Multiple Sequence Alignment: Muscle - set 2

From Bioinformatikpedia
Revision as of 14:53, 6 May 2013 by Gerkej (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)

The native protein is colored red in the Alignment.

MUSCLE (3.8) multiple sequence alignment


tr|I9HH59|I9HH59_BACOV      ----------------MKTQ----SCMNRLLWITLLVIGLSGC-------------SEES
P04062                      MEFSSPSREECPKPLSRVSIMAGSLTGLLLLQAVSWASGARPCIPKSFGYSSVVCVCNAT
tr|I1WBF3|I1WBF3_BIFAR      ----------------MIQA----------------FSTYANA-------------QGTT
tr|D0TN48|D0TN48_9BACE      ----------------MIDM------RNIALTFLGCFTILAAC------------SNSDD
tr|B5QQZ8|B5QQZ8_LACRH      --------------------------------------------------------MTTT
tr|Q21GD0|Q21GD0_SACD2      ----------------MENI-------FHLKKAAFIFCALTSCYNSTASSQQDDYSVTAT
tr|E2LY19|E2LY19_MONPE      ----------------MRPL--------------AFSILLSVC-------------TPIA
tr|K9HBW2|K9HBW2_AGABB      ----------------MQQF--------------AIILILASC-------------VSAQ
tr|H6CEV7|H6CEV7_9BACL      ----------------MKKLQKQRRANLWLLVAAAAILIFAVL-------------VSMV
tr|B1VPJ0|B1VPJ0_STRGG      ------------------------------------MAALGVD-------------ASVG
                                                                                        

tr|I9HH59|I9HH59_BACOV      SSSEENTE---------------------------------SGTIQDGDH-TDNATVIQL
P04062                      YCDSFDPPTFPALGTFSRYESTRSGRRMELS----------MGPIQANHT--GTGLLLTL
tr|I1WBF3|I1WBF3_BIFAR      LAAAFAPLG---------------NACLRVG----------RTPESTAHA---SAPTLSI
tr|D0TN48|D0TN48_9BACE      AEKPVTPVPTGDVTIYATTS----SLTRDLT----------RDAVNFSSKDNLAPTSITL
tr|B5QQZ8|B5QQZ8_LACRH      EKGLYPTE------FWTVTAGDLAQKRDHLA--TP------KPETTPGDA-----AKIVI
tr|Q21GD0|Q21GD0_SACD2      VSTEFNPMSS----SWYTNPWPESDIPRRLEQLTP------SVITQLGQT---SGTLLEV
tr|E2LY19|E2LY19_MONPE      GQQIWD--------IWQTTW----DRSKLFTSTPA------NPPINFGTPSSIGQADIVV
tr|K9HBW2|K9HBW2_AGABB      YA-IWD--------TWSTTW----ERSNLFTSFKP------NPPISFGPVSGTGQADIRI
tr|H6CEV7|H6CEV7_9BACL      IQKILKPEAEHDVSMWLTTP----DPANRLTQQAPIHWKNDNSKESIEKAAISDTLTVEV
tr|B1VPJ0|B1VPJ0_STRGG      TARAADPAAQ----VWITTP----DGAKKLS---P------EGNVPFTGS--PQAVDIRV
                                                                                     : :

tr|I9HH59|I9HH59_BACOV      NSSDQYQTVEGIGGGIAN---YENWYCQHPNKK---ELFDLIF----KDL---EISMIRI
P04062                      QPEQKFQKVKGFGGAMTDAAALNILALSPPAQN---LLLKSYF-SE-EGI---GYNIIRV
tr|I1WBF3|I1WBF3_BIFAR      DTTRVRQPIDGFGASITEATSW-LWHNRVTDKE---RCIRDLFSPR-DGI---GISMLRQ
tr|D0TN48|D0TN48_9BACE      NPTEQYQTMDGFGAAITGATCFNLLQMKPEDRH---AFLTETFSDD-KGF---GFSYIRI
tr|B5QQZ8|B5QQZ8_LACRH      DPADRHQEWIGAGAAITDAAASLIWKQSKEQRS---ALLHEMFDPE-EG----HFSTIRI
tr|Q21GD0|Q21GD0_SACD2      DPSTTYQTLLGLGASLEHTTVYAIRKNKTAEQQK--EVLRSLIDPV-QGM---GMNFFRV
tr|E2LY19|E2LY19_MONPE      NDNQVLQNIYGFGSSLTDNSAMLMNNLKQRNSGNYWNMLNYLFSPT-DGANAAGLTYIRV
tr|K9HBW2|K9HBW2_AGABB      DDTSTFQSVWGFGGSLTDSSALTLNNLKSRNSASYRSLLNYLFNPT-DDMNAAGFSYMRI
tr|H6CEV7|H6CEV7_9BACL      KPDIRYQKMEGFGAAVSGSSAYLMNHGMSANQRD--QLLNDLF-TA-SGI---QLSYIRH
tr|B1VPJ0|B1VPJ0_STRGG      DASDKGQKFTGAGASVTGASAHLLQSLPQAQRT---TVLRSLFSSEGDGI---GLNYLRQ
                            .     *   * *..:                      :   :    ..      . :* 

tr|I9HH59|I9HH59_BACOV      GN---------------------W-YEKKI------SGENPDI----------LKQQKE-
P04062                      PMASCDFSIRT------------YTYADTP---DDFQLHNFSL----------PEEDTKL
tr|I1WBF3|I1WBF3_BIFAR      PIGPSDHVSAP------------YRFVRRF---PDRKLSSLNF----------TPEMER-
tr|D0TN48|D0TN48_9BACE      SIGCSDFSLSE------------YTCCDTK------GIEHFAL---------QSEEKDY-
tr|B5QQZ8|B5QQZ8_LACRH      PLGSCEPASQPY-----------YTYDDVPFGEHDASLSKFSVGEGEPGAPDATKDLKY-
tr|Q21GD0|Q21GD0_SACD2      SIGTSDFADGTRAIPAPDNAKGWYSYQDTP-------TSPFSI----------ARDESLG
tr|E2LY19|E2LY19_MONPE      PLGASDFSSSV------------YSFDDTA---NDRSLNTFNV----------NRAPSY-
tr|K9HBW2|K9HBW2_AGABB      PLGASDFSASA------------YSYDDTP---GDTSFNNFDI----------NRTPSY-
tr|H6CEV7|H6CEV7_9BACL      TIGASDYSVDEQGQPAS------YTYDDVA-TGKDYELNHFSI----------AKDRD--
tr|B1VPJ0|B1VPJ0_STRGG      PLGSTDFDANGNA----------YTYEDTR--------GAFSI----------DRDRSQ-
                                                   :                  .                 

tr|I9HH59|I9HH59_BACOV      IMDAATQRLG------RSNFSVMMSNWLVAPDLIDRP-------KEKGATLKRNNEGKYM
P04062                      KIPLIHRALQLA----QRPVSLLASPWTSPTWLKTNG-------AVNGKGSLKGQPGDIY
tr|I1WBF3|I1WBF3_BIFAR      VLPMVEAANNCALATQSHALNIMASPWSAPWWMKTNLSVLGKRRYTRITGHLRRG----M
tr|D0TN48|D0TN48_9BACE      ILPILKEILSI-----NPSIKVIAAPWTCPKWMKVKSLTDLTPLDSWTNGQLNPA----Y
tr|B5QQZ8|B5QQZ8_LACRH      LIPVVQEILAI-----NPAVKIMASPWSAPAWMKSTG-------ELKMGGHLRFG----E
tr|Q21GD0|Q21GD0_SACD2      IIETIRMAVEVGVET-NNELKILASPWSPPRWMREGD-------NMVDGGPLKAD----M
tr|E2LY19|E2LY19_MONPE      LFTVLKDIQSV-----NPLIKVHVIPWSPPAWMKNSN-------TM-KGGSLNSN----Q
tr|K9HBW2|K9HBW2_AGABB      VFSVLNDIKAV-----NNIMRFHFIPWSPPGWMKDSG-------TM-KGGALKPE----L
tr|H6CEV7|H6CEV7_9BACL      VIDVLKQIMRR-----NQDLQIMGTPWTAPPWMKYGE-------QIYNGWYLDYTDPR-V
tr|B1VPJ0|B1VPJ0_STRGG      IIPVLKQATAI-----NPAIRFMGSPWSPPAWMKTDN-------SL-NGGSLRPE----H
                             :                 . .    *  .  :                           

tr|I9HH59|I9HH59_BACOV      YKE------------FGEWCRMTLKAYQEADMSPDYLSMMNEP-DGDNSAGTKIRLGYGI
P04062                      HQT------------WARYFVKFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQCLGFTP
tr|I1WBF3|I1WBF3_BIFAR      YAA------------YARYITGFARLYAQRGLPLFALTVTNEP---DYPQSRWPSMAMTP
tr|D0TN48|D0TN48_9BACE      YQD------------YATYFVKWVQAFNAEGIDIYAVTPQNEP----LNRGNSASLYMSW
tr|B5QQZ8|B5QQZ8_LACRH      YTNNGYAIKDTFEGVYAQYFVRYLEEYRKYGIPIYAITIQNEP----SNAAAWPAMIWKI
tr|Q21GD0|Q21GD0_SACD2      LDD------------YAAYLRKFVEAYQAEGIPIYALSMQNER---QFEPGAYPGMVITW
tr|E2LY19|E2LY19_MONPE      VQT------------YAQYLLKSLQGFRNNGIPLYAISVQNEP---QNNNPTYPTSTYSP
tr|K9HBW2|K9HBW2_AGABB      VDE------------YATYLLKCVQGWNSKGFRAYAVSAQNEP---LNSNPTYPTSKLTA
tr|H6CEV7|H6CEV7_9BACL      YSA------------YADYFVRYIQAYANEGVPIQAISIQNEP---EFTTSKYPSMSMGA
tr|B1VPJ0|B1VPJ0_STRGG      YQA------------YADYLVKAIRAYGQEGITLTDLTAQNEP----EFATSYPSMSMTS
                                           :. :       :    .    ::  **                  

tr|I9HH59|I9HH59_BACOV      DDSQK---ANYGKALDATYEA-----FKEVSKRPKLIGPEVLGIGYGTFSNYYRDLNPDL
P04062                      EHQRDFIARDLGPTLANSTHH----NVRLLMLDD-----QRLLLPHWAKVVLTDPEAAKY
tr|I1WBF3|I1WBF3_BIFAR      REQAEFVARHLRPMLDHAGLD----GTRILCWDHNYS-TDHYPDGAFVRDMYADSAALAA
tr|D0TN48|D0TN48_9BACE      EEQRDFVKTALGPKFKTAGLA-----TKIYAYDHNYDYSDIETEKNYPGKMYEDAAASQY
tr|B5QQZ8|B5QQZ8_LACRH      PELAHFGYKFLRPALDKT-FP----DTKIYFWDGSL---NVLDVIDKPLSELVTPDEAAA
tr|Q21GD0|Q21GD0_SACD2      QMERDLLIEVYENFHNIDGNYGPELDVKLWTLDHNF---DYWQQAKLQLDSFKAMGKDHY
tr|E2LY19|E2LY19_MONPE      QLEAQ-VGSALRSLMNNNGFG----SVKLIGYDHNW---DN--AGTYPVQLM--DAAPNA
tr|K9HBW2|K9HBW2_AGABB      AQEAQ-IGLRLRSLLNSNGFS----DTKIVGYDHNW---SN--AGGYPVQLMQDAG--SA
tr|H6CEV7|H6CEV7_9BACL      AEQAKFIKQYLGPALSRNHLP-----TQIIAFDHNW---DI--GSDYAKTVLGDEQARSY
tr|B1VPJ0|B1VPJ0_STRGG      AQQADFL-RVLDRALTAANLP-----TNILAYDHNW---DH---PNYPLDVFARTGGIQR
                                                       .           .                    

tr|I9HH59|I9HH59_BACOV      LDAAAFHCY----HGGKTSDYKDNDRYSSAHAFKTEFQNIVRQVGNKSIMMTENCSYHPA
P04062                      VHGIAVHWYLDFLAPAKATLGETHRLFP-----------------NTMLFASEACV--GS
tr|I1WBF3|I1WBF3_BIFAR      CAGSAWHYY----GGSARTMSRIHDAFP-----------------NKGIWVTEASG---G
tr|D0TN48|D0TN48_9BACE      LAGAAYHNY----GGNREELLNIHKAYP-----------------EKELLFTETSI---G
tr|B5QQZ8|B5QQZ8_LACRH      FDGFAFHTY----DGPYTNLFKGSRLNP-----------------NWKLAMTERRCMIEE
tr|Q21GD0|Q21GD0_SACD2      VDATAFHHY----GGVSENMGQLHDAHP-----------------DKDVVFTE------G
tr|E2LY19|E2LY19_MONPE      FAGVAFHCY----AGSVSQQDQFRNRYP-----------------NKEVYFTECSGTLGS
tr|K9HBW2|K9HBW2_AGABB      FDGVSFHCY----AGNVSQQDTFHSQFS-----------------DKQIYFTECSGTFGS
tr|H6CEV7|H6CEV7_9BACL      THGTAFHCY----KGEPTAMTDVHHAFP-----------------DKPVYMTECSG---G
tr|B1VPJ0|B1VPJ0_STRGG      IIGAAFHCY----GGAPAAQKQIADA-------------------GKRVFFTECSGTDSA
                              . : * *                                       :  :*       

tr|I9HH59|I9HH59_BACOV      VPEDAVNIAHFISN--SFRYANATVYLHWA--------LLWGYADADELKKGGDGCIAVE
P04062                      KFWEQSVRLGSWDRGMQYSHSIITNLLYHVVG-----WTDWNLALNPEGGPNWVRNFVDS
tr|I1WBF3|I1WBF3_BIFAR      DWGPRNFTPALL----SLGTAVIDMMNNWARS-----AVLWNIALDEHGGPDYYYLRNDR
tr|D0TN48|D0TN48_9BACE      TWNSGRDLSKRLLE--DMKEVALGTINNWCRG-----VIVWNLMLDNDRAPNREGGCQTC
tr|B5QQZ8|B5QQZ8_LACRH      TPE-------------DASHIMFGLIGNWLVRQGLNMIDLWNIALDERGLPNQVGSTGR-
tr|Q21GD0|Q21GD0_SACD2      TIWGLSSDGNKR----SYEAL-IRHFRNWATG-----YLSWVTMTTQTLNEANQGPYNGL
tr|E2LY19|E2LY19_MONPE      DWWT------------DLKVR----------------LKSFSVLFQVNACSVVHGQ----
tr|K9HBW2|K9HBW2_AGABB      DWWS----DIKW----YMDNIAIGSIERSSHT-----GLMWNIALDGSGNPKLPGTSS-C
tr|H6CEV7|H6CEV7_9BACL      AWSPGFGDDLSW----DMSKLIIGAPRNWSQN-----VLFWNIVLDPSGGPTNGGCTN-C
tr|B1VPJ0|B1VPJ0_STRGG      NPATTFGDTLKW----HAENLVVQNMRNGGET-----VINWNLALDRNGGPHQGHCTNRC
                                                                    :                   

tr|I9HH59|I9HH59_BACOV      -----WPWSSSRWTTEKGYVVRSEFYGLKHFTKYVKP---GWRRIGVDYE-----LKEVE
P04062                      -----PIIVDITK---DTFYKQPMFYHLGHFSKFIPE---GSQRVGLVASQ----KNDLD
tr|I1WBF3|I1WBF3_BIFAR      RHSENRGLITVRDD--GSIRRNADYYALGHFSKYVPI---GSHCVECALDH----AQGVR
tr|D0TN48|D0TN48_9BACE      -----YGAVDISNSDYKTIIRNSHYYIIAHLSSVVKP---GAVRIGASGYA----DSNIM
tr|B5QQZ8|B5QQZ8_LACRH      -----RGVVTIDHTT-GKVQRNLEYYMLRNFNQDVIP---GSIVIGSTNYTQDGYTGGLG
tr|Q21GD0|Q21GD0_SACD2      GAFDPTLLVKYDGDN-ANWYKTPEYWLMSQFSKYLKP---GALRIESNYGS----LQTVT
tr|E2LY19|E2LY19_MONPE      -------------------------YLLGKLVNHVYA-----------------------
tr|K9HBW2|K9HBW2_AGABB      GGPGCRPLVTVNSD--GTWSVNQEFYALAQASKAILPRDVGGPFGKRIGVS----VGGEL
tr|H6CEV7|H6CEV7_9BACL      -----RGVVTIDPLS-GAVTKNVEYYALGHASKFVRP---GAVRIDSTHY-----SGSIE
tr|B1VPJ0|B1VPJ0_STRGG      -----NGIVEIDG---GQVTRNAEFYVLGHVSKFVKA---GATRIGSTSQG----AGGVQ
                                                     : : :  . :                         

tr|I9HH59|I9HH59_BACOV      VVAFQDPDEYQIAVV---------------------------------------------
P04062                      AVALMHPDGSAVVV----------------------------------------------
tr|I1WBF3|I1WBF3_BIFAR      AAAFLTPTGTLVAVLAN-------------------------------------------
tr|D0TN48|D0TN48_9BACE      YSAFENPDGTYAFV----------------------------------------------
tr|B5QQZ8|B5QQZ8_LACRH      SVAFLAPDGAIAAH----------------------------------------------
tr|Q21GD0|Q21GD0_SACD2      NVAFLNPDGYVVLIVANSTNGVQQFDVISEGNQFNASVPARSIATYRWKAGLGQSPHSWQ
tr|E2LY19|E2LY19_MONPE      ------------------------------------------------------------
tr|K9HBW2|K9HBW2_AGABB      NWALRVSAFVTGRV----------------------------------------------
tr|H6CEV7|H6CEV7_9BACL      TVAYRNPDGTLVLIALP-------------------------------------------
tr|B1VPJ0|B1VPJ0_STRGG      NVAFQNSDGSRAAVVVNTGSGAQRFSLTDNGKSLAYTLPAGAVATFTWDGSGGTTEPPAG
                                                                                        

tr|I9HH59|I9HH59_BACOV      ------------------------------------------------------------
P04062                      ------------------------------------------------------------
tr|I1WBF3|I1WBF3_BIFAR      ------------------------------------------------------------
tr|D0TN48|D0TN48_9BACE      ------------------------------------------------------------
tr|B5QQZ8|B5QQZ8_LACRH      ------------------------------------------------------------
tr|Q21GD0|Q21GD0_SACD2      APPELPQFPYAENSIEIPGLVEAEHYDLGGAGAAYADVSTGNNGGVLRADDVDIEANANG
tr|E2LY19|E2LY19_MONPE      ------------------------------------------------------------
tr|K9HBW2|K9HBW2_AGABB      ------------------------------------------------------------
tr|H6CEV7|H6CEV7_9BACL      ------------------------------------------------------------
tr|B1VPJ0|B1VPJ0_STRGG      S-----------------------------------------------IDPAAWYQVRNA
                                                                                        

tr|I9HH59|I9HH59_BACOV      ----------------------------------------------------LVNYSEQE
P04062                      ----------------------------------------------------VLNRSSKD
tr|I1WBF3|I1WBF3_BIFAR      ------------------------------------------------------------
tr|D0TN48|D0TN48_9BACE      ----------------------------------------------------LMNNNEKT
tr|B5QQZ8|B5QQZ8_LACRH      ----------------------------------------------------LYNPSGKP
tr|Q21GD0|Q21GD0_SACD2      YHIGWLDAGEWLEYSVNVNQGQSFDVLIASASASSGGQFHFEVNGESVSPILVTPATGGW
tr|E2LY19|E2LY19_MONPE      --------------------------------------------------------EKEW
tr|K9HBW2|K9HBW2_AGABB      ------DSSEWQRYSIVVLN--------------------------------WDDSVGGW
tr|H6CEV7|H6CEV7_9BACL      ----------------------------------------------------IRERTGRH
tr|B1VPJ0|B1VPJ0_STRGG      GSGACLDAADWGTANGTALQ-------------------QWSCGAGANQGWQFRPTSGGH
                                                                                        

tr|I9HH59|I9HH59_BACOV      EKTVRLENIGSKEVSSIRKVIQTDTQKES-------------------------------
P04062                      VPLT-------------------IKDPAV-------------------------------
tr|I1WBF3|I1WBF3_BIFAR      -----------------------ERAESI-------------------------------
tr|D0TN48|D0TN48_9BACE      KKIT-------------------LSDGKR-------------------------------
tr|B5QQZ8|B5QQZ8_LACRH      LDAAVTIN---------------NDGPVT-------------------------------
tr|Q21GD0|Q21GD0_SACD2      KTFVSTLHRGLQLNAGEQVLRLVIDGGEFNIDSFHIVPAGSMEPPVQEDICEEATVSILA
tr|E2LY19|E2LY19_MONPE      II---------------------LHLGSL-------------------------------
tr|K9HBW2|K9HBW2_AGABB      NPQPV--RATIEFRGTQASYTFPVGVTTL-------------------------------
tr|H6CEV7|H6CEV7_9BACL      LRFGRE-----------------AKFSQL-------------------------------
tr|B1VPJ0|B1VPJ0_STRGG      YQVVN------------------RHNAKV-------------------------------
                                                                                        

tr|I9HH59|I9HH59_BACOV      ------------------------------------------------------------
P04062                      ------------------------------------------------------------
tr|I1WBF3|I1WBF3_BIFAR      ------------------------------------------------------------
tr|D0TN48|D0TN48_9BACE      ------------------------------------------------------------
tr|B5QQZ8|B5QQZ8_LACRH      ------------------------------------------------------------
tr|Q21GD0|Q21GD0_SACD2      GKIQAESYCLASGIQTENTSDQGGGENIGWIDAGDSVDYGVSVANAGSYTLNLRVASQNG
tr|E2LY19|E2LY19_MONPE      ------------------------------------------------------------
tr|K9HBW2|K9HBW2_AGABB      ------------------------------------------------------------
tr|H6CEV7|H6CEV7_9BACL      ------------------------------------------------------------
tr|B1VPJ0|B1VPJ0_STRGG      ------------------------------------------------------------
                                                                                        

tr|I9HH59|I9HH59_BACOV      -------------------------------------------------------WY---
P04062                      -------------------------------------------------------GF---
tr|I1WBF3|I1WBF3_BIFAR      -------------------------------------------------------WV---
tr|D0TN48|D0TN48_9BACE      -------------------------------------------------------HF---
tr|B5QQZ8|B5QQZ8_LACRH      -------------------------------------------------------WQ---
tr|Q21GD0|Q21GD0_SACD2      GGEIALSVGDTVLANVQIPGTGGWQNWQTISVPVQLSAGYQQLHFVFINGGLNINWFEFV
tr|E2LY19|E2LY19_MONPE      ------------------------------------------------------------
tr|K9HBW2|K9HBW2_AGABB      -------------------------------------------------------WW---
tr|H6CEV7|H6CEV7_9BACL      -------------------------------------------------------HF---
tr|B1VPJ0|B1VPJ0_STRGG      -------------------------------------------------------WDVVG
                                                                                        

tr|I9HH59|I9HH59_BACOV      ----------------------------------------------QELKNTDPFVELVL
P04062                      -------------------------------------------------------LETIS
tr|I1WBF3|I1WBF3_BIFAR      ----------------------------------------------------QCEVDDSG
tr|D0TN48|D0TN48_9BACE      --------------------------------------------------------AYDV
tr|B5QQZ8|B5QQZ8_LACRH      -------------------------------------HVTVPAWGTVTLHKAFGPVNESA
tr|Q21GD0|Q21GD0_SACD2      ETDNPTDPTDPTDPAAELEEGAYYIINEASGKALDVSGVSTSNGTNVQQWSYSGGLNQQW
tr|E2LY19|E2LY19_MONPE      ------------------------------------------------------------
tr|K9HBW2|K9HBW2_AGABB      -------------------------------------------------YAPSTSFDVCG
tr|H6CEV7|H6CEV7_9BACL      -----------------------------------------------------------H
tr|B1VPJ0|B1VPJ0_STRGG      GSG------------------------------------GTADGTKVHLWSYEGGANQQW
                                                                                        

tr|I9HH59|I9HH59_BACOV      PKMSVT--------------------------------------------TVYFKFKTN-
P04062                      PGYSI---------------------------------------------HTYLWRRQ--
tr|I1WBF3|I1WBF3_BIFAR      IGVRLPSR------------------------------------------SLTTVLRR--
tr|D0TN48|D0TN48_9BACE      PGKSV---------------------------------------------TSYRWAKSE-
tr|B5QQZ8|B5QQZ8_LACRH      PRQDEDFKLNPY--------------------------------------PANLMDDWAP
tr|Q21GD0|Q21GD0_SACD2      IAQHVSGNTFELVSLNSGSCLDADNGSDNAHQWACEGNTNQQWVIEGQSDGTYLIRTKAG
tr|E2LY19|E2LY19_MONPE      ------------------------------------------------------------
tr|K9HBW2|K9HBW2_AGABB      SSNTEEQG------------------------------------------PMVFLNDQQG
tr|H6CEV7|H6CEV7_9BACL      PSQRLPFN------------------------------------------GILRLHDTAS
tr|B1VPJ0|B1VPJ0_STRGG      RPEALAGG------------------------------------------GQYRFVARHS
                                                                                        

tr|I9HH59|I9HH59_BACOV      ------------------------------------
P04062                      ------------------------------------
tr|I1WBF3|I1WBF3_BIFAR      ------------------------------------
tr|D0TN48|D0TN48_9BACE      ------------------------------------
tr|B5QQZ8|B5QQZ8_LACRH      GKGVNANKK---------------------------
tr|Q21GD0|Q21GD0_SACD2      NEVLEVQGGSANNGANVRTASSVNNNRQKWRFNDVE
tr|E2LY19|E2LY19_MONPE      ------------------------------------
tr|K9HBW2|K9HBW2_AGABB      QVPLNF------------------------------
tr|H6CEV7|H6CEV7_9BACL      QQCL--------------------------------
tr|B1VPJ0|B1VPJ0_STRGG      GKCLGVDNSSTADGARLSQQPCSGSPAQAFTLTR--