Difference between revisions of "Multiple Sequence Alignment: Espresso - set 1"

From Bioinformatikpedia
(Created page with "<html><head> <meta http-equiv="content-type" content="text/html; charset=UTF-8"><style> SPAN { font-family: courier new, courier-new, courier, monospace; font-weight: bold; font-…")
 
 
Line 1: Line 1:
<html><head>
+
<addhtml><html><head>
 
<meta http-equiv="content-type" content="text/html; charset=UTF-8"><style>
 
<meta http-equiv="content-type" content="text/html; charset=UTF-8"><style>
 
SPAN { font-family: courier new, courier-new, courier, monospace; font-weight: bold; font-size: 11pt;}
 
SPAN { font-family: courier new, courier-new, courier, monospace; font-weight: bold; font-size: 11pt;}
Line 18: Line 18:
 
SPAN.valueink {background: 000000}
 
SPAN.valueink {background: 000000}
 
</style></head><body><span class="valuedefault">T-COFFEE,&nbsp;Version_9.03.r1318&nbsp;(2012-07-12&nbsp;19:05:45&nbsp;-&nbsp;Revision&nbsp;1318&nbsp;-&nbsp;Build&nbsp;366)</span><br><span class="valuedefault">Cedric&nbsp;Notredame&nbsp;</span><br><span class="valuedefault">CPU&nbsp;TIME:0&nbsp;sec.</span><br><span class="valuedefault">SCORE=99</span><br><span class="valuedefault">*</span><br><span class="valuedefault">&nbsp;</span><span class="value0">B</span><span class="value1">A</span><span class="value2">D</span><span class="value3">&nbsp;</span><span class="value4">A</span><span class="value5">V</span><span class="value6">G</span><span class="value7">&nbsp;</span><span class="value8">G</span><span class="value9">OOD</span><br><span class="valuedefault">*</span><br><span class="value9">sp|P04062|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">:&nbsp;&nbsp;99</span><br><span class="value9">tr|A9UD35|A9UD3&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">:&nbsp;&nbsp;92</span><br><span class="value9">tr|D1L2S0|D1L2S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">:&nbsp;&nbsp;98</span><br><span class="value9">pdb|pdb|3gxi_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">:&nbsp;&nbsp;99</span><br><span class="value9">pdb|pdb|2nt1_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">:&nbsp;&nbsp;99</span><br><span class="value9">tr|F6WDY8|F6WDY&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">:&nbsp;&nbsp;99</span><br><span class="value9">sp|Q2KHZ8|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">:&nbsp;&nbsp;99</span><br><span class="value9">tr|F5CB27|F5CB2&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">:&nbsp;&nbsp;98</span><br><span class="value9">tr|F5H241|F5H24&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">:&nbsp;&nbsp;98</span><br><span class="value9">tr|B7Z6S9|B7Z6S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">:&nbsp;&nbsp;99</span><br><span class="value9">cons&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">:&nbsp;&nbsp;99</span><br><br><span class="valuedefault">sp|P04062|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;0&nbsp;</span><br><span class="valuedefault">tr|A9UD35|A9UD3&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;0&nbsp;</span><br><span class="valuedefault">tr|D1L2S0|D1L2S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;0&nbsp;</span><br><span class="valuedefault">pdb|pdb|3gxi_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;0&nbsp;</span><br><span class="valuedefault">pdb|pdb|2nt1_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;0&nbsp;</span><br><span class="valuedefault">tr|F6WDY8|F6WDY&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;0&nbsp;</span><br><span class="valuedefault">sp|Q2KHZ8|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;0&nbsp;</span><br><span class="valuedefault">tr|F5CB27|F5CB2&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;0&nbsp;</span><br><span class="valuedefault">tr|F5H241|F5H24&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;0&nbsp;</span><br><span class="valuedefault">tr|B7Z6S9|B7Z6S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">MSDRLFSNPGPAPTPQGCFSRGCGWSGCILPSESYCAGPQSPVPPRRLCRLRWDFVLPPVGAA</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;63&nbsp;</span><br><br><span class="valuedefault">cons&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;63&nbsp;</span><br><br><br><span class="valuedefault">sp|P04062|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">----------------------MEFSSPSREECPKPLSRVSIMAGSLTGLLLLQAVSWASG</span><span class="value9">AR</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;41&nbsp;</span><br><span class="valuedefault">tr|A9UD35|A9UD3&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;0&nbsp;</span><br><span class="valuedefault">tr|D1L2S0|D1L2S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;0&nbsp;</span><br><span class="valuedefault">pdb|pdb|3gxi_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">-------------------------------------------------------------</span><span class="value9">AR</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;2&nbsp;</span><br><span class="valuedefault">pdb|pdb|2nt1_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">-------------------------------------------------------------</span><span class="value9">AR</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;2&nbsp;</span><br><span class="valuedefault">tr|F6WDY8|F6WDY&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">----------------------MELSSPSREGCLKCPGRVGIMAASFMGLLLLQAVSRASG</span><span class="value9">AR</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;41&nbsp;</span><br><span class="valuedefault">sp|Q2KHZ8|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">----------------------MELSSPSREEYPMPRGRVGIMAASLMGLLLLHTVSWVSG</span><span class="value9">AR</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;41&nbsp;</span><br><span class="valuedefault">tr|F5CB27|F5CB2&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;0&nbsp;</span><br><span class="valuedefault">tr|F5H241|F5H24&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;0&nbsp;</span><br><span class="valuedefault">tr|B7Z6S9|B7Z6S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;64&nbsp;</span><span class="valuegap">VSLRRRDSGTPVVFSSSNDPEGMEFSSPSREECPKPLSRVSIMAGSLTGLLLLQAVSWASG</span><span class="value9">AR</span><span class="valuedefault">&nbsp;&nbsp;126&nbsp;</span><br><br><span class="valuedefault">cons&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;64&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="value9">&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;126&nbsp;</span><br><br><br><span class="valuedefault">sp|P04062|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;42&nbsp;</span><span class="value9">PCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGT</span><span class="value8">F</span><span class="value9">SRYESTRSGRRMELSMGPIQANHTGTGL</span><span class="valuedefault">&nbsp;&nbsp;104&nbsp;</span><br><span class="valuedefault">tr|A9UD35|A9UD3&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">---------------</span><span class="value9">CNATYCDSLDPLTL</span><span class="value8">P</span><span class="value9">DPGT</span><span class="value8">FSRFESTRSGRRMELSLGTI</span><span class="value9">QANRTG</span><span class="value8">TGL</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;48&nbsp;</span><br><span class="valuedefault">tr|D1L2S0|D1L2S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">-----------</span><span class="value9">VVCVCNATYCDSLDPLTLPDPGT</span><span class="value8">F</span><span class="value9">SRFESTRSGRRMELSLGAIQANRTGTGL</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;52&nbsp;</span><br><span class="valuedefault">pdb|pdb|3gxi_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;3&nbsp;</span><span class="value9">PCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGT</span><span class="value8">F</span><span class="value9">SRYESTRSGRRMELSMGPIQANHTGTGL</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;65&nbsp;</span><br><span class="valuedefault">pdb|pdb|2nt1_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;3&nbsp;</span><span class="value9">PCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGT</span><span class="value8">F</span><span class="value9">SRYESTRSGRRMELSMGPIQANHTGTGL</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;65&nbsp;</span><br><span class="valuedefault">tr|F6WDY8|F6WDY&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;42&nbsp;</span><span class="value9">PCSPKSFGYSSVVCVCNATYCDSLDPLTLPAPGT</span><span class="value8">F</span><span class="value9">SRYESTRSGRRMELSLGAIQANRTGTGL</span><span class="valuedefault">&nbsp;&nbsp;104&nbsp;</span><br><span class="valuedefault">sp|Q2KHZ8|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;42&nbsp;</span><span class="value9">PCSPKSFGYSSVVCVCNGTYCDSLDPLTLPDPGT</span><span class="value8">F</span><span class="value9">SRFESTRSGRRMELSLGTIQANRTGTGL</span><span class="valuedefault">&nbsp;&nbsp;104&nbsp;</span><br><span class="valuedefault">tr|F5CB27|F5CB2&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">---------------</span><span class="value9">CNATYCDSLDPLTLPDPGT</span><span class="value8">F</span><span class="value9">SRFESTRSGRRMELSLGTIQANRTGTGL</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;48&nbsp;</span><br><span class="valuedefault">tr|F5H241|F5H24&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">----</span><span class="value9">MEF</span><span class="valuegap">--</span><span class="value9">SS</span><span class="valuegap">-----------------------</span><span class="value0">P</span><span class="value9">SREE</span><span class="value8">C</span><span class="value9">PKPLSRVSIMAGSL</span><span class="valuegap">------</span><span class="value9">TGL</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;28&nbsp;</span><br><span class="valuedefault">tr|B7Z6S9|B7Z6S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;127&nbsp;</span><span class="value9">PCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGT</span><span class="value8">F</span><span class="value9">SRYESTRSGRRMELSMGPIQANHTGTGL</span><span class="valuedefault">&nbsp;&nbsp;189&nbsp;</span><br><br><span class="valuedefault">cons&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;127&nbsp;</span><span class="value9">&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="value7">&nbsp;</span><span class="value9">**&nbsp;*..:.&nbsp;&nbsp;*:.:&nbsp;&nbsp;*.:&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;***</span><span class="valuedefault">&nbsp;&nbsp;189&nbsp;</span><br><br><br><span class="valuedefault">sp|P04062|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;105&nbsp;</span><span class="value9">LLTLQPEQKFQKVKGFGGAMTDAAALNILALSPPAQNLLLKSYFSEEGIGYNIIRVPMASCDF</span><span class="valuedefault">&nbsp;&nbsp;167&nbsp;</span><br><span class="valuedefault">tr|A9UD35|A9UD3&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;49&nbsp;</span><span class="value8">LL</span><span class="value9">T</span><span class="value8">LQ</span><span class="value9">PDQKFQKVK</span><span class="value8">G</span><span class="valuegap">------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;63&nbsp;</span><br><span class="valuedefault">tr|D1L2S0|D1L2S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;53&nbsp;</span><span class="value9">LLTLQPD</span><span class="valuegap">--------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;59&nbsp;</span><br><span class="valuedefault">pdb|pdb|3gxi_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;66&nbsp;</span><span class="value9">LLTLQPEQKFQKVKGFGGAMTDAAALNILALSPPAQNLLLKSYFSEEGIGYNIIRVPMASCDF</span><span class="valuedefault">&nbsp;&nbsp;128&nbsp;</span><br><span class="valuedefault">pdb|pdb|2nt1_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;66&nbsp;</span><span class="value9">LLTLQPEQKFQKVKGFGGAMTDAAALNILALSPPAQNLLLKSYFSEEGIGYNIIRVPMASCDF</span><span class="valuedefault">&nbsp;&nbsp;128&nbsp;</span><br><span class="valuedefault">tr|F6WDY8|F6WDY&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;105&nbsp;</span><span class="value9">LLTLQPDQKFQKVKGFGGAMTDAAALNILALSPAARNLLLKSYFSEEGIEYNIIRVPMASCDF</span><span class="valuedefault">&nbsp;&nbsp;167&nbsp;</span><br><span class="valuedefault">sp|Q2KHZ8|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;105&nbsp;</span><span class="value9">LLTLQPDQKFQKVKGFGGAMTDAAALNILALSPAARNLLLKSYFSEEGIEYNIIRVPMASCDF</span><span class="valuedefault">&nbsp;&nbsp;167&nbsp;</span><br><span class="valuedefault">tr|F5CB27|F5CB2&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;49&nbsp;</span><span class="value9">LLTLQPD</span><span class="valuegap">--------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;55&nbsp;</span><br><span class="valuedefault">tr|F5H241|F5H24&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;29&nbsp;</span><span class="value9">LL</span><span class="valuegap">-</span><span class="value9">LQ</span><span class="valuegap">-------------</span><span class="value9">AV</span><span class="valuegap">---------------------</span><span class="value9">SWAS</span><span class="valuegap">--</span><span class="value9">GIGYNIIRVPMASCDF</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;54&nbsp;</span><br><span class="valuedefault">tr|B7Z6S9|B7Z6S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;190&nbsp;</span><span class="value9">LLTLQPEQKFQKVKGFGGAMTDAAALNILALSPPAQNLLLKSYFSEEGIGYNIIRVPMASCDF</span><span class="valuedefault">&nbsp;&nbsp;252&nbsp;</span><br><br><span class="valuedefault">cons&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;190&nbsp;</span><span class="value9">**&nbsp;**&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;252&nbsp;</span><br><br><br><span class="valuedefault">sp|P04062|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;168&nbsp;</span><span class="value9">SIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAV</span><span class="valuedefault">&nbsp;&nbsp;230&nbsp;</span><br><span class="valuedefault">tr|A9UD35|A9UD3&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;64&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;63&nbsp;</span><br><span class="valuedefault">tr|D1L2S0|D1L2S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;60&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;59&nbsp;</span><br><span class="valuedefault">pdb|pdb|3gxi_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;129&nbsp;</span><span class="value9">SIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAV</span><span class="valuedefault">&nbsp;&nbsp;191&nbsp;</span><br><span class="valuedefault">pdb|pdb|2nt1_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;129&nbsp;</span><span class="value9">SIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAV</span><span class="valuedefault">&nbsp;&nbsp;191&nbsp;</span><br><span class="valuedefault">tr|F6WDY8|F6WDY&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;168&nbsp;</span><span class="value9">SIRVYTYADTPDDFQLHNFSLPEEDVKLKIPLIHQALELSQRPISLFASPWTSPTWLKTNGAV</span><span class="valuedefault">&nbsp;&nbsp;230&nbsp;</span><br><span class="valuedefault">sp|Q2KHZ8|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;168&nbsp;</span><span class="value9">SIRTYTYDDSPDDFQLLNFSLPEEDVKLKIPLIHQALELANRSVSLFASPWTSPTWLKTNGAV</span><span class="valuedefault">&nbsp;&nbsp;230&nbsp;</span><br><span class="valuedefault">tr|F5CB27|F5CB2&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;56&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;55&nbsp;</span><br><span class="valuedefault">tr|F5H241|F5H24&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;55&nbsp;</span><span class="value9">SIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAV</span><span class="valuedefault">&nbsp;&nbsp;117&nbsp;</span><br><span class="valuedefault">tr|B7Z6S9|B7Z6S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;253&nbsp;</span><span class="value9">SIRTYTYADTPDDFQLHNFGLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAV</span><span class="valuedefault">&nbsp;&nbsp;315&nbsp;</span><br><br><span class="valuedefault">cons&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;253&nbsp;</span><span class="value9">&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;315&nbsp;</span><br><br><br><span class="valuedefault">sp|P04062|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;231&nbsp;</span><span class="value9">NGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQCLGFTPE</span><span class="valuedefault">&nbsp;&nbsp;293&nbsp;</span><br><span class="valuedefault">tr|A9UD35|A9UD3&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;64&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;63&nbsp;</span><br><span class="valuedefault">tr|D1L2S0|D1L2S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;60&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;59&nbsp;</span><br><span class="valuedefault">pdb|pdb|3gxi_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;192&nbsp;</span><span class="value9">NGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQCLGFTPE</span><span class="valuedefault">&nbsp;&nbsp;254&nbsp;</span><br><span class="valuedefault">pdb|pdb|2nt1_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;192&nbsp;</span><span class="value9">NGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQCLGFTPE</span><span class="valuedefault">&nbsp;&nbsp;254&nbsp;</span><br><span class="valuedefault">tr|F6WDY8|F6WDY&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;231&nbsp;</span><span class="value9">NGKGSLKGQPGDRYHQTWAKYFVKFLDAYAEHKLQFWAVTTENEPSAGLISGYPFQCLGFTPE</span><span class="valuedefault">&nbsp;&nbsp;293&nbsp;</span><br><span class="valuedefault">sp|Q2KHZ8|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;231&nbsp;</span><span class="value9">NGKGTLKGQAGDLYHKTWARYFVKFLDAYAEHKLRFWAVTAENEPTAGLLTGYPFQCLGFTPE</span><span class="valuedefault">&nbsp;&nbsp;293&nbsp;</span><br><span class="valuedefault">tr|F5CB27|F5CB2&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;56&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;55&nbsp;</span><br><span class="valuedefault">tr|F5H241|F5H24&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;118&nbsp;</span><span class="value9">NGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQCLGFTPE</span><span class="valuedefault">&nbsp;&nbsp;180&nbsp;</span><br><span class="valuedefault">tr|B7Z6S9|B7Z6S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;316&nbsp;</span><span class="value9">NGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQCLGFTPE</span><span class="valuedefault">&nbsp;&nbsp;378&nbsp;</span><br><br><span class="valuedefault">cons&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;316&nbsp;</span><span class="value9">&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;378&nbsp;</span><br><br><br><span class="valuedefault">sp|P04062|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;294&nbsp;</span><span class="value9">HQRDFIARDLGPTLANSTHHNVRLLMLDDQRLLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFL</span><span class="valuedefault">&nbsp;&nbsp;356&nbsp;</span><br><span class="valuedefault">tr|A9UD35|A9UD3&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;64&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;63&nbsp;</span><br><span class="valuedefault">tr|D1L2S0|D1L2S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;60&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;59&nbsp;</span><br><span class="valuedefault">pdb|pdb|3gxi_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;255&nbsp;</span><span class="value9">HQRDFIARDLGPTLANSTHHNVRLLMLDDQRLLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFL</span><span class="valuedefault">&nbsp;&nbsp;317&nbsp;</span><br><span class="valuedefault">pdb|pdb|2nt1_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;255&nbsp;</span><span class="value9">HQRDFIARDLGPTLANSTHHNVRLLMLDDQRLLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFL</span><span class="valuedefault">&nbsp;&nbsp;317&nbsp;</span><br><span class="valuedefault">tr|F6WDY8|F6WDY&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;294&nbsp;</span><span class="value9">HQRDFIARDLGPTLANSTHRNVRVLMLDDQRLLLPRWAQVVLADPEAAKYVHGIAVHWYLDFL</span><span class="valuedefault">&nbsp;&nbsp;356&nbsp;</span><br><span class="valuedefault">sp|Q2KHZ8|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;294&nbsp;</span><span class="value9">HQRDFIARDLGPILANSTHRDVRLLMLDDQRLLLPRWAQVVLADPEAAKYVHGIAVHWYLDFL</span><span class="valuedefault">&nbsp;&nbsp;356&nbsp;</span><br><span class="valuedefault">tr|F5CB27|F5CB2&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;56&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;55&nbsp;</span><br><span class="valuedefault">tr|F5H241|F5H24&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;181&nbsp;</span><span class="value9">HQRDFIARDLGPTLANSTHHNVRLLMLDDQRLLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFL</span><span class="valuedefault">&nbsp;&nbsp;243&nbsp;</span><br><span class="valuedefault">tr|B7Z6S9|B7Z6S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;379&nbsp;</span><span class="value9">HQRDFIARDLGPTLANSTHHNVRLLMLDDQRLLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFL</span><span class="valuedefault">&nbsp;&nbsp;441&nbsp;</span><br><br><span class="valuedefault">cons&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;379&nbsp;</span><span class="value9">&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;441&nbsp;</span><br><br><br><span class="valuedefault">sp|P04062|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;357&nbsp;</span><span class="value9">APAKATLGETHRLFPNTMLFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTD</span><span class="valuedefault">&nbsp;&nbsp;419&nbsp;</span><br><span class="valuedefault">tr|A9UD35|A9UD3&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;64&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;63&nbsp;</span><br><span class="valuedefault">tr|D1L2S0|D1L2S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;60&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;59&nbsp;</span><br><span class="valuedefault">pdb|pdb|3gxi_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;318&nbsp;</span><span class="value9">APAKATLGETHRLFPNTMLFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTD</span><span class="valuedefault">&nbsp;&nbsp;380&nbsp;</span><br><span class="valuedefault">pdb|pdb|2nt1_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;318&nbsp;</span><span class="value9">APAKATLGETHRLFPNTMLFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTD</span><span class="valuedefault">&nbsp;&nbsp;380&nbsp;</span><br><span class="valuedefault">tr|F6WDY8|F6WDY&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;357&nbsp;</span><span class="value9">APAKATLGETHRLFPDMMLFASEACVGSKFWEQSVRLGSWDRGVQYSHSIITNLLYHVAGWTD</span><span class="valuedefault">&nbsp;&nbsp;419&nbsp;</span><br><span class="valuedefault">sp|Q2KHZ8|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;357&nbsp;</span><span class="value9">APAKATLGETHRLFPNTMLFASEACVGSKFWEQSVRLGSWDRGMRYSHSIITNLLYHVVGWTD</span><span class="valuedefault">&nbsp;&nbsp;419&nbsp;</span><br><span class="valuedefault">tr|F5CB27|F5CB2&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;56&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;55&nbsp;</span><br><span class="valuedefault">tr|F5H241|F5H24&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;244&nbsp;</span><span class="value9">APAKATLGETHRLFPNTMLFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTD</span><span class="valuedefault">&nbsp;&nbsp;306&nbsp;</span><br><span class="valuedefault">tr|B7Z6S9|B7Z6S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;442&nbsp;</span><span class="value9">APAKATLGETHRLFPNTMLFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTD</span><span class="valuedefault">&nbsp;&nbsp;504&nbsp;</span><br><br><span class="valuedefault">cons&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;442&nbsp;</span><span class="value9">&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;504&nbsp;</span><br><br><br><span class="valuedefault">sp|P04062|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;420&nbsp;</span><span class="value9">WNLALNPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASQKND</span><span class="valuedefault">&nbsp;&nbsp;482&nbsp;</span><br><span class="valuedefault">tr|A9UD35|A9UD3&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;64&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;63&nbsp;</span><br><span class="valuedefault">tr|D1L2S0|D1L2S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;60&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;59&nbsp;</span><br><span class="valuedefault">pdb|pdb|3gxi_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;381&nbsp;</span><span class="value9">WNLALNPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASQKND</span><span class="valuedefault">&nbsp;&nbsp;443&nbsp;</span><br><span class="valuedefault">pdb|pdb|2nt1_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;381&nbsp;</span><span class="value9">WNLALNPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASQKND</span><span class="valuedefault">&nbsp;&nbsp;443&nbsp;</span><br><span class="valuedefault">tr|F6WDY8|F6WDY&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;420&nbsp;</span><span class="value9">WNLALNPEGGPNWVRNFVDSPIIVDIAKDTFYKQPMFYHLGHFSKFIPEGSQRVGLDASEKTN</span><span class="valuedefault">&nbsp;&nbsp;482&nbsp;</span><br><span class="valuedefault">sp|Q2KHZ8|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;420&nbsp;</span><span class="value9">WNLALNPEGGPNWVRNFVDSPIIVDIAKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASKKSD</span><span class="valuedefault">&nbsp;&nbsp;482&nbsp;</span><br><span class="valuedefault">tr|F5CB27|F5CB2&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;56&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;55&nbsp;</span><br><span class="valuedefault">tr|F5H241|F5H24&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;307&nbsp;</span><span class="value9">WNLALNPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASQKND</span><span class="valuedefault">&nbsp;&nbsp;369&nbsp;</span><br><span class="valuedefault">tr|B7Z6S9|B7Z6S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;505&nbsp;</span><span class="value9">WNLALNPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASQKND</span><span class="valuedefault">&nbsp;&nbsp;567&nbsp;</span><br><br><span class="valuedefault">cons&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;505&nbsp;</span><span class="value9">&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;567&nbsp;</span><br><br><br><span class="valuedefault">sp|P04062|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;483&nbsp;</span><span class="value9">LDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISPGYSIHTYLWRRQ</span><span class="valuedefault">&nbsp;&nbsp;536&nbsp;</span><br><span class="valuedefault">tr|A9UD35|A9UD3&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;64&nbsp;</span><span class="valuegap">------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;63&nbsp;</span><br><span class="valuedefault">tr|D1L2S0|D1L2S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;60&nbsp;</span><span class="valuegap">------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;59&nbsp;</span><br><span class="valuedefault">pdb|pdb|3gxi_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;444&nbsp;</span><span class="value9">LDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISPGYSIHTYLWHRQ</span><span class="valuedefault">&nbsp;&nbsp;497&nbsp;</span><br><span class="valuedefault">pdb|pdb|2nt1_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;444&nbsp;</span><span class="value9">LDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISPGYSIHTYLWHRQ</span><span class="valuedefault">&nbsp;&nbsp;497&nbsp;</span><br><span class="valuedefault">tr|F6WDY8|F6WDY&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;483&nbsp;</span><span class="value9">LDTVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETVSPGYSIHTYLWRRQ</span><span class="valuedefault">&nbsp;&nbsp;536&nbsp;</span><br><span class="valuedefault">sp|Q2KHZ8|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;483&nbsp;</span><span class="value9">LDTVALLRPDGSAVAVVLNRSSKDVPLTIKDPAVGFMETVSPGYSIHTYLWRRQ</span><span class="valuedefault">&nbsp;&nbsp;536&nbsp;</span><br><span class="valuedefault">tr|F5CB27|F5CB2&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;56&nbsp;</span><span class="valuegap">------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;55&nbsp;</span><br><span class="valuedefault">tr|F5H241|F5H24&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;370&nbsp;</span><span class="value9">LDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISPGYSIHTYLWRRQ</span><span class="valuedefault">&nbsp;&nbsp;423&nbsp;</span><br><span class="valuedefault">tr|B7Z6S9|B7Z6S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;568&nbsp;</span><span class="value9">LDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISPGYSIHTYLWRRQ</span><span class="valuedefault">&nbsp;&nbsp;621&nbsp;</span><br><br><span class="valuedefault">cons&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;568&nbsp;</span><span class="value9">&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;621&nbsp;</span><br><br><br><br><br><br>
 
</style></head><body><span class="valuedefault">T-COFFEE,&nbsp;Version_9.03.r1318&nbsp;(2012-07-12&nbsp;19:05:45&nbsp;-&nbsp;Revision&nbsp;1318&nbsp;-&nbsp;Build&nbsp;366)</span><br><span class="valuedefault">Cedric&nbsp;Notredame&nbsp;</span><br><span class="valuedefault">CPU&nbsp;TIME:0&nbsp;sec.</span><br><span class="valuedefault">SCORE=99</span><br><span class="valuedefault">*</span><br><span class="valuedefault">&nbsp;</span><span class="value0">B</span><span class="value1">A</span><span class="value2">D</span><span class="value3">&nbsp;</span><span class="value4">A</span><span class="value5">V</span><span class="value6">G</span><span class="value7">&nbsp;</span><span class="value8">G</span><span class="value9">OOD</span><br><span class="valuedefault">*</span><br><span class="value9">sp|P04062|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">:&nbsp;&nbsp;99</span><br><span class="value9">tr|A9UD35|A9UD3&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">:&nbsp;&nbsp;92</span><br><span class="value9">tr|D1L2S0|D1L2S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">:&nbsp;&nbsp;98</span><br><span class="value9">pdb|pdb|3gxi_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">:&nbsp;&nbsp;99</span><br><span class="value9">pdb|pdb|2nt1_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">:&nbsp;&nbsp;99</span><br><span class="value9">tr|F6WDY8|F6WDY&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">:&nbsp;&nbsp;99</span><br><span class="value9">sp|Q2KHZ8|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">:&nbsp;&nbsp;99</span><br><span class="value9">tr|F5CB27|F5CB2&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">:&nbsp;&nbsp;98</span><br><span class="value9">tr|F5H241|F5H24&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">:&nbsp;&nbsp;98</span><br><span class="value9">tr|B7Z6S9|B7Z6S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">:&nbsp;&nbsp;99</span><br><span class="value9">cons&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">:&nbsp;&nbsp;99</span><br><br><span class="valuedefault">sp|P04062|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;0&nbsp;</span><br><span class="valuedefault">tr|A9UD35|A9UD3&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;0&nbsp;</span><br><span class="valuedefault">tr|D1L2S0|D1L2S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;0&nbsp;</span><br><span class="valuedefault">pdb|pdb|3gxi_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;0&nbsp;</span><br><span class="valuedefault">pdb|pdb|2nt1_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;0&nbsp;</span><br><span class="valuedefault">tr|F6WDY8|F6WDY&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;0&nbsp;</span><br><span class="valuedefault">sp|Q2KHZ8|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;0&nbsp;</span><br><span class="valuedefault">tr|F5CB27|F5CB2&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;0&nbsp;</span><br><span class="valuedefault">tr|F5H241|F5H24&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;0&nbsp;</span><br><span class="valuedefault">tr|B7Z6S9|B7Z6S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">MSDRLFSNPGPAPTPQGCFSRGCGWSGCILPSESYCAGPQSPVPPRRLCRLRWDFVLPPVGAA</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;63&nbsp;</span><br><br><span class="valuedefault">cons&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;63&nbsp;</span><br><br><br><span class="valuedefault">sp|P04062|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">----------------------MEFSSPSREECPKPLSRVSIMAGSLTGLLLLQAVSWASG</span><span class="value9">AR</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;41&nbsp;</span><br><span class="valuedefault">tr|A9UD35|A9UD3&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;0&nbsp;</span><br><span class="valuedefault">tr|D1L2S0|D1L2S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;0&nbsp;</span><br><span class="valuedefault">pdb|pdb|3gxi_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">-------------------------------------------------------------</span><span class="value9">AR</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;2&nbsp;</span><br><span class="valuedefault">pdb|pdb|2nt1_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">-------------------------------------------------------------</span><span class="value9">AR</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;2&nbsp;</span><br><span class="valuedefault">tr|F6WDY8|F6WDY&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">----------------------MELSSPSREGCLKCPGRVGIMAASFMGLLLLQAVSRASG</span><span class="value9">AR</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;41&nbsp;</span><br><span class="valuedefault">sp|Q2KHZ8|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">----------------------MELSSPSREEYPMPRGRVGIMAASLMGLLLLHTVSWVSG</span><span class="value9">AR</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;41&nbsp;</span><br><span class="valuedefault">tr|F5CB27|F5CB2&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;0&nbsp;</span><br><span class="valuedefault">tr|F5H241|F5H24&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;0&nbsp;</span><br><span class="valuedefault">tr|B7Z6S9|B7Z6S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;64&nbsp;</span><span class="valuegap">VSLRRRDSGTPVVFSSSNDPEGMEFSSPSREECPKPLSRVSIMAGSLTGLLLLQAVSWASG</span><span class="value9">AR</span><span class="valuedefault">&nbsp;&nbsp;126&nbsp;</span><br><br><span class="valuedefault">cons&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;64&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="value9">&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;126&nbsp;</span><br><br><br><span class="valuedefault">sp|P04062|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;42&nbsp;</span><span class="value9">PCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGT</span><span class="value8">F</span><span class="value9">SRYESTRSGRRMELSMGPIQANHTGTGL</span><span class="valuedefault">&nbsp;&nbsp;104&nbsp;</span><br><span class="valuedefault">tr|A9UD35|A9UD3&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">---------------</span><span class="value9">CNATYCDSLDPLTL</span><span class="value8">P</span><span class="value9">DPGT</span><span class="value8">FSRFESTRSGRRMELSLGTI</span><span class="value9">QANRTG</span><span class="value8">TGL</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;48&nbsp;</span><br><span class="valuedefault">tr|D1L2S0|D1L2S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">-----------</span><span class="value9">VVCVCNATYCDSLDPLTLPDPGT</span><span class="value8">F</span><span class="value9">SRFESTRSGRRMELSLGAIQANRTGTGL</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;52&nbsp;</span><br><span class="valuedefault">pdb|pdb|3gxi_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;3&nbsp;</span><span class="value9">PCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGT</span><span class="value8">F</span><span class="value9">SRYESTRSGRRMELSMGPIQANHTGTGL</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;65&nbsp;</span><br><span class="valuedefault">pdb|pdb|2nt1_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;3&nbsp;</span><span class="value9">PCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGT</span><span class="value8">F</span><span class="value9">SRYESTRSGRRMELSMGPIQANHTGTGL</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;65&nbsp;</span><br><span class="valuedefault">tr|F6WDY8|F6WDY&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;42&nbsp;</span><span class="value9">PCSPKSFGYSSVVCVCNATYCDSLDPLTLPAPGT</span><span class="value8">F</span><span class="value9">SRYESTRSGRRMELSLGAIQANRTGTGL</span><span class="valuedefault">&nbsp;&nbsp;104&nbsp;</span><br><span class="valuedefault">sp|Q2KHZ8|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;42&nbsp;</span><span class="value9">PCSPKSFGYSSVVCVCNGTYCDSLDPLTLPDPGT</span><span class="value8">F</span><span class="value9">SRFESTRSGRRMELSLGTIQANRTGTGL</span><span class="valuedefault">&nbsp;&nbsp;104&nbsp;</span><br><span class="valuedefault">tr|F5CB27|F5CB2&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">---------------</span><span class="value9">CNATYCDSLDPLTLPDPGT</span><span class="value8">F</span><span class="value9">SRFESTRSGRRMELSLGTIQANRTGTGL</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;48&nbsp;</span><br><span class="valuedefault">tr|F5H241|F5H24&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;&nbsp;1&nbsp;</span><span class="valuegap">----</span><span class="value9">MEF</span><span class="valuegap">--</span><span class="value9">SS</span><span class="valuegap">-----------------------</span><span class="value0">P</span><span class="value9">SREE</span><span class="value8">C</span><span class="value9">PKPLSRVSIMAGSL</span><span class="valuegap">------</span><span class="value9">TGL</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;28&nbsp;</span><br><span class="valuedefault">tr|B7Z6S9|B7Z6S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;127&nbsp;</span><span class="value9">PCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGT</span><span class="value8">F</span><span class="value9">SRYESTRSGRRMELSMGPIQANHTGTGL</span><span class="valuedefault">&nbsp;&nbsp;189&nbsp;</span><br><br><span class="valuedefault">cons&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;127&nbsp;</span><span class="value9">&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="value7">&nbsp;</span><span class="value9">**&nbsp;*..:.&nbsp;&nbsp;*:.:&nbsp;&nbsp;*.:&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;***</span><span class="valuedefault">&nbsp;&nbsp;189&nbsp;</span><br><br><br><span class="valuedefault">sp|P04062|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;105&nbsp;</span><span class="value9">LLTLQPEQKFQKVKGFGGAMTDAAALNILALSPPAQNLLLKSYFSEEGIGYNIIRVPMASCDF</span><span class="valuedefault">&nbsp;&nbsp;167&nbsp;</span><br><span class="valuedefault">tr|A9UD35|A9UD3&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;49&nbsp;</span><span class="value8">LL</span><span class="value9">T</span><span class="value8">LQ</span><span class="value9">PDQKFQKVK</span><span class="value8">G</span><span class="valuegap">------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;63&nbsp;</span><br><span class="valuedefault">tr|D1L2S0|D1L2S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;53&nbsp;</span><span class="value9">LLTLQPD</span><span class="valuegap">--------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;59&nbsp;</span><br><span class="valuedefault">pdb|pdb|3gxi_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;66&nbsp;</span><span class="value9">LLTLQPEQKFQKVKGFGGAMTDAAALNILALSPPAQNLLLKSYFSEEGIGYNIIRVPMASCDF</span><span class="valuedefault">&nbsp;&nbsp;128&nbsp;</span><br><span class="valuedefault">pdb|pdb|2nt1_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;66&nbsp;</span><span class="value9">LLTLQPEQKFQKVKGFGGAMTDAAALNILALSPPAQNLLLKSYFSEEGIGYNIIRVPMASCDF</span><span class="valuedefault">&nbsp;&nbsp;128&nbsp;</span><br><span class="valuedefault">tr|F6WDY8|F6WDY&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;105&nbsp;</span><span class="value9">LLTLQPDQKFQKVKGFGGAMTDAAALNILALSPAARNLLLKSYFSEEGIEYNIIRVPMASCDF</span><span class="valuedefault">&nbsp;&nbsp;167&nbsp;</span><br><span class="valuedefault">sp|Q2KHZ8|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;105&nbsp;</span><span class="value9">LLTLQPDQKFQKVKGFGGAMTDAAALNILALSPAARNLLLKSYFSEEGIEYNIIRVPMASCDF</span><span class="valuedefault">&nbsp;&nbsp;167&nbsp;</span><br><span class="valuedefault">tr|F5CB27|F5CB2&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;49&nbsp;</span><span class="value9">LLTLQPD</span><span class="valuegap">--------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;55&nbsp;</span><br><span class="valuedefault">tr|F5H241|F5H24&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;29&nbsp;</span><span class="value9">LL</span><span class="valuegap">-</span><span class="value9">LQ</span><span class="valuegap">-------------</span><span class="value9">AV</span><span class="valuegap">---------------------</span><span class="value9">SWAS</span><span class="valuegap">--</span><span class="value9">GIGYNIIRVPMASCDF</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;54&nbsp;</span><br><span class="valuedefault">tr|B7Z6S9|B7Z6S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;190&nbsp;</span><span class="value9">LLTLQPEQKFQKVKGFGGAMTDAAALNILALSPPAQNLLLKSYFSEEGIGYNIIRVPMASCDF</span><span class="valuedefault">&nbsp;&nbsp;252&nbsp;</span><br><br><span class="valuedefault">cons&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;190&nbsp;</span><span class="value9">**&nbsp;**&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;252&nbsp;</span><br><br><br><span class="valuedefault">sp|P04062|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;168&nbsp;</span><span class="value9">SIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAV</span><span class="valuedefault">&nbsp;&nbsp;230&nbsp;</span><br><span class="valuedefault">tr|A9UD35|A9UD3&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;64&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;63&nbsp;</span><br><span class="valuedefault">tr|D1L2S0|D1L2S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;60&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;59&nbsp;</span><br><span class="valuedefault">pdb|pdb|3gxi_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;129&nbsp;</span><span class="value9">SIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAV</span><span class="valuedefault">&nbsp;&nbsp;191&nbsp;</span><br><span class="valuedefault">pdb|pdb|2nt1_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;129&nbsp;</span><span class="value9">SIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAV</span><span class="valuedefault">&nbsp;&nbsp;191&nbsp;</span><br><span class="valuedefault">tr|F6WDY8|F6WDY&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;168&nbsp;</span><span class="value9">SIRVYTYADTPDDFQLHNFSLPEEDVKLKIPLIHQALELSQRPISLFASPWTSPTWLKTNGAV</span><span class="valuedefault">&nbsp;&nbsp;230&nbsp;</span><br><span class="valuedefault">sp|Q2KHZ8|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;168&nbsp;</span><span class="value9">SIRTYTYDDSPDDFQLLNFSLPEEDVKLKIPLIHQALELANRSVSLFASPWTSPTWLKTNGAV</span><span class="valuedefault">&nbsp;&nbsp;230&nbsp;</span><br><span class="valuedefault">tr|F5CB27|F5CB2&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;56&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;55&nbsp;</span><br><span class="valuedefault">tr|F5H241|F5H24&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;55&nbsp;</span><span class="value9">SIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAV</span><span class="valuedefault">&nbsp;&nbsp;117&nbsp;</span><br><span class="valuedefault">tr|B7Z6S9|B7Z6S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;253&nbsp;</span><span class="value9">SIRTYTYADTPDDFQLHNFGLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAV</span><span class="valuedefault">&nbsp;&nbsp;315&nbsp;</span><br><br><span class="valuedefault">cons&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;253&nbsp;</span><span class="value9">&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;315&nbsp;</span><br><br><br><span class="valuedefault">sp|P04062|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;231&nbsp;</span><span class="value9">NGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQCLGFTPE</span><span class="valuedefault">&nbsp;&nbsp;293&nbsp;</span><br><span class="valuedefault">tr|A9UD35|A9UD3&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;64&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;63&nbsp;</span><br><span class="valuedefault">tr|D1L2S0|D1L2S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;60&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;59&nbsp;</span><br><span class="valuedefault">pdb|pdb|3gxi_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;192&nbsp;</span><span class="value9">NGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQCLGFTPE</span><span class="valuedefault">&nbsp;&nbsp;254&nbsp;</span><br><span class="valuedefault">pdb|pdb|2nt1_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;192&nbsp;</span><span class="value9">NGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQCLGFTPE</span><span class="valuedefault">&nbsp;&nbsp;254&nbsp;</span><br><span class="valuedefault">tr|F6WDY8|F6WDY&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;231&nbsp;</span><span class="value9">NGKGSLKGQPGDRYHQTWAKYFVKFLDAYAEHKLQFWAVTTENEPSAGLISGYPFQCLGFTPE</span><span class="valuedefault">&nbsp;&nbsp;293&nbsp;</span><br><span class="valuedefault">sp|Q2KHZ8|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;231&nbsp;</span><span class="value9">NGKGTLKGQAGDLYHKTWARYFVKFLDAYAEHKLRFWAVTAENEPTAGLLTGYPFQCLGFTPE</span><span class="valuedefault">&nbsp;&nbsp;293&nbsp;</span><br><span class="valuedefault">tr|F5CB27|F5CB2&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;56&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;55&nbsp;</span><br><span class="valuedefault">tr|F5H241|F5H24&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;118&nbsp;</span><span class="value9">NGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQCLGFTPE</span><span class="valuedefault">&nbsp;&nbsp;180&nbsp;</span><br><span class="valuedefault">tr|B7Z6S9|B7Z6S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;316&nbsp;</span><span class="value9">NGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQCLGFTPE</span><span class="valuedefault">&nbsp;&nbsp;378&nbsp;</span><br><br><span class="valuedefault">cons&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;316&nbsp;</span><span class="value9">&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;378&nbsp;</span><br><br><br><span class="valuedefault">sp|P04062|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;294&nbsp;</span><span class="value9">HQRDFIARDLGPTLANSTHHNVRLLMLDDQRLLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFL</span><span class="valuedefault">&nbsp;&nbsp;356&nbsp;</span><br><span class="valuedefault">tr|A9UD35|A9UD3&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;64&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;63&nbsp;</span><br><span class="valuedefault">tr|D1L2S0|D1L2S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;60&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;59&nbsp;</span><br><span class="valuedefault">pdb|pdb|3gxi_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;255&nbsp;</span><span class="value9">HQRDFIARDLGPTLANSTHHNVRLLMLDDQRLLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFL</span><span class="valuedefault">&nbsp;&nbsp;317&nbsp;</span><br><span class="valuedefault">pdb|pdb|2nt1_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;255&nbsp;</span><span class="value9">HQRDFIARDLGPTLANSTHHNVRLLMLDDQRLLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFL</span><span class="valuedefault">&nbsp;&nbsp;317&nbsp;</span><br><span class="valuedefault">tr|F6WDY8|F6WDY&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;294&nbsp;</span><span class="value9">HQRDFIARDLGPTLANSTHRNVRVLMLDDQRLLLPRWAQVVLADPEAAKYVHGIAVHWYLDFL</span><span class="valuedefault">&nbsp;&nbsp;356&nbsp;</span><br><span class="valuedefault">sp|Q2KHZ8|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;294&nbsp;</span><span class="value9">HQRDFIARDLGPILANSTHRDVRLLMLDDQRLLLPRWAQVVLADPEAAKYVHGIAVHWYLDFL</span><span class="valuedefault">&nbsp;&nbsp;356&nbsp;</span><br><span class="valuedefault">tr|F5CB27|F5CB2&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;56&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;55&nbsp;</span><br><span class="valuedefault">tr|F5H241|F5H24&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;181&nbsp;</span><span class="value9">HQRDFIARDLGPTLANSTHHNVRLLMLDDQRLLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFL</span><span class="valuedefault">&nbsp;&nbsp;243&nbsp;</span><br><span class="valuedefault">tr|B7Z6S9|B7Z6S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;379&nbsp;</span><span class="value9">HQRDFIARDLGPTLANSTHHNVRLLMLDDQRLLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFL</span><span class="valuedefault">&nbsp;&nbsp;441&nbsp;</span><br><br><span class="valuedefault">cons&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;379&nbsp;</span><span class="value9">&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;441&nbsp;</span><br><br><br><span class="valuedefault">sp|P04062|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;357&nbsp;</span><span class="value9">APAKATLGETHRLFPNTMLFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTD</span><span class="valuedefault">&nbsp;&nbsp;419&nbsp;</span><br><span class="valuedefault">tr|A9UD35|A9UD3&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;64&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;63&nbsp;</span><br><span class="valuedefault">tr|D1L2S0|D1L2S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;60&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;59&nbsp;</span><br><span class="valuedefault">pdb|pdb|3gxi_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;318&nbsp;</span><span class="value9">APAKATLGETHRLFPNTMLFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTD</span><span class="valuedefault">&nbsp;&nbsp;380&nbsp;</span><br><span class="valuedefault">pdb|pdb|2nt1_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;318&nbsp;</span><span class="value9">APAKATLGETHRLFPNTMLFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTD</span><span class="valuedefault">&nbsp;&nbsp;380&nbsp;</span><br><span class="valuedefault">tr|F6WDY8|F6WDY&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;357&nbsp;</span><span class="value9">APAKATLGETHRLFPDMMLFASEACVGSKFWEQSVRLGSWDRGVQYSHSIITNLLYHVAGWTD</span><span class="valuedefault">&nbsp;&nbsp;419&nbsp;</span><br><span class="valuedefault">sp|Q2KHZ8|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;357&nbsp;</span><span class="value9">APAKATLGETHRLFPNTMLFASEACVGSKFWEQSVRLGSWDRGMRYSHSIITNLLYHVVGWTD</span><span class="valuedefault">&nbsp;&nbsp;419&nbsp;</span><br><span class="valuedefault">tr|F5CB27|F5CB2&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;56&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;55&nbsp;</span><br><span class="valuedefault">tr|F5H241|F5H24&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;244&nbsp;</span><span class="value9">APAKATLGETHRLFPNTMLFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTD</span><span class="valuedefault">&nbsp;&nbsp;306&nbsp;</span><br><span class="valuedefault">tr|B7Z6S9|B7Z6S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;442&nbsp;</span><span class="value9">APAKATLGETHRLFPNTMLFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTD</span><span class="valuedefault">&nbsp;&nbsp;504&nbsp;</span><br><br><span class="valuedefault">cons&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;442&nbsp;</span><span class="value9">&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;504&nbsp;</span><br><br><br><span class="valuedefault">sp|P04062|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;420&nbsp;</span><span class="value9">WNLALNPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASQKND</span><span class="valuedefault">&nbsp;&nbsp;482&nbsp;</span><br><span class="valuedefault">tr|A9UD35|A9UD3&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;64&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;63&nbsp;</span><br><span class="valuedefault">tr|D1L2S0|D1L2S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;60&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;59&nbsp;</span><br><span class="valuedefault">pdb|pdb|3gxi_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;381&nbsp;</span><span class="value9">WNLALNPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASQKND</span><span class="valuedefault">&nbsp;&nbsp;443&nbsp;</span><br><span class="valuedefault">pdb|pdb|2nt1_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;381&nbsp;</span><span class="value9">WNLALNPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASQKND</span><span class="valuedefault">&nbsp;&nbsp;443&nbsp;</span><br><span class="valuedefault">tr|F6WDY8|F6WDY&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;420&nbsp;</span><span class="value9">WNLALNPEGGPNWVRNFVDSPIIVDIAKDTFYKQPMFYHLGHFSKFIPEGSQRVGLDASEKTN</span><span class="valuedefault">&nbsp;&nbsp;482&nbsp;</span><br><span class="valuedefault">sp|Q2KHZ8|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;420&nbsp;</span><span class="value9">WNLALNPEGGPNWVRNFVDSPIIVDIAKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASKKSD</span><span class="valuedefault">&nbsp;&nbsp;482&nbsp;</span><br><span class="valuedefault">tr|F5CB27|F5CB2&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;56&nbsp;</span><span class="valuegap">---------------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;55&nbsp;</span><br><span class="valuedefault">tr|F5H241|F5H24&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;307&nbsp;</span><span class="value9">WNLALNPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASQKND</span><span class="valuedefault">&nbsp;&nbsp;369&nbsp;</span><br><span class="valuedefault">tr|B7Z6S9|B7Z6S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;505&nbsp;</span><span class="value9">WNLALNPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASQKND</span><span class="valuedefault">&nbsp;&nbsp;567&nbsp;</span><br><br><span class="valuedefault">cons&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;505&nbsp;</span><span class="value9">&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;567&nbsp;</span><br><br><br><span class="valuedefault">sp|P04062|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;483&nbsp;</span><span class="value9">LDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISPGYSIHTYLWRRQ</span><span class="valuedefault">&nbsp;&nbsp;536&nbsp;</span><br><span class="valuedefault">tr|A9UD35|A9UD3&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;64&nbsp;</span><span class="valuegap">------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;63&nbsp;</span><br><span class="valuedefault">tr|D1L2S0|D1L2S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;60&nbsp;</span><span class="valuegap">------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;59&nbsp;</span><br><span class="valuedefault">pdb|pdb|3gxi_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;444&nbsp;</span><span class="value9">LDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISPGYSIHTYLWHRQ</span><span class="valuedefault">&nbsp;&nbsp;497&nbsp;</span><br><span class="valuedefault">pdb|pdb|2nt1_A&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;444&nbsp;</span><span class="value9">LDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISPGYSIHTYLWHRQ</span><span class="valuedefault">&nbsp;&nbsp;497&nbsp;</span><br><span class="valuedefault">tr|F6WDY8|F6WDY&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;483&nbsp;</span><span class="value9">LDTVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETVSPGYSIHTYLWRRQ</span><span class="valuedefault">&nbsp;&nbsp;536&nbsp;</span><br><span class="valuedefault">sp|Q2KHZ8|GLCM_&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;483&nbsp;</span><span class="value9">LDTVALLRPDGSAVAVVLNRSSKDVPLTIKDPAVGFMETVSPGYSIHTYLWRRQ</span><span class="valuedefault">&nbsp;&nbsp;536&nbsp;</span><br><span class="valuedefault">tr|F5CB27|F5CB2&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;56&nbsp;</span><span class="valuegap">------------------------------------------------------</span><span class="valuedefault">&nbsp;&nbsp;&nbsp;55&nbsp;</span><br><span class="valuedefault">tr|F5H241|F5H24&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;370&nbsp;</span><span class="value9">LDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISPGYSIHTYLWRRQ</span><span class="valuedefault">&nbsp;&nbsp;423&nbsp;</span><br><span class="valuedefault">tr|B7Z6S9|B7Z6S&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;568&nbsp;</span><span class="value9">LDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISPGYSIHTYLWRRQ</span><span class="valuedefault">&nbsp;&nbsp;621&nbsp;</span><br><br><span class="valuedefault">cons&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;568&nbsp;</span><span class="value9">&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span><span class="valuedefault">&nbsp;&nbsp;621&nbsp;</span><br><br><br><br><br><br>
</body></html>
+
</body></html></addhtml>

Latest revision as of 17:20, 6 May 2013

<addhtml><html><head> <meta http-equiv="content-type" content="text/html; charset=UTF-8"><style> SPAN { font-family: courier new, courier-new, courier, monospace; font-weight: bold; font-size: 11pt;} SPAN { line-height:100%} SPAN { white-space: pre} SPAN.value0 {background: #6666FF} SPAN.value1 {background: #00FF00} SPAN.value2 {background: #66FF00} SPAN.value3 {background: #CCFF00} SPAN.value4 {background: #FFFF00} SPAN.value5 {background: #FFCC00} SPAN.value6 {background: #FF9900} SPAN.value7 {background: #FF6600} SPAN.value8 {background: #FF3300} SPAN.value9 {background: #FF2000} SPAN.valuedefault {} SPAN.valuegap {} SPAN.valueink {background: 000000} </style></head><body>T-COFFEE, Version_9.03.r1318 (2012-07-12 19:05:45 - Revision 1318 - Build 366)
Cedric Notredame 
CPU TIME:0 sec.
SCORE=99
*
 BAD AVG GOOD
*
sp|P04062|GLCM_   :  99
tr|A9UD35|A9UD3   :  92
tr|D1L2S0|D1L2S   :  98
pdb|pdb|3gxi_A    :  99
pdb|pdb|2nt1_A    :  99
tr|F6WDY8|F6WDY   :  99
sp|Q2KHZ8|GLCM_   :  99
tr|F5CB27|F5CB2   :  98
tr|F5H241|F5H24   :  98
tr|B7Z6S9|B7Z6S   :  99
cons              :  99

sp|P04062|GLCM_       1 ---------------------------------------------------------------    0 
tr|A9UD35|A9UD3       1 ---------------------------------------------------------------    0 
tr|D1L2S0|D1L2S       1 ---------------------------------------------------------------    0 
pdb|pdb|3gxi_A        1 ---------------------------------------------------------------    0 
pdb|pdb|2nt1_A        1 ---------------------------------------------------------------    0 
tr|F6WDY8|F6WDY       1 ---------------------------------------------------------------    0 
sp|Q2KHZ8|GLCM_       1 ---------------------------------------------------------------    0 
tr|F5CB27|F5CB2       1 ---------------------------------------------------------------    0 
tr|F5H241|F5H24       1 ---------------------------------------------------------------    0 
tr|B7Z6S9|B7Z6S       1 MSDRLFSNPGPAPTPQGCFSRGCGWSGCILPSESYCAGPQSPVPPRRLCRLRWDFVLPPVGAA   63 

cons                  1                                                                   63 


sp|P04062|GLCM_       1 ----------------------MEFSSPSREECPKPLSRVSIMAGSLTGLLLLQAVSWASGAR   41 
tr|A9UD35|A9UD3       1 ---------------------------------------------------------------    0 
tr|D1L2S0|D1L2S       1 ---------------------------------------------------------------    0 
pdb|pdb|3gxi_A        1 -------------------------------------------------------------AR    2 
pdb|pdb|2nt1_A        1 -------------------------------------------------------------AR    2 
tr|F6WDY8|F6WDY       1 ----------------------MELSSPSREGCLKCPGRVGIMAASFMGLLLLQAVSRASGAR   41 
sp|Q2KHZ8|GLCM_       1 ----------------------MELSSPSREEYPMPRGRVGIMAASLMGLLLLHTVSWVSGAR   41 
tr|F5CB27|F5CB2       1 ---------------------------------------------------------------    0 
tr|F5H241|F5H24       1 ---------------------------------------------------------------    0 
tr|B7Z6S9|B7Z6S      64 VSLRRRDSGTPVVFSSSNDPEGMEFSSPSREECPKPLSRVSIMAGSLTGLLLLQAVSWASGAR  126 

cons                 64                                                                  126 


sp|P04062|GLCM_      42 PCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRRMELSMGPIQANHTGTGL  104 
tr|A9UD35|A9UD3       1 ---------------CNATYCDSLDPLTLPDPGTFSRFESTRSGRRMELSLGTIQANRTGTGL   48 
tr|D1L2S0|D1L2S       1 -----------VVCVCNATYCDSLDPLTLPDPGTFSRFESTRSGRRMELSLGAIQANRTGTGL   52 
pdb|pdb|3gxi_A        3 PCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRRMELSMGPIQANHTGTGL   65 
pdb|pdb|2nt1_A        3 PCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRRMELSMGPIQANHTGTGL   65 
tr|F6WDY8|F6WDY      42 PCSPKSFGYSSVVCVCNATYCDSLDPLTLPAPGTFSRYESTRSGRRMELSLGAIQANRTGTGL  104 
sp|Q2KHZ8|GLCM_      42 PCSPKSFGYSSVVCVCNGTYCDSLDPLTLPDPGTFSRFESTRSGRRMELSLGTIQANRTGTGL  104 
tr|F5CB27|F5CB2       1 ---------------CNATYCDSLDPLTLPDPGTFSRFESTRSGRRMELSLGTIQANRTGTGL   48 
tr|F5H241|F5H24       1 ----MEF--SS-----------------------PSREECPKPLSRVSIMAGSL------TGL   28 
tr|B7Z6S9|B7Z6S     127 PCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRRMELSMGPIQANHTGTGL  189 

cons                127                                    ** *..:.  *:.:  *.:      ***  189 


sp|P04062|GLCM_     105 LLTLQPEQKFQKVKGFGGAMTDAAALNILALSPPAQNLLLKSYFSEEGIGYNIIRVPMASCDF  167 
tr|A9UD35|A9UD3      49 LLTLQPDQKFQKVKG------------------------------------------------   63 
tr|D1L2S0|D1L2S      53 LLTLQPD--------------------------------------------------------   59 
pdb|pdb|3gxi_A       66 LLTLQPEQKFQKVKGFGGAMTDAAALNILALSPPAQNLLLKSYFSEEGIGYNIIRVPMASCDF  128 
pdb|pdb|2nt1_A       66 LLTLQPEQKFQKVKGFGGAMTDAAALNILALSPPAQNLLLKSYFSEEGIGYNIIRVPMASCDF  128 
tr|F6WDY8|F6WDY     105 LLTLQPDQKFQKVKGFGGAMTDAAALNILALSPAARNLLLKSYFSEEGIEYNIIRVPMASCDF  167 
sp|Q2KHZ8|GLCM_     105 LLTLQPDQKFQKVKGFGGAMTDAAALNILALSPAARNLLLKSYFSEEGIEYNIIRVPMASCDF  167 
tr|F5CB27|F5CB2      49 LLTLQPD--------------------------------------------------------   55 
tr|F5H241|F5H24      29 LL-LQ-------------AV---------------------SWAS--GIGYNIIRVPMASCDF   54 
tr|B7Z6S9|B7Z6S     190 LLTLQPEQKFQKVKGFGGAMTDAAALNILALSPPAQNLLLKSYFSEEGIGYNIIRVPMASCDF  252 

cons                190 ** **                                                            252 


sp|P04062|GLCM_     168 SIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAV  230 
tr|A9UD35|A9UD3      64 ---------------------------------------------------------------   63 
tr|D1L2S0|D1L2S      60 ---------------------------------------------------------------   59 
pdb|pdb|3gxi_A      129 SIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAV  191 
pdb|pdb|2nt1_A      129 SIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAV  191 
tr|F6WDY8|F6WDY     168 SIRVYTYADTPDDFQLHNFSLPEEDVKLKIPLIHQALELSQRPISLFASPWTSPTWLKTNGAV  230 
sp|Q2KHZ8|GLCM_     168 SIRTYTYDDSPDDFQLLNFSLPEEDVKLKIPLIHQALELANRSVSLFASPWTSPTWLKTNGAV  230 
tr|F5CB27|F5CB2      56 ---------------------------------------------------------------   55 
tr|F5H241|F5H24      55 SIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAV  117 
tr|B7Z6S9|B7Z6S     253 SIRTYTYADTPDDFQLHNFGLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAV  315 

cons                253                                                                  315 


sp|P04062|GLCM_     231 NGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQCLGFTPE  293 
tr|A9UD35|A9UD3      64 ---------------------------------------------------------------   63 
tr|D1L2S0|D1L2S      60 ---------------------------------------------------------------   59 
pdb|pdb|3gxi_A      192 NGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQCLGFTPE  254 
pdb|pdb|2nt1_A      192 NGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQCLGFTPE  254 
tr|F6WDY8|F6WDY     231 NGKGSLKGQPGDRYHQTWAKYFVKFLDAYAEHKLQFWAVTTENEPSAGLISGYPFQCLGFTPE  293 
sp|Q2KHZ8|GLCM_     231 NGKGTLKGQAGDLYHKTWARYFVKFLDAYAEHKLRFWAVTAENEPTAGLLTGYPFQCLGFTPE  293 
tr|F5CB27|F5CB2      56 ---------------------------------------------------------------   55 
tr|F5H241|F5H24     118 NGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQCLGFTPE  180 
tr|B7Z6S9|B7Z6S     316 NGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQCLGFTPE  378 

cons                316                                                                  378 


sp|P04062|GLCM_     294 HQRDFIARDLGPTLANSTHHNVRLLMLDDQRLLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFL  356 
tr|A9UD35|A9UD3      64 ---------------------------------------------------------------   63 
tr|D1L2S0|D1L2S      60 ---------------------------------------------------------------   59 
pdb|pdb|3gxi_A      255 HQRDFIARDLGPTLANSTHHNVRLLMLDDQRLLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFL  317 
pdb|pdb|2nt1_A      255 HQRDFIARDLGPTLANSTHHNVRLLMLDDQRLLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFL  317 
tr|F6WDY8|F6WDY     294 HQRDFIARDLGPTLANSTHRNVRVLMLDDQRLLLPRWAQVVLADPEAAKYVHGIAVHWYLDFL  356 
sp|Q2KHZ8|GLCM_     294 HQRDFIARDLGPILANSTHRDVRLLMLDDQRLLLPRWAQVVLADPEAAKYVHGIAVHWYLDFL  356 
tr|F5CB27|F5CB2      56 ---------------------------------------------------------------   55 
tr|F5H241|F5H24     181 HQRDFIARDLGPTLANSTHHNVRLLMLDDQRLLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFL  243 
tr|B7Z6S9|B7Z6S     379 HQRDFIARDLGPTLANSTHHNVRLLMLDDQRLLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFL  441 

cons                379                                                                  441 


sp|P04062|GLCM_     357 APAKATLGETHRLFPNTMLFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTD  419 
tr|A9UD35|A9UD3      64 ---------------------------------------------------------------   63 
tr|D1L2S0|D1L2S      60 ---------------------------------------------------------------   59 
pdb|pdb|3gxi_A      318 APAKATLGETHRLFPNTMLFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTD  380 
pdb|pdb|2nt1_A      318 APAKATLGETHRLFPNTMLFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTD  380 
tr|F6WDY8|F6WDY     357 APAKATLGETHRLFPDMMLFASEACVGSKFWEQSVRLGSWDRGVQYSHSIITNLLYHVAGWTD  419 
sp|Q2KHZ8|GLCM_     357 APAKATLGETHRLFPNTMLFASEACVGSKFWEQSVRLGSWDRGMRYSHSIITNLLYHVVGWTD  419 
tr|F5CB27|F5CB2      56 ---------------------------------------------------------------   55 
tr|F5H241|F5H24     244 APAKATLGETHRLFPNTMLFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTD  306 
tr|B7Z6S9|B7Z6S     442 APAKATLGETHRLFPNTMLFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTD  504 

cons                442                                                                  504 


sp|P04062|GLCM_     420 WNLALNPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASQKND  482 
tr|A9UD35|A9UD3      64 ---------------------------------------------------------------   63 
tr|D1L2S0|D1L2S      60 ---------------------------------------------------------------   59 
pdb|pdb|3gxi_A      381 WNLALNPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASQKND  443 
pdb|pdb|2nt1_A      381 WNLALNPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASQKND  443 
tr|F6WDY8|F6WDY     420 WNLALNPEGGPNWVRNFVDSPIIVDIAKDTFYKQPMFYHLGHFSKFIPEGSQRVGLDASEKTN  482 
sp|Q2KHZ8|GLCM_     420 WNLALNPEGGPNWVRNFVDSPIIVDIAKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASKKSD  482 
tr|F5CB27|F5CB2      56 ---------------------------------------------------------------   55 
tr|F5H241|F5H24     307 WNLALNPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASQKND  369 
tr|B7Z6S9|B7Z6S     505 WNLALNPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASQKND  567 

cons                505                                                                  567 


sp|P04062|GLCM_     483 LDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISPGYSIHTYLWRRQ  536 
tr|A9UD35|A9UD3      64 ------------------------------------------------------   63 
tr|D1L2S0|D1L2S      60 ------------------------------------------------------   59 
pdb|pdb|3gxi_A      444 LDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISPGYSIHTYLWHRQ  497 
pdb|pdb|2nt1_A      444 LDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISPGYSIHTYLWHRQ  497 
tr|F6WDY8|F6WDY     483 LDTVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETVSPGYSIHTYLWRRQ  536 
sp|Q2KHZ8|GLCM_     483 LDTVALLRPDGSAVAVVLNRSSKDVPLTIKDPAVGFMETVSPGYSIHTYLWRRQ  536 
tr|F5CB27|F5CB2      56 ------------------------------------------------------   55 
tr|F5H241|F5H24     370 LDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISPGYSIHTYLWRRQ  423 
tr|B7Z6S9|B7Z6S     568 LDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISPGYSIHTYLWRRQ  621 

cons                568                                                         621 





</body></html></addhtml>