVCNATYC-DSFDPPTFPALGTFSRYESTRS---G---------
  +
tr|D4SV88|D4SV88_9XANT -----V--------------------------------------------
  +
tr|A9UD58|A9UD58_INIGE --------CNATYC-DSLDPLTLPDPGTFSRFESTRS---G---------
  +
tr|A9UD54|A9UD54_PHOPH --------CNATYC-DSLDPLTLPDPGTFSRFESTRS---G---------
  +
tr|G9MUP6|G9MUP6_HYPVG -----V--------------------------------------------
  +
  +
  +
<span style="color:#a30909">P04062 --------RRMELSMGP--IQA----------------------------</span>
  +
tr|B5DYA3|B5DYA3_DROPS --------LRFKVTTGD--LSNKAPLVVEDKQSTDENFHAEAIVVDQHRA
  +
tr|B4JTN5|B4JTN5_DROGR --------LRFELNTGS--FGSKDTYAIEDYVEPASKFAASNDTILSK-L
  +
tr|F5CB37|F5CB37_PSECS --------RRMELSLGT--IQA----------------------------
  +
tr|E1ZYU8|E1ZYU8_CAMFO --------------------------------------------------
  +
tr|J2STU0|J2STU0_9FLAO ---------------E----K-----------------------------
  +
tr|F4E6W5|F4E6W5_BACAM KEVKYALDEQTPLTL-----------------------------------
  +
tr|G9BHQ3|G9BHQ3_BALAC --------RRMELSLGT--IQA----------------------------
  +
tr|F4X220|F4X220_ACREC --------KRMQSSIMN--FSAK---------------------------
  +
pdb|pdb|2nsx_B --------RRMELSMGP--IQA----------------------------
  +
tr|E5UPZ0|E5UPZ0_9BACE ------------------P-------------------------------
  +
tr|G9BHQ5|G9BHQ5_SOUCH --------RRMELSLGT--IQA----------------------------
  +
tr|C6A5Q0|C6A5Q0_BIFLB --------EQTELSVMDEAMNT----------------------------
  +
tr|D0TIX6|D0TIX6_9BACE K--DF---VRSEIAL-----------------------------------
  +
tr|B1QKT0|B1QKT0_CLOBO ---KF-----LKNEI-----------------------------------
  +
pdb|pdb|1y7v_A --------RRMELSMGP--IQA----------------------------
  +
tr|D4SV88|D4SV88_9XANT --------------------V-----------------------------
  +
tr|A9UD58|A9UD58_INIGE --------RRMELSLGT--IQA----------------------------
  +
tr|A9UD54|A9UD54_PHOPH --------RRMELSLGT--IQA----------------------------
  +
tr|G9MUP6|G9MUP6_HYPVG --------------------A-----------------------------
  +
  +
  +
<span style="color:#a30909">P04062 ----------------NHTGTGLLLTLQP-EQKFQKVKGFGGAMTDAAAL</span>
  +
tr|B5DYA3|B5DYA3_DROPS W-LNLASI--PQRLFINASVKTVSVSVKR-DQRYQNVTNFGGALTGTVSH
  +
tr|B4JTN5|B4JTN5_DROGR WDQAIDSIFSQSATPASSITRSVTLKLDR-SKRFQKIEGFGGSFTGAVSY
  +
tr|F5CB37|F5CB37_PSECS ----------------NRTGTGLLLTLQP---------------------
  +
tr|E1ZYU8|E1ZYU8_CAMFO ---------------------SKVLTLDS-NKKHQQIFGFGGAMTDAAAL
  +
tr|J2STU0|J2STU0_9FLAO --------------FAQPKENEACIFVDP-DFKYQKLIGIGGAVTDAAAE
  +
tr|F4E6W5|F4E6W5_BACAM --------------TKKKASDSTAVYIDP-SHRYQSVLGIGSSLEESTIS
  +
tr|G9BHQ3|G9BHQ3_BALAC ----------------NRTGTGLLLTLQP-DQKFQK--------------
  +
tr|F4X220|F4X220_ACREC ----------------NESEIDLVLTVDI-NQKFQKIQGFGGAMTDAAAL
  +
pdb|pdb|2nsx_B ----------------NHTGTGLLLTLQP-EQKFQKVKGFGGAMTDAAAL
  +
tr|E5UPZ0|E5UPZ0_9BACE --------------ADARSTLGADVVLQW-NNEEQTIDGFGVAQAGWSDY
  +
tr|G9BHQ5|G9BHQ5_SOUCH ----------------NRTGTGLLLTLQP-DQKFQK--------------
  +
tr|C6A5Q0|C6A5Q0_BIFLB ----------------EHIVESNVVGIYP-DYTFQMMEGYGCSLTESACY
  +
tr|D0TIX6|D0TIX6_9BACE --------------GDKQAASPSVITIDP-SVRYQTMDGFGAAVTGSTCY
  +
tr|B1QKT0|B1QKT0_CLOBO ----------------NNTTDE-RPTLHVSQIENRIIEGFGSCFNELGMK
  +
pdb|pdb|1y7v_A ----------------NHTGTGLLLTLQP-EQKFQKVKGFGGAMTDAAAL
  +
tr|D4SV88|D4SV88_9XANT --------------GHALTEKENSIFVNP-QRQFQQVLGIGGAITDSSAE
  +
tr|A9UD58|A9UD58_INIGE ----------------NRTG------------------------------
  +
tr|A9UD54|A9UD54_PHOPH ----------------NRTGTGLLLTLQP---------------------
  +
tr|G9MUP6|G9MUP6_HYPVG --------------LTVPTTSATSIKINT-NSKLQRIDGFGFSQAFGRAS
  +
  +
  +
<span style="color:#a30909">P04062 NILALSP-PAQNLLLKSYFS-EEGIGYNIIRVPMASCD-FSIRT-YTYAD</span>
  +
tr|B5DYA3|B5DYA3_DROPS LLQLLPT-ELQDHVYKSYYH-DDGIAYNSIRTSIGGCD-FDLEP-WAYNE
  +
tr|B4JTN5|B4JTN5_DROGR LLNNFKEQDIQDHLYKSYYA-ADGLGFNLLRISIGGCD-FDLNP-WAYNE
  +
tr|F5CB37|F5CB37_PSECS --------------------------------------------------
  +
tr|E1ZYU8|E1ZYU8_CAMFO NIRTLSN-ETQRQLLESYFG-STGIGYTFSRIPIAGTD-FSTRP-YTYDD
  +
tr|J2STU0|J2STU0_9FLAO TFYKLPK-AKQKEIIDAYYG-KNGLGYTIVRTNMNSCD-FSSDS-YTYVE
  +
tr|F4E6W5|F4E6W5_BACAM NLSKMSP-GKRKEVLKKLVDPNEGIGMDVMRITIGTSD-FTAQEFYTYDD
  +
tr|G9BHQ3|G9BHQ3_BALAC --------------------------------------------------
  +
tr|F4X220|F4X220_ACREC NIKSLSN-NTQQILLESYFG-SKGIGYTFTRIPIAGTD-FSMRP-YTYDD
  +
pdb|pdb|2nsx_B NILALSP-PAQNLLLKSYFS-EEGIGYNIIRVPMASCD-FSIRT-YTYAD
  +
tr|E5UPZ0|E5UPZ0_9BACE LY---AHR-KRQEIMDVMFG-QDGLRLSILRGEVFP-HY-DETT-FNMDE
  +
tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------
  +
tr|C6A5Q0|C6A5Q0_BIFLB LLSKMDS-ATRKEALAQWFG-PAGMDAWFVRVHIDSCD-YSLSE-YQAVE
  +
tr|D0TIX6|D0TIX6_9BACE NLMRMAP-EDRTAFLKETFSDTEGMGYSYIRISIGCSD-FSLSE-YTCCD
  +
tr|B1QKT0|B1QKT0_CLOBO ALNHLDK-DERNKVLDQLFSIKGDCRFNLCRMPIGASD-YATEW-YSYNE
  +
pdb|pdb|1y7v_A NILALSP-PAQNLLLKSYFS-EEGIGYNIIRVPMASCD-FSIRT-YTYAD
  +
tr|D4SV88|D4SV88_9XANT TFAKLPK-RAQRALLTAYYDPQQGIGYTLARTTIHSSD-FSSGS-YTYIK
  +
tr|A9UD58|A9UD58_INIGE --------------------------------------------------
  +
tr|A9UD54|A9UD54_PHOPH --------------------------------------------------
  +
tr|G9MUP6|G9MUP6_HYPVG QFQAAEP-EMRKKALDLLFDTKTGAGFSIIRNWIPSTTALSIEP-NSPGL
  +
  +
  +
<span style="color:#a30909">P04062 TP---DDFQLHN----FSLPE-ED----------TKLKI-PLIHRALQLA</span>
  +
tr|B5DYA3|B5DYA3_DROPS LPR--NDVALSN----FTELD-PR----------DLQKI-EQLKRLKSVA
  +
tr|B4JTN5|B4JTN5_DROGR EPQ--NEVVLTG----MDKLH-ER----------DVLRV-GQIKRMKEVS
  +
tr|F5CB37|F5CB37_PSECS --------------------------------------------------
  +
tr|E1ZYU8|E1ZYU8_CAMFO VP---NDFTLSN----FSLVG-ED-----------DYKI-EYLHRIKNIM
  +
tr|J2STU0|J2STU0_9FLAO D----NDTSLKS----FSLAH--D----------EKYKI-PMIKEAQKSI
  +
tr|F4E6W5|F4E6W5_BACAM MPEGRKDPKLRH----FSIQK-D-----------IDLHITATIKEALAI-
  +
tr|G9BHQ3|G9BHQ3_BALAC --------------------------------------------------
  +
tr|F4X220|F4X220_ACREC VP---DDLMLSH----FGLVE-ED-----------DYKI-KYLHNIKKIM
  +
pdb|pdb|2nsx_B TP---DDFQLHN----FSLPE-ED----------TKLKI-PLIHRALQLA
  +
tr|E5UPZ0|E5UPZ0_9BACE ------DINLSLDDPFFDIDFNRDENRVAEGIAQRNGQL-WIMKKAKQ--
  +
tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------
  +
tr|C6A5Q0|C6A5Q0_BIFLB DPL--ADPELET----FSIDR--D----------RQYIL-PVLKEAMAMA
  +
tr|D0TIX6|D0TIX6_9BACE TK------GVEN----FALQS-EE----------KEYVI-PILKEILAI-
  +
tr|B1QKT0|B1QKT0_CLOBO NE---NDFDMEK----FSIQK-D-----------KRLLI-PYIKEALKR-
  +
pdb|pdb|1y7v_A TP---DDFQLHN----FSLPE-ED----------TKLKI-PLIHRALQLA
  +
tr|D4SV88|D4SV88_9XANT E----GDAALKS----FSVKH--D----------AKYRI-PMLRQAIAAA
  +
tr|A9UD58|A9UD58_INIGE --------------------------------------------------
  +
tr|A9UD54|A9UD54_PHOPH --------------------------------------------------
  +
tr|G9MUP6|G9MUP6_HYPVG A----S--NKPN----YTWDG--D----------DEGQI-WFTKQAVSY-
  +
  +
  +
<span style="color:#a30909">P04062 Q--RPVSLLASPWTSPTWLKTNGAVNG-----------------------</span>
  +
tr|B5DYA3|B5DYA3_DROPS R-MEELKIMAAAWSAPPWMKTNDRWTG-----------------------
  +
tr|B4JTN5|B4JTN5_DROGR G-ETNLRIKGAAWSPPKWMKTNNEWTG-----------------------
  +
tr|F5CB37|F5CB37_PSECS --------------------------------------------------
  +
tr|E1ZYU8|E1ZYU8_CAMFO SDPETLRIFTTSWSAPAWMKNTNNIK------------------------
  +
tr|J2STU0|J2STU0_9FLAO G--SSFKLYFSPWSPPAWMKSNKDMLK-----------------------
  +
tr|F4E6W5|F4E6W5_BACAM --NPKLKIIASPWSPPAWMKTNEN-------------------------L
  +
tr|G9BHQ3|G9BHQ3_BALAC --------------------------------------------------
  +
tr|F4X220|F4X220_ACREC SNPDEFRILTTAWSAPAWMKSSKSIT------------------------
  +
pdb|pdb|2nsx_B Q--RPVSLLASPWTSPTWLKTNGAVNG-----------------------
  +
tr|E5UPZ0|E5UPZ0_9BACE -EYGVDKLIFSVWSAPAYMKSNGSTS------------------------
  +
tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------
  +
tr|C6A5Q0|C6A5Q0_BIFLB G--HPIHVLLSPWSPPAQWKTPPEMTR-NDASVYGGEEGDVIDLSKPGRC
  +
tr|D0TIX6|D0TIX6_9BACE --SPSIKILGSPWTCPRWMKVDNLKDLRPF-----------------ESW
  +
tr|B1QKT0|B1QKT0_CLOBO --NPNIILTASPWSPPTWMKTQKA-------------------------Y
  +
pdb|pdb|1y7v_A Q--RPVSLLASPWTSPTWLKTNGAVNG-----------------------
  +
tr|D4SV88|D4SV88_9XANT G--GTLTTFASPWSAPAFMKDSKTMLK-----------------------
  +
tr|A9UD58|A9UD58_INIGE --------------------------------------------------
  +
tr|A9UD54|A9UD54_PHOPH --------------------------------------------------
  +
tr|G9MUP6|G9MUP6_HYPVG ---GVKTIYADAWSAPGYMKTNGDEAT-----------------------
  +
  +
  +
<span style="color:#a30909">P04062 -KGSLKGQ-----PGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPS</span>
  +
tr|B5DYA3|B5DYA3_DROPS -FGQLK---------SEYYQTWALYHLKFLELMQSKNMPIWAISTGNEPL
  +
tr|B4JTN5|B4JTN5_DROGR -FGQLK---------REYYQTWANYHLKWLDLMESNGLPIWAISTGNEPL
  +
tr|F5CB37|F5CB37_PSECS --------------------------------------------------
  +
tr|E1ZYU8|E1ZYU8_CAMFO -WGALN---------PEYYQLYADYIKKFFDAYKERGINIWGMTPGNEPI
  +
tr|J2STU0|J2STU0_9FLAO -GGRLE---------NQYYQTWANYYIKFIQEYEKQGLNIWGLTVQNEPM
  +
tr|F4E6W5|F4E6W5_BACAM KRGKLK---------DKYISELAVYFRKFIEAYEKQGIPIYAMTLQNEPL
  +
tr|G9BHQ3|G9BHQ3_BALAC --------------------------------------------------
  +
tr|F4X220|F4X220_ACREC -WGILK---------SEYYQLYADYIVKFFDAYKERGINIWGITPGNEPL
  +
pdb|pdb|2nsx_B -KGSLKGQ-----PGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPS
  +
tr|E5UPZ0|E5UPZ0_9BACE -QGFLK---------RGSYQAFADYLSNFCDAYTAAGLPVYAISPANEPE
  +
tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------
  +
tr|C6A5Q0|C6A5Q0_BIFLB FGGRLK---------PEYYSSWARYLVRFISAYMAEGVPVTMLSIQNEAA
  +
tr|D0TIX6|D0TIX6_9BACE TSGQLN---------PAYYQDYATYFVKWIQAMEAEGIPIEAITPQNEPL
  +
tr|B1QKT0|B1QKT0_CLOBO NFGTLRF-------EEKVLKVYSLYFVKFVQAYEEEGITIHQVYVQNEVV
  +
pdb|pdb|1y7v_A -KGSLKGQ-----PGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPS
  +
tr|D4SV88|D4SV88_9XANT -GGKLL---------PEYAQAWATYYTRFIAAYEKAGIPIWGISLQNEPM
  +
tr|A9UD58|A9UD58_INIGE --------------------------------------------------
  +
tr|A9UD54|A9UD54_PHOPH --------------------------------------------------
  +
tr|G9MUP6|G9MUP6_HYPVG -PGYLCGSTGHTCSTGDWRQAFANYLVQYVKFYKQEGLDITHLGFLNEPD
  +
  +
  +
<span style="color:#a30909">P04062 AGLLS--GYPFQCLGFTPEHQ--RDFIARDLGPTLANSTHHN-VRLLML-</span>
  +
tr|B5DYA3|B5DYA3_DROPS NGVIGFFFVHFMSMGWTPWQQ--AIWLSDHLGPTIRNSTQKP-VLIFGN-
  +
tr|B4JTN5|B4JTN5_DROGR NGIFFMFFVKFMSLGWTPQMQ--AVWLNDYLGPTIRNSKHKD-IIIFGN-
  +
tr|F5CB37|F5CB37_PSECS --------------------------------------------------
  +
tr|E1ZYU8|E1ZYU8_CAMFO DGLVP--FFPFNSMMWLPREG--ADWVVNHLAPTLSKAGYKD-LIYMAM-
  +
tr|J2STU0|J2STU0_9FLAO ATQ------TWESCLYTAEEE--GNFLKNNLGPTLWKNGYKD-KKIMIW-
  +
tr|F4E6W5|F4E6W5_BACAM LEI------DYPSMYMPPSQQ--RK-LAQALKKEMKKHLID-T-KIWIY-
  +
tr|G9BHQ3|G9BHQ3_BALAC --------------------------------------------------
  +
tr|F4X220|F4X220_ACREC NGFIP--FFTFNSMGWTPNTS--AVWTVKHLAPTLTNAGYNP-LY-IAM-
  +
pdb|pdb|2nsx_B AGLLS--GYPFQCLGFTPEHQ--RDFIARDLGPTLANSTHHN-VRLLML-
  +
tr|E5UPZ0|E5UPZ0_9BACE YAA------SWNSCLWLPGTTTLGPFIVNNLGPKLRQTHP-E-TRIIFG-
  +
tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------
  +
tr|C6A5Q0|C6A5Q0_BIFLB AAT------SWDSCLWTGDQE--REFLKHHLYPAMEEAGLTDAVKIFIW-
  +
tr|D0TIX6|D0TIX6_9BACE NRG------NSASLFMGWEEQ--LSFVRDALGPKLKETGLK-T-KIYAFD
  +
tr|B1QKT0|B1QKT0_CLOBO ADQ------KFPSCRWTGDQL--RDFIKNYLGLAFEKHNIS-S-EIWLGT
  +
pdb|pdb|1y7v_A AGLLS--GYPFQCLGFTPEHQ--RDFIARDLGPTLANSTHHN-VRLLML-
  +
tr|D4SV88|D4SV88_9XANT AVQ------TWESMLFSAEEE--RDFLKHHLGPTMASAGYGE-RKIIVW-
  +
tr|A9UD58|A9UD58_INIGE --------------------------------------------------
  +
tr|A9UD54|A9UD54_PHOPH --------------------------------------------------
  +
tr|G9MUP6|G9MUP6_HYPVG YIA------SYSQMQISPSAQEAISFI-PTLYETVKRE-HLD-LRLTCC-
  +
  +
  +
<span style="color:#a30909">P04062 -----------DDQRLLLP--------HWAKV-VLTDPEAAKYVHGIAVH</span>
  +
tr|B5DYA3|B5DYA3_DROPS -----------DDQRYTFP--------SWFRKMRSSRSNSLSYLDGLAVH
  +
tr|B4JTN5|B4JTN5_DROGR -----------DDQRFTSP--------LWFKMMNRTRPNSVDYIDGVALH
  +
tr|F5CB37|F5CB37_PSECS --------------------------------------------------
  +
tr|E1ZYU8|E1ZYU8_CAMFO -----------DDQRMLLP--------WYVET-MFTNQKAKEVFSGTAIH
  +
tr|J2STU0|J2STU0_9FLAO -----------DHNRDLMF--------QRATT-TLSDPETSKYASGIGYH
  +
tr|F4E6W5|F4E6W5_BACAM -----------DHNASGAW--------NYIPP-ILDDKKGNQAADGIAFH
  +
tr|G9BHQ3|G9BHQ3_BALAC --------------------------------------------------
  +
tr|F4X220|F4X220_ACREC -----------DDQRFEIP--------WFTEL-MFEYPKTKELFSGTAVH
  +
pdb|pdb|2nsx_B -----------DDQRLLLP--------HWAKV-VLTDPEAAKYVHGIAVH
  +
tr|E5UPZ0|E5UPZ0_9BACE -----------ENAQWSAILGFIMGSKNYVRDILNLNPKITNFPVIAAGH
  +
tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------
  +
tr|C6A5Q0|C6A5Q0_BIFLB -----------DHNKERAI--------EHIDE-FMSDPEAAKEVGGFAYH
  +
tr|D0TIX6|D0TIX6_9BACE HNYN--Y-----DNMLEQQ--------GYPMK-IYEDENAASFLTGAAYH
  +
tr|B1QKT0|B1QKT0_CLOBO INAPEPYVEWLEDYTQDFD--------VYAGL-VLRDPKAYKYVKGVGYQ
  +
pdb|pdb|1y7v_A -----------DDQRLLLP--------HWAKV-VLTDPEAAKYVHGIAVH
  +
tr|D4SV88|D4SV88_9XANT -----------DHNRDMMV--------HRAHV-IFDDPEAAKYAWGMGFH
  +
tr|A9UD58|A9UD58_INIGE --------------------------------------------------
  +
tr|A9UD54|A9UD54_PHOPH --------------------------------------------------
  +
tr|G9MUP6|G9MUP6_HYPVG -----------DATGW------------------DTQANYTNYLMAAGMQ
  +
  +
  +
<span style="color:#a30909">P04062 WYLDFLAPAK--ATLGETHRLFPN--TMLFASEACVGSKF----------</span>
  +
tr|B5DYA3|B5DYA3_DROPS WYWDELVG-P--QLIDQAHAEMPN--MLLLNTESCIGDKPWQ--------
  +
tr|B4JTN5|B4JTN5_DROGR WYWDEIFG-N--SFIHKTNKYMEN--KIQIISESCIGDKPWQ--------
  +
tr|F5CB37|F5CB37_PSECS --------------------------------------------------
  +
tr|E1ZYU8|E1ZYU8_CAMFO WYADKQFS-P--DRLTRTHNKYPN--KFMLITEACTGTFPTN--------
  +
tr|J2STU0|J2STU0_9FLAO WYEVWHNKTQLFDNVIETYRAFPD--KFLAFTEGCKEV------------
  +
tr|F4E6W5|F4E6W5_BACAM DYDGDL------SVMSEIGRRYPD--KSIHLTERSVWG------------
  +
tr|G9BHQ3|G9BHQ3_BALAC --------------------------------------------------
  +
tr|F4X220|F4X220_ACREC WYADEIFS-P--IRLSQLHDKYPD--KFILMSEACTGSSPFN--------
  +
pdb|pdb|2nsx_B WYLDFLAPAK--ATLGETHRLFPN--TMLFASEACVGSKF----------
  +
tr|E5UPZ0|E5UPZ0_9BACE GYVDPVTG-K--DPAIEPFSKAESKGIPVWLTEISDPTE-----------
  +
tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------
  +
tr|C6A5Q0|C6A5Q0_BIFLB WYSGDHF-----EALSMLRGKYPD--KVLMHSESCGLHIPGKVTMLDMTD
  +
tr|D0TIX6|D0TIX6_9BACE NYGGDR------EELNNVNGKFPD--KELIFTETSIGM------------
  +
tr|B1QKT0|B1QKT0_CLOBO WAGK--------NAIQRSVEAFPE--KRFIQTENECGN------------
  +
pdb|pdb|1y7v_A WYLDFLAPAK--ATLGETHRLFPN--TMLFASEACVGSKF----------
  +
tr|D4SV88|D4SV88_9XANT WYETWAGFEPMVENVAAVAQAYPD--KHLLLTEAAVEK------------
  +
tr|A9UD58|A9UD58_INIGE --------------------------------------------------
  +
tr|A9UD54|A9UD54_PHOPH --------------------------------------------------
  +
tr|G9MUP6|G9MUP6_HYPVG KYLDIISS--HMYSSDATFPLKTN--LPTWLTEAGVETSS----------
  +
  +
  +
<span style="color:#a30909">P04062 --------------WE-QSVRLGSWDRGMQYSHSIITNL--------LYH</span>
  +
tr|B5DYA3|B5DYA3_DROPS ----------------THGPELGSWQRGENYMRAYIQDF--------QHN
  +
tr|B4JTN5|B4JTN5_DROGR ----------------KAAPLLGSWERGEKMARSMMSHL--------QDG
  +
tr|F5CB37|F5CB37_PSECS --------------------------------------------------
  +
tr|E1ZYU8|E1ZYU8_CAMFO -------------PF-EPKVSLGSWSRGELYMLDIIENL--------SHY
  +
tr|J2STU0|J2STU0_9FLAO --------------FKMS--GIEDVKLGELYGKNMINDF--------NRG
  +
tr|F4E6W5|F4E6W5_BACAM -------------------------TE---GADRIA--------QYFRNG
  +
tr|G9BHQ3|G9BHQ3_BALAC --------------------------------------------------
  +
tr|F4X220|F4X220_ACREC ----------------KEKVILGSWKRGQKYALNIIENL--------SHW
  +
pdb|pdb|2nsx_B --------------WE-QSVRLGSWDRGMQYSHSIITNL--------LYH
  +
tr|E5UPZ0|E5UPZ0_9BACE -------------SYD------ATMTSGLKWAKKFHRFL--------CEA
  +
tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------
  +
tr|C6A5Q0|C6A5Q0_BIFLB EQIEALPDGDYKTMVQTTTPNEMDFNDATAYAHDIIGDL--------NHG
  +
tr|D0TIX6|D0TIX6_9BACE ------------------------WNDGRNLEKCLMEDMEETALGTVNNW
  +
tr|B1QKT0|B1QKT0_CLOBO ------------------------GKNTWIYAEYVFNLFR----HYIVNG
  +
pdb|pdb|1y7v_A --------------WE-QSVRLGSWDRGMQYSHSIITNL--------LYH
  +
tr|D4SV88|D4SV88_9XANT --------------FDPA--KLQYWPNGERYGTAIINDL--------NHG
  +
tr|A9UD58|A9UD58_INIGE --------------------------------------------------
  +
tr|A9UD54|A9UD54_PHOPH --------------------------------------------------
  +
tr|G9MUP6|G9MUP6_HYPVG ------------APFTTTWYDDGALNEGMTWASKLATGF-------VDAG
  +
  +
  +
<span style="color:#a30909">P04062 VVGWTDWNLALNPEGGPNWVRNFVD--SPIIVDIT-KDTFYKQPMFYHLG</span>
  +
tr|B5DYA3|B5DYA3_DROPS FNGWLDWNLVLDEKGGPNYVNNFVD--APIIVNATSRSEIYKQPIYYAIG
  +
tr|B4JTN5|B4JTN5_DROGR FHGWIDWNIILDEEGGPNYVDNFVD--APVIADTITYTEFYKQPMFYVMG
  +
tr|F5CB37|F5CB37_PSECS --------------------------------------------------
  +
tr|E1ZYU8|E1ZYU8_CAMFO VSGWVDWNLALNKTGGPNWVENYVD--SPIIVIPE-EDQFYKQPMFYAIA
  +
tr|J2STU0|J2STU0_9FLAO TALWTDWNVLLDETGGPNHVGNFCF--APIIGDTK-TGEVHYTYEYYYIG
  +
tr|F4E6W5|F4E6W5_BACAM ASSYNAWVTMLDSQIKTHHWIGTPD-PTLFIQDAKNPDRYWNIPIYHMTG
  +
tr|G9BHQ3|G9BHQ3_BALAC --------------------------------------------------
  +
tr|F4X220|F4X220_ACREC MVGWIDWNMALDEYGAPNWAKNYVD--SPIIVMPQ-TDEFYKQPMFYAIS
  +
pdb|pdb|2nsx_B VVGWTDWNLALNPEGGPNWVRNFVD--SPIIVDIT-KDTFYKQPMFYHLG
  +
tr|E5UPZ0|E5UPZ0_9BACE NTGAIVWWAGAIPDGGTT------E--GLINIEK-NRVDYEVTKRCEVFG
  +
tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------
  +
tr|C6A5Q0|C6A5Q0_BIFLB MQRWIDWNMIVDRQGGPRHTPGGFA--APIVAED--DGRYTLTISYRYIR
  +
tr|D0TIX6|D0TIX6_9BACE CKAVIVWNLMLDNERGPNREGGCQTCYGAVDIDRSDYKTITRNSHYYIIG
  +
tr|B1QKT0|B1QKT0_CLOBO VNGYMYWNAVLEPKGMST-WGWEQN--SMITVNPETK-EVMYNPEFYVMK
  +
pdb|pdb|1y7v_A VVGWTDWNLALNPEGGPNWVRNFVD--SPIIVDIT-KDTFYKQPMFYHLG
  +
tr|D4SV88|D4SV88_9XANT AVGWTDWNILLDQHGGPNHVGNYCF--APVHADTR-TGEVIYTPSYWYIG
  +
tr|A9UD58|A9UD58_INIGE --------------------------------------------------
  +
tr|A9UD54|A9UD54_PHOPH --------------------------------------------------
  +
tr|G9MUP6|G9MUP6_HYPVG LSAYLFWEGFEISQ-------NQ-S--ASHLVDVL-GQDPEPSSIYYAFT
  +
  +
  +
<span style="color:#a30909">P04062 HFSKFIPEGSQRVGLVASQK----NDLDAVALMHPDGSAVVVVLNRSSKD</span>
  +
tr|B5DYA3|B5DYA3_DROPS HFSKFLPAQSVRIETRIEGENNSFSQLSVVGFQRPDGSVALIVYNGQNLP
  +
tr|B4JTN5|B4JTN5_DROGR HFSKLVPEGSVHIEAVA-SN----INLDCIAFIRPDNKIVAVLFNSGRAD
  +
tr|F5CB37|F5CB37_PSECS --------------------------------------------------
  +
tr|E1ZYU8|E1ZYU8_CAMFO HFSKFVPRNSYVIFSTLEE-RFKEENIKSIAFLTPEQKIVIVIVNKGKNP
  +
tr|J2STU0|J2STU0_9FLAO HLSKYIKPNAHRVASSTN-E----SGLLSTSFMNENGQLVTVIMNDSDHD
  +
tr|F4E6W5|F4E6W5_BACAM NFSKFVDRGAKRIESNYGSK----NTVSNVSFLNPDQSIVTVVINQTSAE
  +
tr|G9BHQ3|G9BHQ3_BALAC --------------------------------------------------
  +
tr|F4X220|F4X220_ACREC HFSQFVPRNSYRILSTGLE---DNPNIKTIAFLTPENCITVVAVNKAYTP
  +
pdb|pdb|2nsx_B HFSKFIPEGSQRVGLVASQK----NDLDAVALMHPDGSAVVVVLNRSSKD
  +
tr|E5UPZ0|E5UPZ0_9BACE NFSRYIPVGSKRISAQYDFE----QGYMVSGYKYGDNGYTVVAINPADHE
  +
tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------
  +
tr|C6A5Q0|C6A5Q0_BIFLB EIAQAIKPNAVVLGTSTY-S----RDIEAVSARNADGSIGVVLLNQAERD
  +
tr|D0TIX6|D0TIX6_9BACE HLSSVVKPGAVRIGSKGYTA----DGIMYSAFENLDGTEALVLLNNTDGT
  +
tr|B1QKT0|B1QKT0_CLOBO HFSHFVQKGAKRLTTS-G-V----DSVDTVAFKNLDESIIIVISNKNDDS
  +
pdb|pdb|1y7v_A HFSKFIPEGSQRVGLVASQK----NDLDAVALMHPDGSAVVVVLNRSSKD
  +
tr|D4SV88|D4SV88_9XANT HFSKFIRPGARRVSAASS-R----SNLATTAFRNTDGSLAMVVMNASDVA
  +
tr|A9UD58|A9UD58_INIGE --------------------------------------------------
  +
tr|A9UD54|A9UD54_PHOPH --------------------------------------------------
  +
tr|G9MUP6|G9MUP6_HYPVG MWSRFIRPGANRVAVSGA-L----PNVITAAFQNTDKSVIVIFTNSGNSS
  +
  +
  +
<span style="color:#a30909">P04062 VP--LTIKD------------------------------------PAVG-</span>
  +
tr|B5DYA3|B5DYA3_DROPS VD--VALND------------------------------------SQSG-
  +
tr|B4JTN5|B4JTN5_DROGR LD--ITIVD------------------------------------TIRG-
  +
tr|F5CB37|F5CB37_PSECS --------------------------------------------------
  +
tr|E1ZYU8|E1ZYU8_CAMFO IP--LTIKD------------------------------------TVRGK
  +
tr|J2STU0|J2STU0_9FLAO --------------------------------------------------
  +
tr|F4E6W5|F4E6W5_BACAM QK--FHVVS------------------------------------ED--R
  +
tr|G9BHQ3|G9BHQ3_BALAC --------------------------------------------------
  +
tr|F4X220|F4X220_ACREC ST--ITIKN------------------------------------KNKNN
  +
pdb|pdb|2nsx_B VP--LTIKD------------------------------------PAVG-
  +
tr|E5UPZ0|E5UPZ0_9BACE VV--ISLALESAQVSGALQGY---------VTDDTRKWELVEAVQPADG-
  +
tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------
  +
tr|C6A5Q0|C6A5Q0_BIFLB IP--VNIRM------------------------------------GGLL-
  +
tr|D0TIX6|D0TIX6_9BACE KN--ITVNS------------------------------------GE--R
  +
tr|B1QKT0|B1QKT0_CLOBO RI--ANIEF------------------------------------TG--E
  +
pdb|pdb|1y7v_A VP--LTIKD------------------------------------PAVG-
  +
tr|D4SV88|D4SV88_9XANT IA--YNLY-------------------------------------VGE-A
  +
tr|A9UD58|A9UD58_INIGE --------------------------------------------------
  +
tr|A9UD54|A9UD54_PHOPH --------------------------------------------------
  +
tr|G9MUP6|G9MUP6_HYPVG QLADVAIPTG---KKSSAQVWLTDNNHRVHE----------TNFKRQS-S
  +
  +
  +
<span style="color:#a30909">P04062 FLETISPGYSIHTYLW-----RRQ</span>
  +
tr|B5DYA3|B5DYA3_DROPS AFNLLLPPRSWHTVL-------YK
  +
tr|B4JTN5|B4JTN5_DROGR ELKVNVPAKSIHTLY-------YN
  +
tr|F5CB37|F5CB37_PSECS -----------------------D
  +
tr|E1ZYU8|E1ZYU8_CAMFO TISVTLPGKSFHTISY------SA
  +
tr|J2STU0|J2STU0_9FLAO ----------------------TE
  +
tr|F4E6W5|F4E6W5_BACAM QFEAVIPAKTVATYKW----QHKK
  +
tr|G9BHQ3|G9BHQ3_BALAC ----------------------VK
  +
tr|F4X220|F4X220_ACREC VVNVCLPAKSFNTLLY----LAQE
  +
pdb|pdb|2nsx_B FLETISPGYSIHTYLW-----HRQ
  +
tr|E5UPZ0|E5UPZ0_9BACE VYTLTLPARSVVSYTGTVLSSSSL
  +
tr|G9BHQ5|G9BHQ5_SOUCH ----------------------VK
  +
tr|C6A5Q0|C6A5Q0_BIFLB VADVPLPARTLSTLVF------TE
  +
tr|D0TIX6|D0TIX6_9BACE SFTYEVPAKAVASFRW-----NLY
  +
tr|B1QKT0|B1QKT0_CLOBO IFEVELEGHSFNTIV-------LE
  +
pdb|pdb|1y7v_A FLETISPGYSIHTYLW-----HRQ
  +
tr|D4SV88|D4SV88_9XANT SSTLQIPAHAIQTVVL------GP
  +
tr|A9UD58|A9UD58_INIGE -----------------------T
  +
tr|A9UD54|A9UD54_PHOPH -----------------------D
  +
tr|G9MUP6|G9MUP6_HYPVG SIEVAVPPNSVVTVKF-----TSR

Revision as of 16:41, 6 May 2013

The native protein is colored red in the Alignment.

CLUSTAL FORMAT for T-COFFEE Version_8.47 [1] [MODE:  ], CPU=0.00 sec, SCORE=73, Nseq=20, Len=824 

P04062                  MEFSSPSREECPKPLSRVSIMAGSLTGLLLLQAV-SWA------------
tr|B5DYA3|B5DYA3_DROPS  MKEIW--------------LC--FLFAVAAISAQPGGT------------
tr|B4JTN5|B4JTN5_DROGR  MLKRKS-------------IG--LLGAFVLLIAIIGGQ------------
tr|F5CB37|F5CB37_PSECS  --------------------------------------------------
tr|E1ZYU8|E1ZYU8_CAMFO  M-------------------------------------------------
tr|J2STU0|J2STU0_9FLAO  MKKII--------------VS--CFF----I-SV-AGN------------
tr|F4E6W5|F4E6W5_BACAM  MFFKKG-------------LY--MTLAFLLLSFLLSGS------------
tr|G9BHQ3|G9BHQ3_BALAC  --------------------------------------------------
tr|F4X220|F4X220_ACREC  MATPNE-------------LQ--TR-NFDSLLVIPSAARNNMFSLEERFE
pdb|pdb|2nsx_B          AR------------------------------------------------
tr|E5UPZ0|E5UPZ0_9BACE  MKKLS--------------YL--FAV--AAS-------------------
tr|G9BHQ5|G9BHQ5_SOUCH  --------------------------------------------------
tr|C6A5Q0|C6A5Q0_BIFLB  MMKAL---------------------------------------------
tr|D0TIX6|D0TIX6_9BACE  MVLFSL------------------LMVLICLNAC-SGA------------
tr|B1QKT0|B1QKT0_CLOBO  MKFIQ---------------------------------------------
pdb|pdb|1y7v_A          AR------------------------------------------------
tr|D4SV88|D4SV88_9XANT  MRAST--------------AA--A--------P-----------------
tr|A9UD58|A9UD58_INIGE  --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH  --------------------------------------------------
tr|G9MUP6|G9MUP6_HYPVG  MKAFA--------------LA--AVG----L-------------------
                                                                          

P04062                  ------------SG---------------------------ARPCIPKSF
tr|B5DYA3|B5DYA3_DROPS  ------------AST--------------------------QLPCDLRET
tr|B4JTN5|B4JTN5_DROGR  ------------AK---------------------------TVPCKLKDV
tr|F5CB37|F5CB37_PSECS  --------------------------------------------------
tr|E1ZYU8|E1ZYU8_CAMFO  --------------------------------------------------
tr|J2STU0|J2STU0_9FLAO  ------------AN---------------------------AQNYWKKNA
tr|F4E6W5|F4E6W5_BACAM  ------------MET--------------------------EV-------
tr|G9BHQ3|G9BHQ3_BALAC  --------------------------------------------------
tr|F4X220|F4X220_ACREC  ILKTYFQSQCCVAETVRILKRNMGRDRAPTEGAIRKLVRKVRDECIPRSF
pdb|pdb|2nsx_B          -------------------------------------------PCIPKSF
tr|E5UPZ0|E5UPZ0_9BACE  --------------------------------------------------
tr|G9BHQ5|G9BHQ5_SOUCH  --------------------------------------------------
tr|C6A5Q0|C6A5Q0_BIFLB  --------------------------------------------------
tr|D0TIX6|D0TIX6_9BACE  --------------------------------------------------
tr|B1QKT0|B1QKT0_CLOBO  --------------------------------------------------
pdb|pdb|1y7v_A          -------------------------------------------PCIPKSF
tr|D4SV88|D4SV88_9XANT  --------------------------------------------------
tr|A9UD58|A9UD58_INIGE  --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH  --------------------------------------------------
tr|G9MUP6|G9MUP6_HYPVG  --------------------------------------------------
                                                                          

P04062                  GYSSVVCVCNATYC-DSFDPPTFPALGTFSRYESTRS---G---------
tr|B5DYA3|B5DYA3_DROPS  PHG-SVCVCNSTYC-DYLEQPELNEGSRIVVISSSKD---G---------
tr|B4JTN5|B4JTN5_DROGR  KYG-KVCVCTADYC-DYLDNPTLSKDDDFAIISSSKQ---G---------
tr|F5CB37|F5CB37_PSECS  --------CNATYC-DSLDPLTLPDPGTFSRFESTRS---G---------
tr|E1ZYU8|E1ZYU8_CAMFO  --------------------------------------------------
tr|J2STU0|J2STU0_9FLAO  GKTARVILTNSTTN-EK-----LADKGTV-KF------------------
tr|F4E6W5|F4E6W5_BACAM  ---------YATDR-KAP-----DKNKVRVWYSSEKD---PASRTWYDGP
tr|G9BHQ3|G9BHQ3_BALAC  -------------C-DSLDPLALPDPGTFSRFESTRS---G---------
tr|F4X220|F4X220_ACREC  GNNSIVCVCNSTYC-DTVSKQKLQQ-NQLLWYTSTQD---G---------
pdb|pdb|2nsx_B          GYSSVVCVCNATYC-DSFDPPTFPALGTFSRYESTRS---G---------
tr|E5UPZ0|E5UPZ0_9BACE  ----AACLCACTDVTDVLPAEQI---------------------------
tr|G9BHQ5|G9BHQ5_SOUCH  -------------C-DSLDPLTLPDPGTFSRFESTRS---G---------
tr|C6A5Q0|C6A5Q0_BIFLB  --------------------------KTTVHYDVTAGRTHT---------
tr|D0TIX6|D0TIX6_9BACE  ---------------KTS-------DNVTV-YVTTND---R--------A
tr|B1QKT0|B1QKT0_CLOBO  -------------------------------YKTTKK---D---------
pdb|pdb|1y7v_A          GYSSVVCVCNATYC-DSFDPPTFPALGTFSRYESTRS---G---------
tr|D4SV88|D4SV88_9XANT  -----V--------------------------------------------
tr|A9UD58|A9UD58_INIGE  --------CNATYC-DSLDPLTLPDPGTFSRFESTRS---G---------
tr|A9UD54|A9UD54_PHOPH  --------CNATYC-DSLDPLTLPDPGTFSRFESTRS---G---------
tr|G9MUP6|G9MUP6_HYPVG  -----V--------------------------------------------
                                                                          

P04062                  --------RRMELSMGP--IQA----------------------------
tr|B5DYA3|B5DYA3_DROPS  --------LRFKVTTGD--LSNKAPLVVEDKQSTDENFHAEAIVVDQHRA
tr|B4JTN5|B4JTN5_DROGR  --------LRFELNTGS--FGSKDTYAIEDYVEPASKFAASNDTILSK-L
tr|F5CB37|F5CB37_PSECS  --------RRMELSLGT--IQA----------------------------
tr|E1ZYU8|E1ZYU8_CAMFO  --------------------------------------------------
tr|J2STU0|J2STU0_9FLAO  ---------------E----K-----------------------------
tr|F4E6W5|F4E6W5_BACAM  KEVKYALDEQTPLTL-----------------------------------
tr|G9BHQ3|G9BHQ3_BALAC  --------RRMELSLGT--IQA----------------------------
tr|F4X220|F4X220_ACREC  --------KRMQSSIMN--FSAK---------------------------
pdb|pdb|2nsx_B          --------RRMELSMGP--IQA----------------------------
tr|E5UPZ0|E5UPZ0_9BACE  ------------------P-------------------------------
tr|G9BHQ5|G9BHQ5_SOUCH  --------RRMELSLGT--IQA----------------------------
tr|C6A5Q0|C6A5Q0_BIFLB  --------EQTELSVMDEAMNT----------------------------
tr|D0TIX6|D0TIX6_9BACE  K--DF---VRSEIAL-----------------------------------
tr|B1QKT0|B1QKT0_CLOBO  ---KF-----LKNEI-----------------------------------
pdb|pdb|1y7v_A          --------RRMELSMGP--IQA----------------------------
tr|D4SV88|D4SV88_9XANT  --------------------V-----------------------------
tr|A9UD58|A9UD58_INIGE  --------RRMELSLGT--IQA----------------------------
tr|A9UD54|A9UD54_PHOPH  --------RRMELSLGT--IQA----------------------------
tr|G9MUP6|G9MUP6_HYPVG  --------------------A-----------------------------
                                                                          

P04062                  ----------------NHTGTGLLLTLQP-EQKFQKVKGFGGAMTDAAAL
tr|B5DYA3|B5DYA3_DROPS  W-LNLASI--PQRLFINASVKTVSVSVKR-DQRYQNVTNFGGALTGTVSH
tr|B4JTN5|B4JTN5_DROGR  WDQAIDSIFSQSATPASSITRSVTLKLDR-SKRFQKIEGFGGSFTGAVSY
tr|F5CB37|F5CB37_PSECS  ----------------NRTGTGLLLTLQP---------------------
tr|E1ZYU8|E1ZYU8_CAMFO  ---------------------SKVLTLDS-NKKHQQIFGFGGAMTDAAAL
tr|J2STU0|J2STU0_9FLAO  --------------FAQPKENEACIFVDP-DFKYQKLIGIGGAVTDAAAE
tr|F4E6W5|F4E6W5_BACAM  --------------TKKKASDSTAVYIDP-SHRYQSVLGIGSSLEESTIS
tr|G9BHQ3|G9BHQ3_BALAC  ----------------NRTGTGLLLTLQP-DQKFQK--------------
tr|F4X220|F4X220_ACREC  ----------------NESEIDLVLTVDI-NQKFQKIQGFGGAMTDAAAL
pdb|pdb|2nsx_B          ----------------NHTGTGLLLTLQP-EQKFQKVKGFGGAMTDAAAL
tr|E5UPZ0|E5UPZ0_9BACE  --------------ADARSTLGADVVLQW-NNEEQTIDGFGVAQAGWSDY
tr|G9BHQ5|G9BHQ5_SOUCH  ----------------NRTGTGLLLTLQP-DQKFQK--------------
tr|C6A5Q0|C6A5Q0_BIFLB  ----------------EHIVESNVVGIYP-DYTFQMMEGYGCSLTESACY
tr|D0TIX6|D0TIX6_9BACE  --------------GDKQAASPSVITIDP-SVRYQTMDGFGAAVTGSTCY
tr|B1QKT0|B1QKT0_CLOBO  ----------------NNTTDE-RPTLHVSQIENRIIEGFGSCFNELGMK
pdb|pdb|1y7v_A          ----------------NHTGTGLLLTLQP-EQKFQKVKGFGGAMTDAAAL
tr|D4SV88|D4SV88_9XANT  --------------GHALTEKENSIFVNP-QRQFQQVLGIGGAITDSSAE
tr|A9UD58|A9UD58_INIGE  ----------------NRTG------------------------------
tr|A9UD54|A9UD54_PHOPH  ----------------NRTGTGLLLTLQP---------------------
tr|G9MUP6|G9MUP6_HYPVG  --------------LTVPTTSATSIKINT-NSKLQRIDGFGFSQAFGRAS
                                                                          

P04062                  NILALSP-PAQNLLLKSYFS-EEGIGYNIIRVPMASCD-FSIRT-YTYAD
tr|B5DYA3|B5DYA3_DROPS  LLQLLPT-ELQDHVYKSYYH-DDGIAYNSIRTSIGGCD-FDLEP-WAYNE
tr|B4JTN5|B4JTN5_DROGR  LLNNFKEQDIQDHLYKSYYA-ADGLGFNLLRISIGGCD-FDLNP-WAYNE
tr|F5CB37|F5CB37_PSECS  --------------------------------------------------
tr|E1ZYU8|E1ZYU8_CAMFO  NIRTLSN-ETQRQLLESYFG-STGIGYTFSRIPIAGTD-FSTRP-YTYDD
tr|J2STU0|J2STU0_9FLAO  TFYKLPK-AKQKEIIDAYYG-KNGLGYTIVRTNMNSCD-FSSDS-YTYVE
tr|F4E6W5|F4E6W5_BACAM  NLSKMSP-GKRKEVLKKLVDPNEGIGMDVMRITIGTSD-FTAQEFYTYDD
tr|G9BHQ3|G9BHQ3_BALAC  --------------------------------------------------
tr|F4X220|F4X220_ACREC  NIKSLSN-NTQQILLESYFG-SKGIGYTFTRIPIAGTD-FSMRP-YTYDD
pdb|pdb|2nsx_B          NILALSP-PAQNLLLKSYFS-EEGIGYNIIRVPMASCD-FSIRT-YTYAD
tr|E5UPZ0|E5UPZ0_9BACE  LY---AHR-KRQEIMDVMFG-QDGLRLSILRGEVFP-HY-DETT-FNMDE
tr|G9BHQ5|G9BHQ5_SOUCH  --------------------------------------------------
tr|C6A5Q0|C6A5Q0_BIFLB  LLSKMDS-ATRKEALAQWFG-PAGMDAWFVRVHIDSCD-YSLSE-YQAVE
tr|D0TIX6|D0TIX6_9BACE  NLMRMAP-EDRTAFLKETFSDTEGMGYSYIRISIGCSD-FSLSE-YTCCD
tr|B1QKT0|B1QKT0_CLOBO  ALNHLDK-DERNKVLDQLFSIKGDCRFNLCRMPIGASD-YATEW-YSYNE
pdb|pdb|1y7v_A          NILALSP-PAQNLLLKSYFS-EEGIGYNIIRVPMASCD-FSIRT-YTYAD
tr|D4SV88|D4SV88_9XANT  TFAKLPK-RAQRALLTAYYDPQQGIGYTLARTTIHSSD-FSSGS-YTYIK
tr|A9UD58|A9UD58_INIGE  --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH  --------------------------------------------------
tr|G9MUP6|G9MUP6_HYPVG  QFQAAEP-EMRKKALDLLFDTKTGAGFSIIRNWIPSTTALSIEP-NSPGL
                                                                          

P04062                  TP---DDFQLHN----FSLPE-ED----------TKLKI-PLIHRALQLA
tr|B5DYA3|B5DYA3_DROPS  LPR--NDVALSN----FTELD-PR----------DLQKI-EQLKRLKSVA
tr|B4JTN5|B4JTN5_DROGR  EPQ--NEVVLTG----MDKLH-ER----------DVLRV-GQIKRMKEVS
tr|F5CB37|F5CB37_PSECS  --------------------------------------------------
tr|E1ZYU8|E1ZYU8_CAMFO  VP---NDFTLSN----FSLVG-ED-----------DYKI-EYLHRIKNIM
tr|J2STU0|J2STU0_9FLAO  D----NDTSLKS----FSLAH--D----------EKYKI-PMIKEAQKSI
tr|F4E6W5|F4E6W5_BACAM  MPEGRKDPKLRH----FSIQK-D-----------IDLHITATIKEALAI-
tr|G9BHQ3|G9BHQ3_BALAC  --------------------------------------------------
tr|F4X220|F4X220_ACREC  VP---DDLMLSH----FGLVE-ED-----------DYKI-KYLHNIKKIM
pdb|pdb|2nsx_B          TP---DDFQLHN----FSLPE-ED----------TKLKI-PLIHRALQLA
tr|E5UPZ0|E5UPZ0_9BACE  ------DINLSLDDPFFDIDFNRDENRVAEGIAQRNGQL-WIMKKAKQ--
tr|G9BHQ5|G9BHQ5_SOUCH  --------------------------------------------------
tr|C6A5Q0|C6A5Q0_BIFLB  DPL--ADPELET----FSIDR--D----------RQYIL-PVLKEAMAMA
tr|D0TIX6|D0TIX6_9BACE  TK------GVEN----FALQS-EE----------KEYVI-PILKEILAI-
tr|B1QKT0|B1QKT0_CLOBO  NE---NDFDMEK----FSIQK-D-----------KRLLI-PYIKEALKR-
pdb|pdb|1y7v_A          TP---DDFQLHN----FSLPE-ED----------TKLKI-PLIHRALQLA
tr|D4SV88|D4SV88_9XANT  E----GDAALKS----FSVKH--D----------AKYRI-PMLRQAIAAA
tr|A9UD58|A9UD58_INIGE  --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH  --------------------------------------------------
tr|G9MUP6|G9MUP6_HYPVG  A----S--NKPN----YTWDG--D----------DEGQI-WFTKQAVSY-
                                                                          

P04062                  Q--RPVSLLASPWTSPTWLKTNGAVNG-----------------------
tr|B5DYA3|B5DYA3_DROPS  R-MEELKIMAAAWSAPPWMKTNDRWTG-----------------------
tr|B4JTN5|B4JTN5_DROGR  G-ETNLRIKGAAWSPPKWMKTNNEWTG-----------------------
tr|F5CB37|F5CB37_PSECS  --------------------------------------------------
tr|E1ZYU8|E1ZYU8_CAMFO  SDPETLRIFTTSWSAPAWMKNTNNIK------------------------
tr|J2STU0|J2STU0_9FLAO  G--SSFKLYFSPWSPPAWMKSNKDMLK-----------------------
tr|F4E6W5|F4E6W5_BACAM  --NPKLKIIASPWSPPAWMKTNEN-------------------------L
tr|G9BHQ3|G9BHQ3_BALAC  --------------------------------------------------
tr|F4X220|F4X220_ACREC  SNPDEFRILTTAWSAPAWMKSSKSIT------------------------
pdb|pdb|2nsx_B          Q--RPVSLLASPWTSPTWLKTNGAVNG-----------------------
tr|E5UPZ0|E5UPZ0_9BACE  -EYGVDKLIFSVWSAPAYMKSNGSTS------------------------
tr|G9BHQ5|G9BHQ5_SOUCH  --------------------------------------------------
tr|C6A5Q0|C6A5Q0_BIFLB  G--HPIHVLLSPWSPPAQWKTPPEMTR-NDASVYGGEEGDVIDLSKPGRC
tr|D0TIX6|D0TIX6_9BACE  --SPSIKILGSPWTCPRWMKVDNLKDLRPF-----------------ESW
tr|B1QKT0|B1QKT0_CLOBO  --NPNIILTASPWSPPTWMKTQKA-------------------------Y
pdb|pdb|1y7v_A          Q--RPVSLLASPWTSPTWLKTNGAVNG-----------------------
tr|D4SV88|D4SV88_9XANT  G--GTLTTFASPWSAPAFMKDSKTMLK-----------------------
tr|A9UD58|A9UD58_INIGE  --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH  --------------------------------------------------
tr|G9MUP6|G9MUP6_HYPVG  ---GVKTIYADAWSAPGYMKTNGDEAT-----------------------
                                                                          

P04062                  -KGSLKGQ-----PGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPS
tr|B5DYA3|B5DYA3_DROPS  -FGQLK---------SEYYQTWALYHLKFLELMQSKNMPIWAISTGNEPL
tr|B4JTN5|B4JTN5_DROGR  -FGQLK---------REYYQTWANYHLKWLDLMESNGLPIWAISTGNEPL
tr|F5CB37|F5CB37_PSECS  --------------------------------------------------
tr|E1ZYU8|E1ZYU8_CAMFO  -WGALN---------PEYYQLYADYIKKFFDAYKERGINIWGMTPGNEPI
tr|J2STU0|J2STU0_9FLAO  -GGRLE---------NQYYQTWANYYIKFIQEYEKQGLNIWGLTVQNEPM
tr|F4E6W5|F4E6W5_BACAM  KRGKLK---------DKYISELAVYFRKFIEAYEKQGIPIYAMTLQNEPL
tr|G9BHQ3|G9BHQ3_BALAC  --------------------------------------------------
tr|F4X220|F4X220_ACREC  -WGILK---------SEYYQLYADYIVKFFDAYKERGINIWGITPGNEPL
pdb|pdb|2nsx_B          -KGSLKGQ-----PGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPS
tr|E5UPZ0|E5UPZ0_9BACE  -QGFLK---------RGSYQAFADYLSNFCDAYTAAGLPVYAISPANEPE
tr|G9BHQ5|G9BHQ5_SOUCH  --------------------------------------------------
tr|C6A5Q0|C6A5Q0_BIFLB  FGGRLK---------PEYYSSWARYLVRFISAYMAEGVPVTMLSIQNEAA
tr|D0TIX6|D0TIX6_9BACE  TSGQLN---------PAYYQDYATYFVKWIQAMEAEGIPIEAITPQNEPL
tr|B1QKT0|B1QKT0_CLOBO  NFGTLRF-------EEKVLKVYSLYFVKFVQAYEEEGITIHQVYVQNEVV
pdb|pdb|1y7v_A          -KGSLKGQ-----PGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPS
tr|D4SV88|D4SV88_9XANT  -GGKLL---------PEYAQAWATYYTRFIAAYEKAGIPIWGISLQNEPM
tr|A9UD58|A9UD58_INIGE  --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH  --------------------------------------------------
tr|G9MUP6|G9MUP6_HYPVG  -PGYLCGSTGHTCSTGDWRQAFANYLVQYVKFYKQEGLDITHLGFLNEPD
                                                                          

P04062                  AGLLS--GYPFQCLGFTPEHQ--RDFIARDLGPTLANSTHHN-VRLLML-
tr|B5DYA3|B5DYA3_DROPS  NGVIGFFFVHFMSMGWTPWQQ--AIWLSDHLGPTIRNSTQKP-VLIFGN-
tr|B4JTN5|B4JTN5_DROGR  NGIFFMFFVKFMSLGWTPQMQ--AVWLNDYLGPTIRNSKHKD-IIIFGN-
tr|F5CB37|F5CB37_PSECS  --------------------------------------------------
tr|E1ZYU8|E1ZYU8_CAMFO  DGLVP--FFPFNSMMWLPREG--ADWVVNHLAPTLSKAGYKD-LIYMAM-
tr|J2STU0|J2STU0_9FLAO  ATQ------TWESCLYTAEEE--GNFLKNNLGPTLWKNGYKD-KKIMIW-
tr|F4E6W5|F4E6W5_BACAM  LEI------DYPSMYMPPSQQ--RK-LAQALKKEMKKHLID-T-KIWIY-
tr|G9BHQ3|G9BHQ3_BALAC  --------------------------------------------------
tr|F4X220|F4X220_ACREC  NGFIP--FFTFNSMGWTPNTS--AVWTVKHLAPTLTNAGYNP-LY-IAM-
pdb|pdb|2nsx_B          AGLLS--GYPFQCLGFTPEHQ--RDFIARDLGPTLANSTHHN-VRLLML-
tr|E5UPZ0|E5UPZ0_9BACE  YAA------SWNSCLWLPGTTTLGPFIVNNLGPKLRQTHP-E-TRIIFG-
tr|G9BHQ5|G9BHQ5_SOUCH  --------------------------------------------------
tr|C6A5Q0|C6A5Q0_BIFLB  AAT------SWDSCLWTGDQE--REFLKHHLYPAMEEAGLTDAVKIFIW-
tr|D0TIX6|D0TIX6_9BACE  NRG------NSASLFMGWEEQ--LSFVRDALGPKLKETGLK-T-KIYAFD
tr|B1QKT0|B1QKT0_CLOBO  ADQ------KFPSCRWTGDQL--RDFIKNYLGLAFEKHNIS-S-EIWLGT
pdb|pdb|1y7v_A          AGLLS--GYPFQCLGFTPEHQ--RDFIARDLGPTLANSTHHN-VRLLML-
tr|D4SV88|D4SV88_9XANT  AVQ------TWESMLFSAEEE--RDFLKHHLGPTMASAGYGE-RKIIVW-
tr|A9UD58|A9UD58_INIGE  --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH  --------------------------------------------------
tr|G9MUP6|G9MUP6_HYPVG  YIA------SYSQMQISPSAQEAISFI-PTLYETVKRE-HLD-LRLTCC-
                                                                          

P04062                  -----------DDQRLLLP--------HWAKV-VLTDPEAAKYVHGIAVH
tr|B5DYA3|B5DYA3_DROPS  -----------DDQRYTFP--------SWFRKMRSSRSNSLSYLDGLAVH
tr|B4JTN5|B4JTN5_DROGR  -----------DDQRFTSP--------LWFKMMNRTRPNSVDYIDGVALH
tr|F5CB37|F5CB37_PSECS  --------------------------------------------------
tr|E1ZYU8|E1ZYU8_CAMFO  -----------DDQRMLLP--------WYVET-MFTNQKAKEVFSGTAIH
tr|J2STU0|J2STU0_9FLAO  -----------DHNRDLMF--------QRATT-TLSDPETSKYASGIGYH
tr|F4E6W5|F4E6W5_BACAM  -----------DHNASGAW--------NYIPP-ILDDKKGNQAADGIAFH
tr|G9BHQ3|G9BHQ3_BALAC  --------------------------------------------------
tr|F4X220|F4X220_ACREC  -----------DDQRFEIP--------WFTEL-MFEYPKTKELFSGTAVH
pdb|pdb|2nsx_B          -----------DDQRLLLP--------HWAKV-VLTDPEAAKYVHGIAVH
tr|E5UPZ0|E5UPZ0_9BACE  -----------ENAQWSAILGFIMGSKNYVRDILNLNPKITNFPVIAAGH
tr|G9BHQ5|G9BHQ5_SOUCH  --------------------------------------------------
tr|C6A5Q0|C6A5Q0_BIFLB  -----------DHNKERAI--------EHIDE-FMSDPEAAKEVGGFAYH
tr|D0TIX6|D0TIX6_9BACE  HNYN--Y-----DNMLEQQ--------GYPMK-IYEDENAASFLTGAAYH
tr|B1QKT0|B1QKT0_CLOBO  INAPEPYVEWLEDYTQDFD--------VYAGL-VLRDPKAYKYVKGVGYQ
pdb|pdb|1y7v_A          -----------DDQRLLLP--------HWAKV-VLTDPEAAKYVHGIAVH
tr|D4SV88|D4SV88_9XANT  -----------DHNRDMMV--------HRAHV-IFDDPEAAKYAWGMGFH
tr|A9UD58|A9UD58_INIGE  --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH  --------------------------------------------------
tr|G9MUP6|G9MUP6_HYPVG  -----------DATGW------------------DTQANYTNYLMAAGMQ
                                                                          

P04062                  WYLDFLAPAK--ATLGETHRLFPN--TMLFASEACVGSKF----------
tr|B5DYA3|B5DYA3_DROPS  WYWDELVG-P--QLIDQAHAEMPN--MLLLNTESCIGDKPWQ--------
tr|B4JTN5|B4JTN5_DROGR  WYWDEIFG-N--SFIHKTNKYMEN--KIQIISESCIGDKPWQ--------
tr|F5CB37|F5CB37_PSECS  --------------------------------------------------
tr|E1ZYU8|E1ZYU8_CAMFO  WYADKQFS-P--DRLTRTHNKYPN--KFMLITEACTGTFPTN--------
tr|J2STU0|J2STU0_9FLAO  WYEVWHNKTQLFDNVIETYRAFPD--KFLAFTEGCKEV------------
tr|F4E6W5|F4E6W5_BACAM  DYDGDL------SVMSEIGRRYPD--KSIHLTERSVWG------------
tr|G9BHQ3|G9BHQ3_BALAC  --------------------------------------------------
tr|F4X220|F4X220_ACREC  WYADEIFS-P--IRLSQLHDKYPD--KFILMSEACTGSSPFN--------
pdb|pdb|2nsx_B          WYLDFLAPAK--ATLGETHRLFPN--TMLFASEACVGSKF----------
tr|E5UPZ0|E5UPZ0_9BACE  GYVDPVTG-K--DPAIEPFSKAESKGIPVWLTEISDPTE-----------
tr|G9BHQ5|G9BHQ5_SOUCH  --------------------------------------------------
tr|C6A5Q0|C6A5Q0_BIFLB  WYSGDHF-----EALSMLRGKYPD--KVLMHSESCGLHIPGKVTMLDMTD
tr|D0TIX6|D0TIX6_9BACE  NYGGDR------EELNNVNGKFPD--KELIFTETSIGM------------
tr|B1QKT0|B1QKT0_CLOBO  WAGK--------NAIQRSVEAFPE--KRFIQTENECGN------------
pdb|pdb|1y7v_A          WYLDFLAPAK--ATLGETHRLFPN--TMLFASEACVGSKF----------
tr|D4SV88|D4SV88_9XANT  WYETWAGFEPMVENVAAVAQAYPD--KHLLLTEAAVEK------------
tr|A9UD58|A9UD58_INIGE  --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH  --------------------------------------------------
tr|G9MUP6|G9MUP6_HYPVG  KYLDIISS--HMYSSDATFPLKTN--LPTWLTEAGVETSS----------
                                                                          

P04062                  --------------WE-QSVRLGSWDRGMQYSHSIITNL--------LYH
tr|B5DYA3|B5DYA3_DROPS  ----------------THGPELGSWQRGENYMRAYIQDF--------QHN
tr|B4JTN5|B4JTN5_DROGR  ----------------KAAPLLGSWERGEKMARSMMSHL--------QDG
tr|F5CB37|F5CB37_PSECS  --------------------------------------------------
tr|E1ZYU8|E1ZYU8_CAMFO  -------------PF-EPKVSLGSWSRGELYMLDIIENL--------SHY
tr|J2STU0|J2STU0_9FLAO  --------------FKMS--GIEDVKLGELYGKNMINDF--------NRG
tr|F4E6W5|F4E6W5_BACAM  -------------------------TE---GADRIA--------QYFRNG
tr|G9BHQ3|G9BHQ3_BALAC  --------------------------------------------------
tr|F4X220|F4X220_ACREC  ----------------KEKVILGSWKRGQKYALNIIENL--------SHW
pdb|pdb|2nsx_B          --------------WE-QSVRLGSWDRGMQYSHSIITNL--------LYH
tr|E5UPZ0|E5UPZ0_9BACE  -------------SYD------ATMTSGLKWAKKFHRFL--------CEA
tr|G9BHQ5|G9BHQ5_SOUCH  --------------------------------------------------
tr|C6A5Q0|C6A5Q0_BIFLB  EQIEALPDGDYKTMVQTTTPNEMDFNDATAYAHDIIGDL--------NHG
tr|D0TIX6|D0TIX6_9BACE  ------------------------WNDGRNLEKCLMEDMEETALGTVNNW
tr|B1QKT0|B1QKT0_CLOBO  ------------------------GKNTWIYAEYVFNLFR----HYIVNG
pdb|pdb|1y7v_A          --------------WE-QSVRLGSWDRGMQYSHSIITNL--------LYH
tr|D4SV88|D4SV88_9XANT  --------------FDPA--KLQYWPNGERYGTAIINDL--------NHG
tr|A9UD58|A9UD58_INIGE  --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH  --------------------------------------------------
tr|G9MUP6|G9MUP6_HYPVG  ------------APFTTTWYDDGALNEGMTWASKLATGF-------VDAG
                                                                          

P04062                  VVGWTDWNLALNPEGGPNWVRNFVD--SPIIVDIT-KDTFYKQPMFYHLG
tr|B5DYA3|B5DYA3_DROPS  FNGWLDWNLVLDEKGGPNYVNNFVD--APIIVNATSRSEIYKQPIYYAIG
tr|B4JTN5|B4JTN5_DROGR  FHGWIDWNIILDEEGGPNYVDNFVD--APVIADTITYTEFYKQPMFYVMG
tr|F5CB37|F5CB37_PSECS  --------------------------------------------------
tr|E1ZYU8|E1ZYU8_CAMFO  VSGWVDWNLALNKTGGPNWVENYVD--SPIIVIPE-EDQFYKQPMFYAIA
tr|J2STU0|J2STU0_9FLAO  TALWTDWNVLLDETGGPNHVGNFCF--APIIGDTK-TGEVHYTYEYYYIG
tr|F4E6W5|F4E6W5_BACAM  ASSYNAWVTMLDSQIKTHHWIGTPD-PTLFIQDAKNPDRYWNIPIYHMTG
tr|G9BHQ3|G9BHQ3_BALAC  --------------------------------------------------
tr|F4X220|F4X220_ACREC  MVGWIDWNMALDEYGAPNWAKNYVD--SPIIVMPQ-TDEFYKQPMFYAIS
pdb|pdb|2nsx_B          VVGWTDWNLALNPEGGPNWVRNFVD--SPIIVDIT-KDTFYKQPMFYHLG
tr|E5UPZ0|E5UPZ0_9BACE  NTGAIVWWAGAIPDGGTT------E--GLINIEK-NRVDYEVTKRCEVFG
tr|G9BHQ5|G9BHQ5_SOUCH  --------------------------------------------------
tr|C6A5Q0|C6A5Q0_BIFLB  MQRWIDWNMIVDRQGGPRHTPGGFA--APIVAED--DGRYTLTISYRYIR
tr|D0TIX6|D0TIX6_9BACE  CKAVIVWNLMLDNERGPNREGGCQTCYGAVDIDRSDYKTITRNSHYYIIG
tr|B1QKT0|B1QKT0_CLOBO  VNGYMYWNAVLEPKGMST-WGWEQN--SMITVNPETK-EVMYNPEFYVMK
pdb|pdb|1y7v_A          VVGWTDWNLALNPEGGPNWVRNFVD--SPIIVDIT-KDTFYKQPMFYHLG
tr|D4SV88|D4SV88_9XANT  AVGWTDWNILLDQHGGPNHVGNYCF--APVHADTR-TGEVIYTPSYWYIG
tr|A9UD58|A9UD58_INIGE  --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH  --------------------------------------------------
tr|G9MUP6|G9MUP6_HYPVG  LSAYLFWEGFEISQ-------NQ-S--ASHLVDVL-GQDPEPSSIYYAFT
                                                                          

P04062                  HFSKFIPEGSQRVGLVASQK----NDLDAVALMHPDGSAVVVVLNRSSKD
tr|B5DYA3|B5DYA3_DROPS  HFSKFLPAQSVRIETRIEGENNSFSQLSVVGFQRPDGSVALIVYNGQNLP
tr|B4JTN5|B4JTN5_DROGR  HFSKLVPEGSVHIEAVA-SN----INLDCIAFIRPDNKIVAVLFNSGRAD
tr|F5CB37|F5CB37_PSECS  --------------------------------------------------
tr|E1ZYU8|E1ZYU8_CAMFO  HFSKFVPRNSYVIFSTLEE-RFKEENIKSIAFLTPEQKIVIVIVNKGKNP
tr|J2STU0|J2STU0_9FLAO  HLSKYIKPNAHRVASSTN-E----SGLLSTSFMNENGQLVTVIMNDSDHD
tr|F4E6W5|F4E6W5_BACAM  NFSKFVDRGAKRIESNYGSK----NTVSNVSFLNPDQSIVTVVINQTSAE
tr|G9BHQ3|G9BHQ3_BALAC  --------------------------------------------------
tr|F4X220|F4X220_ACREC  HFSQFVPRNSYRILSTGLE---DNPNIKTIAFLTPENCITVVAVNKAYTP
pdb|pdb|2nsx_B          HFSKFIPEGSQRVGLVASQK----NDLDAVALMHPDGSAVVVVLNRSSKD
tr|E5UPZ0|E5UPZ0_9BACE  NFSRYIPVGSKRISAQYDFE----QGYMVSGYKYGDNGYTVVAINPADHE
tr|G9BHQ5|G9BHQ5_SOUCH  --------------------------------------------------
tr|C6A5Q0|C6A5Q0_BIFLB  EIAQAIKPNAVVLGTSTY-S----RDIEAVSARNADGSIGVVLLNQAERD
tr|D0TIX6|D0TIX6_9BACE  HLSSVVKPGAVRIGSKGYTA----DGIMYSAFENLDGTEALVLLNNTDGT
tr|B1QKT0|B1QKT0_CLOBO  HFSHFVQKGAKRLTTS-G-V----DSVDTVAFKNLDESIIIVISNKNDDS
pdb|pdb|1y7v_A          HFSKFIPEGSQRVGLVASQK----NDLDAVALMHPDGSAVVVVLNRSSKD
tr|D4SV88|D4SV88_9XANT  HFSKFIRPGARRVSAASS-R----SNLATTAFRNTDGSLAMVVMNASDVA
tr|A9UD58|A9UD58_INIGE  --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH  --------------------------------------------------
tr|G9MUP6|G9MUP6_HYPVG  MWSRFIRPGANRVAVSGA-L----PNVITAAFQNTDKSVIVIFTNSGNSS
                                                                          

P04062                  VP--LTIKD------------------------------------PAVG-
tr|B5DYA3|B5DYA3_DROPS  VD--VALND------------------------------------SQSG-
tr|B4JTN5|B4JTN5_DROGR  LD--ITIVD------------------------------------TIRG-
tr|F5CB37|F5CB37_PSECS  --------------------------------------------------
tr|E1ZYU8|E1ZYU8_CAMFO  IP--LTIKD------------------------------------TVRGK
tr|J2STU0|J2STU0_9FLAO  --------------------------------------------------
tr|F4E6W5|F4E6W5_BACAM  QK--FHVVS------------------------------------ED--R
tr|G9BHQ3|G9BHQ3_BALAC  --------------------------------------------------
tr|F4X220|F4X220_ACREC  ST--ITIKN------------------------------------KNKNN
pdb|pdb|2nsx_B          VP--LTIKD------------------------------------PAVG-
tr|E5UPZ0|E5UPZ0_9BACE  VV--ISLALESAQVSGALQGY---------VTDDTRKWELVEAVQPADG-
tr|G9BHQ5|G9BHQ5_SOUCH  --------------------------------------------------
tr|C6A5Q0|C6A5Q0_BIFLB  IP--VNIRM------------------------------------GGLL-
tr|D0TIX6|D0TIX6_9BACE  KN--ITVNS------------------------------------GE--R
tr|B1QKT0|B1QKT0_CLOBO  RI--ANIEF------------------------------------TG--E
pdb|pdb|1y7v_A          VP--LTIKD------------------------------------PAVG-
tr|D4SV88|D4SV88_9XANT  IA--YNLY-------------------------------------VGE-A
tr|A9UD58|A9UD58_INIGE  --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH  --------------------------------------------------
tr|G9MUP6|G9MUP6_HYPVG  QLADVAIPTG---KKSSAQVWLTDNNHRVHE----------TNFKRQS-S
                                                                          

P04062                  FLETISPGYSIHTYLW-----RRQ
tr|B5DYA3|B5DYA3_DROPS  AFNLLLPPRSWHTVL-------YK
tr|B4JTN5|B4JTN5_DROGR  ELKVNVPAKSIHTLY-------YN
tr|F5CB37|F5CB37_PSECS  -----------------------D
tr|E1ZYU8|E1ZYU8_CAMFO  TISVTLPGKSFHTISY------SA
tr|J2STU0|J2STU0_9FLAO  ----------------------TE
tr|F4E6W5|F4E6W5_BACAM  QFEAVIPAKTVATYKW----QHKK
tr|G9BHQ3|G9BHQ3_BALAC  ----------------------VK
tr|F4X220|F4X220_ACREC  VVNVCLPAKSFNTLLY----LAQE
pdb|pdb|2nsx_B          FLETISPGYSIHTYLW-----HRQ
tr|E5UPZ0|E5UPZ0_9BACE  VYTLTLPARSVVSYTGTVLSSSSL
tr|G9BHQ5|G9BHQ5_SOUCH  ----------------------VK
tr|C6A5Q0|C6A5Q0_BIFLB  VADVPLPARTLSTLVF------TE
tr|D0TIX6|D0TIX6_9BACE  SFTYEVPAKAVASFRW-----NLY
tr|B1QKT0|B1QKT0_CLOBO  IFEVELEGHSFNTIV-------LE
pdb|pdb|1y7v_A          FLETISPGYSIHTYLW-----HRQ
tr|D4SV88|D4SV88_9XANT  SSTLQIPAHAIQTVVL------GP
tr|A9UD58|A9UD58_INIGE  -----------------------T
tr|A9UD54|A9UD54_PHOPH  -----------------------D
tr|G9MUP6|G9MUP6_HYPVG  SIEVAVPPNSVVTVKF-----TSR