Difference between revisions of "Multiple Sequence Alignment: ClustalW - set 3"

From Bioinformatikpedia
Line 7: Line 7:
 
<span style="color:#a30909">P04062 ------------------------------------MEFSSPSREECPKP</span>
 
<span style="color:#a30909">P04062 ------------------------------------MEFSSPSREECPKP</span>
 
<span style="color:#045a21">pdb|pdb|1y7v_A --------------------------------------------------</span>
 
<span style="color:#045a21">pdb|pdb|1y7v_A --------------------------------------------------</span>
pdb|pdb|2nsx_B --------------------------------------------------
+
<span style="color:#045a21">pdb|pdb|2nsx_B --------------------------------------------------</span>
tr|F5CB37|F5CB37_PSECS --------------------------------------------------
+
<span style="color:#045a21">tr|F5CB37|F5CB37_PSECS --------------------------------------------------</span>
tr|A9UD54|A9UD54_PHOPH --------------------------------------------------
+
<span style="color:#045a21">tr|A9UD54|A9UD54_PHOPH --------------------------------------------------</span>
tr|A9UD58|A9UD58_INIGE --------------------------------------------------
+
<span style="color:#045a21">tr|A9UD58|A9UD58_INIGE --------------------------------------------------</span>
tr|G9BHQ3|G9BHQ3_BALAC --------------------------------------------------
+
<span style="color:#045a21">tr|G9BHQ5|G9BHQ3_BALAC --------------------------------------------------</span>
tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------
+
<span style="color:#045a21">tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------</span>
 
tr|B5DYA3|B5DYA3_DROPS --------------------------------------------------
 
tr|B5DYA3|B5DYA3_DROPS --------------------------------------------------
 
tr|B4JTN5|B4JTN5_DROGR --------------------------------------------------
 
tr|B4JTN5|B4JTN5_DROGR --------------------------------------------------
Line 28: Line 28:
 
tr|C6A5Q0|C6A5Q0_BIFLB ----------------------------MMKALKTTVHYDVTAG------
 
tr|C6A5Q0|C6A5Q0_BIFLB ----------------------------MMKALKTTVHYDVTAG------
 
<span style="color:#a30909">P04062 LSRVSIMAGSLTGLLLLQAVSWASGARPCIPKSFGYSSVVCVCNATYCDS</span>
 
<span style="color:#a30909">P04062 LSRVSIMAGSLTGLLLLQAVSWASGARPCIPKSFGYSSVVCVCNATYCDS</span>
pdb|pdb|1y7v_A -------------------------ARPCIPKSFGYSSVVCVCNATYCDS
+
<span style="color:#045a21">pdb|pdb|1y7v_A -------------------------ARPCIPKSFGYSSVVCVCNATYCDS</span>
pdb|pdb|2nsx_B -------------------------ARPCIPKSFGYSSVVCVCNATYCDS
+
<span style="color:#045a21">pdb|pdb|2nsx_B -------------------------ARPCIPKSFGYSSVVCVCNATYCDS</span>
tr|F5CB37|F5CB37_PSECS ------------------------------------------CNATYCDS
+
<span style="color:#045a21">tr|F5CB37|F5CB37_PSECS ------------------------------------------CNATYCDS</span>
tr|A9UD54|A9UD54_PHOPH ------------------------------------------CNATYCDS
+
<span style="color:#045a21">tr|A9UD54|A9UD54_PHOPH ------------------------------------------CNATYCDS</span>
tr|A9UD58|A9UD58_INIGE ------------------------------------------CNATYCDS
+
<span style="color:#045a21">tr|A9UD58|A9UD58_INIGE ------------------------------------------CNATYCDS</span>
tr|G9BHQ3|G9BHQ3_BALAC -----------------------------------------------CDS
+
<span style="color:#045a21">tr|G9BHQ5|G9BHQ3_BALAC -----------------------------------------------CDS</span>
tr|G9BHQ5|G9BHQ5_SOUCH -----------------------------------------------CDS
+
<span style="color:#045a21">tr|G9BHQ5|G9BHQ5_SOUCH -----------------------------------------------CDS</span>
 
tr|B5DYA3|B5DYA3_DROPS -MKEIWLCFLFAVAAISAQPGGTASTQLPCDLRETPHGSVCVCNSTYCDY
 
tr|B5DYA3|B5DYA3_DROPS -MKEIWLCFLFAVAAISAQPGGTASTQLPCDLRETPHGSVCVCNSTYCDY
 
tr|B4JTN5|B4JTN5_DROGR MLKRKSIGLLGAFVLLIAIIGGQAKT-VPCKLKDVKYGKVCVCTADYCDY
 
tr|B4JTN5|B4JTN5_DROGR MLKRKSIGLLGAFVLLIAIIGGQAKT-VPCKLKDVKYGKVCVCTADYCDY
Line 50: Line 50:
 
tr|C6A5Q0|C6A5Q0_BIFLB --RTHTEQTELSVMDEAMN-------------------------------
 
tr|C6A5Q0|C6A5Q0_BIFLB --RTHTEQTELSVMDEAMN-------------------------------
 
<span style="color:#a30909">P04062 FDPPTFPALGTFSRYESTRSGRR-----MELSMG----------------</span>
 
<span style="color:#a30909">P04062 FDPPTFPALGTFSRYESTRSGRR-----MELSMG----------------</span>
pdb|pdb|1y7v_A FDPPTFPALGTFSRYESTRSGRR-----MELSMG----------------
+
<span style="color:#045a21">pdb|pdb|1y7v_A FDPPTFPALGTFSRYESTRSGRR-----MELSMG----------------</span>
pdb|pdb|2nsx_B FDPPTFPALGTFSRYESTRSGRR-----MELSMG----------------
+
<span style="color:#045a21">pdb|pdb|2nsx_B FDPPTFPALGTFSRYESTRSGRR-----MELSMG----------------</span>
tr|F5CB37|F5CB37_PSECS LDPLTLPDPGTFSRFESTRSGRR-----MELSLG----------------
+
<span style="color:#045a21">tr|F5CB37|F5CB37_PSECS LDPLTLPDPGTFSRFESTRSGRR-----MELSLG----------------</span>
tr|A9UD54|A9UD54_PHOPH LDPLTLPDPGTFSRFESTRSGRR-----MELSLG----------------
+
<span style="color:#045a21">tr|A9UD54|A9UD54_PHOPH LDPLTLPDPGTFSRFESTRSGRR-----MELSLG----------------</span>
tr|A9UD58|A9UD58_INIGE LDPLTLPDPGTFSRFESTRSGRR-----MELSLG----------------
+
<span style="color:#045a21">tr|A9UD58|A9UD58_INIGE LDPLTLPDPGTFSRFESTRSGRR-----MELSLG----------------</span>
tr|G9BHQ3|G9BHQ3_BALAC LDPLALPDPGTFSRFESTRSGRR-----MELSLG----------------
+
<span style="color:#045a21">tr|G9BHQ5|G9BHQ3_BALAC LDPLALPDPGTFSRFESTRSGRR-----MELSLG----------------</span>
tr|G9BHQ5|G9BHQ5_SOUCH LDPLTLPDPGTFSRFESTRSGRR-----MELSLG----------------
+
<span style="color:#045a21">tr|G9BHQ5|G9BHQ5_SOUCH LDPLTLPDPGTFSRFESTRSGRR-----MELSLG----------------</span>
 
tr|B5DYA3|B5DYA3_DROPS LEQPELNEGSRIVVISSSKDGLR-----FKVTTGDLSNKAPLVVEDKQST
 
tr|B5DYA3|B5DYA3_DROPS LEQPELNEGSRIVVISSSKDGLR-----FKVTTGDLSNKAPLVVEDKQST
 
tr|B4JTN5|B4JTN5_DROGR LDNPTLSKDDDFAIISSSKQGLR-----FELNTGSFGSKDTYAIEDYVEP
 
tr|B4JTN5|B4JTN5_DROGR LDNPTLSKDDDFAIISSSKQGLR-----FELNTGSFGSKDTYAIEDYVEP
Line 72: Line 72:
 
tr|C6A5Q0|C6A5Q0_BIFLB ------------------------------TEHIVESNVVGIYPDYTFQM
 
tr|C6A5Q0|C6A5Q0_BIFLB ------------------------------TEHIVESNVVGIYPDYTFQM
 
<span style="color:#a30909">P04062 ---------------------------PIQANHTGTGLLLTLQPEQKFQK</span>
 
<span style="color:#a30909">P04062 ---------------------------PIQANHTGTGLLLTLQPEQKFQK</span>
pdb|pdb|1y7v_A ---------------------------PIQANHTGTGLLLTLQPEQKFQK
+
<span style="color:#045a21">pdb|pdb|1y7v_A ---------------------------PIQANHTGTGLLLTLQPEQKFQK</span>
pdb|pdb|2nsx_B ---------------------------PIQANHTGTGLLLTLQPEQKFQK
+
<span style="color:#045a21">pdb|pdb|2nsx_B ---------------------------PIQANHTGTGLLLTLQPEQKFQK</span>
tr|F5CB37|F5CB37_PSECS ---------------------------TIQANRTGTGLLLTLQPD-----
+
<span style="color:#045a21">tr|F5CB37|F5CB37_PSECS ---------------------------TIQANRTGTGLLLTLQPD-----</span>
tr|A9UD54|A9UD54_PHOPH ---------------------------TIQANRTGTGLLLTLQPD-----
+
<span style="color:#045a21">tr|A9UD54|A9UD54_PHOPH ---------------------------TIQANRTGTGLLLTLQPD-----</span>
tr|A9UD58|A9UD58_INIGE ---------------------------TIQANRTGT--------------
+
<span style="color:#045a21">tr|A9UD58|A9UD58_INIGE ---------------------------TIQANRTGT--------------</span>
tr|G9BHQ3|G9BHQ3_BALAC ---------------------------TIQANRTGTGLLLTLQPDQKFQK
+
<span style="color:#045a21">tr|G9BHQ5|G9BHQ3_BALAC ---------------------------TIQANRTGTGLLLTLQPDQKFQK</span>
tr|G9BHQ5|G9BHQ5_SOUCH ---------------------------TIQANRTGTGLLLTLQPDQKFQK
+
<span style="color:#045a21">tr|G9BHQ5|G9BHQ5_SOUCH ---------------------------TIQANRTGTGLLLTLQPDQKFQK</span>
 
tr|B5DYA3|B5DYA3_DROPS DENFHAEAIVVDQHRAWLNLASIPQRLFINASVKTVSVSVKRD--QRYQN
 
tr|B5DYA3|B5DYA3_DROPS DENFHAEAIVVDQHRAWLNLASIPQRLFINASVKTVSVSVKRD--QRYQN
 
tr|B4JTN5|B4JTN5_DROGR ASKFAASNDTILSKLWDQAIDSIFSQSATPASSITRSVTLKLDRSKRFQK
 
tr|B4JTN5|B4JTN5_DROGR ASKFAASNDTILSKLWDQAIDSIFSQSATPASSITRSVTLKLDRSKRFQK
Line 94: Line 94:
 
tr|C6A5Q0|C6A5Q0_BIFLB MEGYGCSLTESACYLLSKMDSATRKEALAQWFG-PAGMDAWFVRVHIDSC
 
tr|C6A5Q0|C6A5Q0_BIFLB MEGYGCSLTESACYLLSKMDSATRKEALAQWFG-PAGMDAWFVRVHIDSC
 
<span style="color:#a30909">P04062 VKGFGGAMTDAAALNILALS-PPAQNLLLKSYFSEEGIGYNIIRVPMASC</span>
 
<span style="color:#a30909">P04062 VKGFGGAMTDAAALNILALS-PPAQNLLLKSYFSEEGIGYNIIRVPMASC</span>
pdb|pdb|1y7v_A VKGFGGAMTDAAALNILALS-PPAQNLLLKSYFSEEGIGYNIIRVPMASC
+
<span style="color:#045a21">pdb|pdb|1y7v_A VKGFGGAMTDAAALNILALS-PPAQNLLLKSYFSEEGIGYNIIRVPMASC</span>
pdb|pdb|2nsx_B VKGFGGAMTDAAALNILALS-PPAQNLLLKSYFSEEGIGYNIIRVPMASC
+
<span style="color:#045a21">pdb|pdb|2nsx_B VKGFGGAMTDAAALNILALS-PPAQNLLLKSYFSEEGIGYNIIRVPMASC</span>
tr|F5CB37|F5CB37_PSECS --------------------------------------------------
+
<span style="color:#045a21">tr|F5CB37|F5CB37_PSECS --------------------------------------------------</span>
tr|A9UD54|A9UD54_PHOPH --------------------------------------------------
+
<span style="color:#045a21">tr|A9UD54|A9UD54_PHOPH --------------------------------------------------</span>
tr|A9UD58|A9UD58_INIGE --------------------------------------------------
+
<span style="color:#045a21">tr|A9UD58|A9UD58_INIGE --------------------------------------------------</span>
tr|G9BHQ3|G9BHQ3_BALAC VK------------------------------------------------
+
<span style="color:#045a21">tr|G9BHQ5|G9BHQ3_BALAC VK------------------------------------------------</span>
tr|G9BHQ5|G9BHQ5_SOUCH VK------------------------------------------------
+
<span style="color:#045a21">tr|G9BHQ5|G9BHQ5_SOUCH VK------------------------------------------------</span>
 
tr|B5DYA3|B5DYA3_DROPS VTNFGGALTGTVSHLLQLLP-TELQDHVYKSYYHDDGIAYNSIRTSIGGC
 
tr|B5DYA3|B5DYA3_DROPS VTNFGGALTGTVSHLLQLLP-TELQDHVYKSYYHDDGIAYNSIRTSIGGC
 
tr|B4JTN5|B4JTN5_DROGR IEGFGGSFTGAVSYLLNNFKEQDIQDHLYKSYYAADGLGFNLLRISIGGC
 
tr|B4JTN5|B4JTN5_DROGR IEGFGGSFTGAVSYLLNNFKEQDIQDHLYKSYYAADGLGFNLLRISIGGC
Line 116: Line 116:
 
tr|C6A5Q0|C6A5Q0_BIFLB DYSLSE-YQAVEDP---LADPELETFSIDRDRQYILPVLKEAMAMAG--H
 
tr|C6A5Q0|C6A5Q0_BIFLB DYSLSE-YQAVEDP---LADPELETFSIDRDRQYILPVLKEAMAMAG--H
 
<span style="color:#a30909">P04062 DFSIRT-YTYADTP---DDFQLHN--FSLPEEDTKLKIPLIHRALQLAQR</span>
 
<span style="color:#a30909">P04062 DFSIRT-YTYADTP---DDFQLHN--FSLPEEDTKLKIPLIHRALQLAQR</span>
pdb|pdb|1y7v_A DFSIRT-YTYADTP---DDFQLHN--FSLPEEDTKLKIPLIHRALQLAQR
+
<span style="color:#045a21">pdb|pdb|1y7v_A DFSIRT-YTYADTP---DDFQLHN--FSLPEEDTKLKIPLIHRALQLAQR</span>
pdb|pdb|2nsx_B DFSIRT-YTYADTP---DDFQLHN--FSLPEEDTKLKIPLIHRALQLAQR
+
<span style="color:#045a21">pdb|pdb|2nsx_B DFSIRT-YTYADTP---DDFQLHN--FSLPEEDTKLKIPLIHRALQLAQR</span>
tr|F5CB37|F5CB37_PSECS --------------------------------------------------
+
<span style="color:#045a21">tr|F5CB37|F5CB37_PSECS --------------------------------------------------</span>
tr|A9UD54|A9UD54_PHOPH --------------------------------------------------
+
<span style="color:#045a21">tr|A9UD54|A9UD54_PHOPH --------------------------------------------------</span>
tr|A9UD58|A9UD58_INIGE --------------------------------------------------
+
<span style="color:#045a21">tr|A9UD58|A9UD58_INIGE --------------------------------------------------</span>
tr|G9BHQ3|G9BHQ3_BALAC --------------------------------------------------
+
<span style="color:#045a21">tr|G9BHQ5|G9BHQ3_BALAC --------------------------------------------------</span>
tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------
+
<span style="color:#045a21">tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------</span>
 
tr|B5DYA3|B5DYA3_DROPS DFDLEP-WAYNELP---RNDVALSNFTELDPRDLQKIEQLKRLKSVARME
 
tr|B5DYA3|B5DYA3_DROPS DFDLEP-WAYNELP---RNDVALSNFTELDPRDLQKIEQLKRLKSVARME
 
tr|B4JTN5|B4JTN5_DROGR DFDLNP-WAYNEEP---QNEVVLTGMDKLHERDVLRVGQIKRMKEVSGET
 
tr|B4JTN5|B4JTN5_DROGR DFDLNP-WAYNEEP---QNEVVLTGMDKLHERDVLRVGQIKRMKEVSGET
Line 138: Line 138:
 
tr|C6A5Q0|C6A5Q0_BIFLB PIHVLLSPWSPPAQWKTPPEMTRNDASVYGGEEGDVIDLSKPGRCFGGRL
 
tr|C6A5Q0|C6A5Q0_BIFLB PIHVLLSPWSPPAQWKTPPEMTRNDASVYGGEEGDVIDLSKPGRCFGGRL
 
<span style="color:#a30909">P04062 PVSLLASPWTSPTWLKTNGAVNGKGSL-------------------KGQP</span>
 
<span style="color:#a30909">P04062 PVSLLASPWTSPTWLKTNGAVNGKGSL-------------------KGQP</span>
pdb|pdb|1y7v_A PVSLLASPWTSPTWLKTNGAVNGKGSL-------------------KGQP
+
<span style="color:#045a21">pdb|pdb|1y7v_A PVSLLASPWTSPTWLKTNGAVNGKGSL-------------------KGQP</span>
pdb|pdb|2nsx_B PVSLLASPWTSPTWLKTNGAVNGKGSL-------------------KGQP
+
<span style="color:#045a21">pdb|pdb|2nsx_B PVSLLASPWTSPTWLKTNGAVNGKGSL-------------------KGQP</span>
tr|F5CB37|F5CB37_PSECS --------------------------------------------------
+
<span style="color:#045a21">tr|F5CB37|F5CB37_PSECS --------------------------------------------------</span>
tr|A9UD54|A9UD54_PHOPH --------------------------------------------------
+
<span style="color:#045a21">tr|A9UD54|A9UD54_PHOPH --------------------------------------------------</span>
tr|A9UD58|A9UD58_INIGE --------------------------------------------------
+
<span style="color:#045a21">tr|A9UD58|A9UD58_INIGE --------------------------------------------------</span>
tr|G9BHQ3|G9BHQ3_BALAC --------------------------------------------------
+
<span style="color:#045a21">tr|G9BHQ5|G9BHQ3_BALAC --------------------------------------------------</span>
tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------
+
<span style="color:#045a21">tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------</span>
 
tr|B5DYA3|B5DYA3_DROPS ELKIMAAAWSAPPWMKTN----DRWTG-------------------FGQL
 
tr|B5DYA3|B5DYA3_DROPS ELKIMAAAWSAPPWMKTN----DRWTG-------------------FGQL
 
tr|B4JTN5|B4JTN5_DROGR NLRIKGAAWSPPKWMKTN----NEWTG-------------------FGQL
 
tr|B4JTN5|B4JTN5_DROGR NLRIKGAAWSPPKWMKTN----NEWTG-------------------FGQL
Line 160: Line 160:
 
tr|C6A5Q0|C6A5Q0_BIFLB KPEYYSSWARYLVRFISAYMAEGVPVTMLSIQNEAAA------ATSWDSC
 
tr|C6A5Q0|C6A5Q0_BIFLB KPEYYSSWARYLVRFISAYMAEGVPVTMLSIQNEAAA------ATSWDSC
 
<span style="color:#a30909">P04062 GDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQCLGF</span>
 
<span style="color:#a30909">P04062 GDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQCLGF</span>
pdb|pdb|1y7v_A GDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQCLGF
+
<span style="color:#045a21">pdb|pdb|1y7v_A GDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQCLGF</span>
pdb|pdb|2nsx_B GDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQCLGF
+
<span style="color:#045a21">pdb|pdb|2nsx_B GDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQCLGF</span>
tr|F5CB37|F5CB37_PSECS --------------------------------------------------
+
<span style="color:#045a21">tr|F5CB37|F5CB37_PSECS --------------------------------------------------</span>
tr|A9UD54|A9UD54_PHOPH --------------------------------------------------
+
<span style="color:#045a21">tr|A9UD54|A9UD54_PHOPH --------------------------------------------------</span>
tr|A9UD58|A9UD58_INIGE --------------------------------------------------
+
<span style="color:#045a21">tr|A9UD58|A9UD58_INIGE --------------------------------------------------</span>
tr|G9BHQ3|G9BHQ3_BALAC --------------------------------------------------
+
<span style="color:#045a21">tr|G9BHQ5|G9BHQ3_BALAC --------------------------------------------------</span>
tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------
+
<span style="color:#045a21">tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------</span>
 
tr|B5DYA3|B5DYA3_DROPS KSEYYQTWALYHLKFLELMQSKNMPIWAISTGNEPLNGVIGFFFVHFMSM
 
tr|B5DYA3|B5DYA3_DROPS KSEYYQTWALYHLKFLELMQSKNMPIWAISTGNEPLNGVIGFFFVHFMSM
 
tr|B4JTN5|B4JTN5_DROGR KREYYQTWANYHLKWLDLMESNGLPIWAISTGNEPLNGIFFMFFVKFMSL
 
tr|B4JTN5|B4JTN5_DROGR KREYYQTWANYHLKWLDLMESNGLPIWAISTGNEPLNGIFFMFFVKFMSL
Line 182: Line 182:
 
tr|C6A5Q0|C6A5Q0_BIFLB LWTGDQ--EREFLKHHLYPAMEEAGLTDAVKIFIWDHNK-------ERAI
 
tr|C6A5Q0|C6A5Q0_BIFLB LWTGDQ--EREFLKHHLYPAMEEAGLTDAVKIFIWDHNK-------ERAI
 
<span style="color:#a30909">P04062 --TPEH--QRDFIARDLGPTLANSTHHNVRLLMLDDQRL-------LLPH</span>
 
<span style="color:#a30909">P04062 --TPEH--QRDFIARDLGPTLANSTHHNVRLLMLDDQRL-------LLPH</span>
pdb|pdb|1y7v_A --TPEH--QRDFIARDLGPTLANSTHHNVRLLMLDDQRL-------LLPH
+
<span style="color:#045a21">pdb|pdb|1y7v_A --TPEH--QRDFIARDLGPTLANSTHHNVRLLMLDDQRL-------LLPH</span>
pdb|pdb|2nsx_B --TPEH--QRDFIARDLGPTLANSTHHNVRLLMLDDQRL-------LLPH
+
<span style="color:#045a21">pdb|pdb|2nsx_B --TPEH--QRDFIARDLGPTLANSTHHNVRLLMLDDQRL-------LLPH</span>
tr|F5CB37|F5CB37_PSECS --------------------------------------------------
+
<span style="color:#045a21">tr|F5CB37|F5CB37_PSECS --------------------------------------------------</span>
tr|A9UD54|A9UD54_PHOPH --------------------------------------------------
+
<span style="color:#045a21">tr|A9UD54|A9UD54_PHOPH --------------------------------------------------</span>
tr|A9UD58|A9UD58_INIGE --------------------------------------------------
+
<span style="color:#045a21">tr|A9UD58|A9UD58_INIGE --------------------------------------------------</span>
tr|G9BHQ3|G9BHQ3_BALAC --------------------------------------------------
+
<span style="color:#045a21">tr|G9BHQ5|G9BHQ3_BALAC --------------------------------------------------</span>
tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------
+
<span style="color:#045a21">tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------</span>
 
tr|B5DYA3|B5DYA3_DROPS GWTPWQ--QAIWLSDHLGPTIRNSTQKPVLIFGNDDQRY-------TFPS
 
tr|B5DYA3|B5DYA3_DROPS GWTPWQ--QAIWLSDHLGPTIRNSTQKPVLIFGNDDQRY-------TFPS
 
tr|B4JTN5|B4JTN5_DROGR GWTPQM--QAVWLNDYLGPTIRNSKHKDIIIFGNDDQRF-------TSPL
 
tr|B4JTN5|B4JTN5_DROGR GWTPQM--QAVWLNDYLGPTIRNSKHKDIIIFGNDDQRF-------TSPL
Line 204: Line 204:
 
tr|C6A5Q0|C6A5Q0_BIFLB ---EHIDEFMSDPEAAKEVGGFAYHWYSGDHFEALSMLRGKYPDKVLMHS
 
tr|C6A5Q0|C6A5Q0_BIFLB ---EHIDEFMSDPEAAKEVGGFAYHWYSGDHFEALSMLRGKYPDKVLMHS
 
<span style="color:#a30909">P04062 ---WAKVVLT-DPEAAKYVHGIAVHWY-----LDFLAPAKATLGETHRLF</span>
 
<span style="color:#a30909">P04062 ---WAKVVLT-DPEAAKYVHGIAVHWY-----LDFLAPAKATLGETHRLF</span>
pdb|pdb|1y7v_A ---WAKVVLT-DPEAAKYVHGIAVHWY-----LDFLAPAKATLGETHRLF
+
<span style="color:#045a21">pdb|pdb|1y7v_A ---WAKVVLT-DPEAAKYVHGIAVHWY-----LDFLAPAKATLGETHRLF</span>
pdb|pdb|2nsx_B ---WAKVVLT-DPEAAKYVHGIAVHWY-----LDFLAPAKATLGETHRLF
+
<span style="color:#045a21">pdb|pdb|2nsx_B ---WAKVVLT-DPEAAKYVHGIAVHWY-----LDFLAPAKATLGETHRLF</span>
tr|F5CB37|F5CB37_PSECS --------------------------------------------------
+
<span style="color:#045a21">tr|F5CB37|F5CB37_PSECS --------------------------------------------------</span>
tr|A9UD54|A9UD54_PHOPH --------------------------------------------------
+
<span style="color:#045a21">tr|A9UD54|A9UD54_PHOPH --------------------------------------------------</span>
tr|A9UD58|A9UD58_INIGE --------------------------------------------------
+
<span style="color:#045a21">tr|A9UD58|A9UD58_INIGE --------------------------------------------------</span>
tr|G9BHQ3|G9BHQ3_BALAC --------------------------------------------------
+
<span style="color:#045a21">tr|G9BHQ5|G9BHQ3_BALAC --------------------------------------------------</span>
tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------
+
<span style="color:#045a21">tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------</span>
 
tr|B5DYA3|B5DYA3_DROPS ---WFRKMRSSRSNSLSYLDGLAVHWY-----WDELVGPQLIDQAHAEMP
 
tr|B5DYA3|B5DYA3_DROPS ---WFRKMRSSRSNSLSYLDGLAVHWY-----WDELVGPQLIDQAHAEMP
 
tr|B4JTN5|B4JTN5_DROGR ---WFKMMNRTRPNSVDYIDGVALHWY-----WDEIFGNSFIHKTNKYME
 
tr|B4JTN5|B4JTN5_DROGR ---WFKMMNRTRPNSVDYIDGVALHWY-----WDEIFGNSFIHKTNKYME
Line 226: Line 226:
 
tr|C6A5Q0|C6A5Q0_BIFLB ESCGLHIPGKVTMLDMTDEQIEALPDGDYKTMVQTTTPNEMDFNDATAYA
 
tr|C6A5Q0|C6A5Q0_BIFLB ESCGLHIPGKVTMLDMTDEQIEALPDGDYKTMVQTTTPNEMDFNDATAYA
 
<span style="color:#a30909">P04062 PNTMLFASEACVGSKFW--EQSVRLG---------------SWDRGMQYS</span>
 
<span style="color:#a30909">P04062 PNTMLFASEACVGSKFW--EQSVRLG---------------SWDRGMQYS</span>
pdb|pdb|1y7v_A PNTMLFASEACVGSKFW--EQSVRLG---------------SWDRGMQYS
+
<span style="color:#045a21">pdb|pdb|1y7v_A PNTMLFASEACVGSKFW--EQSVRLG---------------SWDRGMQYS</span>
pdb|pdb|2nsx_B PNTMLFASEACVGSKFW--EQSVRLG---------------SWDRGMQYS
+
<span style="color:#045a21">pdb|pdb|2nsx_B PNTMLFASEACVGSKFW--EQSVRLG---------------SWDRGMQYS</span>
tr|F5CB37|F5CB37_PSECS --------------------------------------------------
+
<span style="color:#045a21">tr|F5CB37|F5CB37_PSECS --------------------------------------------------</span>
tr|A9UD54|A9UD54_PHOPH --------------------------------------------------
+
<span style="color:#045a21">tr|A9UD54|A9UD54_PHOPH --------------------------------------------------</span>
tr|A9UD58|A9UD58_INIGE --------------------------------------------------
+
<span style="color:#045a21">tr|A9UD58|A9UD58_INIGE --------------------------------------------------</span>
tr|G9BHQ3|G9BHQ3_BALAC --------------------------------------------------
+
<span style="color:#045a21">tr|G9BHQ5|G9BHQ3_BALAC --------------------------------------------------</span>
tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------
+
<span style="color:#045a21">tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------</span>
 
tr|B5DYA3|B5DYA3_DROPS NMLLLNTESCIGDKPWQ--THGPELG---------------SWQRGENYM
 
tr|B5DYA3|B5DYA3_DROPS NMLLLNTESCIGDKPWQ--THGPELG---------------SWQRGENYM
 
tr|B4JTN5|B4JTN5_DROGR NKIQIISESCIGDKPWQ--KAAPLLG---------------SWERGEKMA
 
tr|B4JTN5|B4JTN5_DROGR NKIQIISESCIGDKPWQ--KAAPLLG---------------SWERGEKMA
Line 248: Line 248:
 
tr|C6A5Q0|C6A5Q0_BIFLB HDIIGDLNHGMQRWIDWNMIVDRQGGPRHTP--GGFAAPIVAED-DGRYT
 
tr|C6A5Q0|C6A5Q0_BIFLB HDIIGDLNHGMQRWIDWNMIVDRQGGPRHTP--GGFAAPIVAED-DGRYT
 
<span style="color:#a30909">P04062 HSIITNLLYHVVGWTDWNLALNPEGGPNWVR--NFVDSPIIVDITKDT-F</span>
 
<span style="color:#a30909">P04062 HSIITNLLYHVVGWTDWNLALNPEGGPNWVR--NFVDSPIIVDITKDT-F</span>
pdb|pdb|1y7v_A HSIITNLLYHVVGWTDWNLALNPEGGPNWVR--NFVDSPIIVDITKDT-F
+
<span style="color:#045a21">pdb|pdb|1y7v_A HSIITNLLYHVVGWTDWNLALNPEGGPNWVR--NFVDSPIIVDITKDT-F</span>
pdb|pdb|2nsx_B HSIITNLLYHVVGWTDWNLALNPEGGPNWVR--NFVDSPIIVDITKDT-F
+
<span style="color:#045a21">pdb|pdb|2nsx_B HSIITNLLYHVVGWTDWNLALNPEGGPNWVR--NFVDSPIIVDITKDT-F</span>
tr|F5CB37|F5CB37_PSECS --------------------------------------------------
+
<span style="color:#045a21">tr|F5CB37|F5CB37_PSECS --------------------------------------------------</span>
tr|A9UD54|A9UD54_PHOPH --------------------------------------------------
+
<span style="color:#045a21">tr|A9UD54|A9UD54_PHOPH --------------------------------------------------</span>
tr|A9UD58|A9UD58_INIGE --------------------------------------------------
+
<span style="color:#045a21">tr|A9UD58|A9UD58_INIGE --------------------------------------------------</span>
tr|G9BHQ3|G9BHQ3_BALAC --------------------------------------------------
+
<span style="color:#045a21">tr|G9BHQ5|G9BHQ3_BALAC --------------------------------------------------</span>
tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------
+
<span style="color:#045a21">tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------</span>
 
tr|B5DYA3|B5DYA3_DROPS RAYIQDFQHNFNGWLDWNLVLDEKGGPNYVN--NFVDAPIIVNATSRSEI
 
tr|B5DYA3|B5DYA3_DROPS RAYIQDFQHNFNGWLDWNLVLDEKGGPNYVN--NFVDAPIIVNATSRSEI
 
tr|B4JTN5|B4JTN5_DROGR RSMMSHLQDGFHGWIDWNIILDEEGGPNYVD--NFVDAPVIADTITYTEF
 
tr|B4JTN5|B4JTN5_DROGR RSMMSHLQDGFHGWIDWNIILDEEGGPNYVD--NFVDAPVIADTITYTEF
Line 270: Line 270:
 
tr|C6A5Q0|C6A5Q0_BIFLB LTISYRY-IREIAQAIKPNAVVLGTSTYSRD-----IEAVSARNADGSIG
 
tr|C6A5Q0|C6A5Q0_BIFLB LTISYRY-IREIAQAIKPNAVVLGTSTYSRD-----IEAVSARNADGSIG
 
<span style="color:#a30909">P04062 YKQPMFYHLGHFSKFIPEGSQRVGLVASQKND----LDAVALMHPDGSAV</span>
 
<span style="color:#a30909">P04062 YKQPMFYHLGHFSKFIPEGSQRVGLVASQKND----LDAVALMHPDGSAV</span>
pdb|pdb|1y7v_A YKQPMFYHLGHFSKFIPEGSQRVGLVASQKND----LDAVALMHPDGSAV
+
<span style="color:#045a21">pdb|pdb|1y7v_A YKQPMFYHLGHFSKFIPEGSQRVGLVASQKND----LDAVALMHPDGSAV</span>
pdb|pdb|2nsx_B YKQPMFYHLGHFSKFIPEGSQRVGLVASQKND----LDAVALMHPDGSAV
+
<span style="color:#045a21">pdb|pdb|2nsx_B YKQPMFYHLGHFSKFIPEGSQRVGLVASQKND----LDAVALMHPDGSAV</span>
tr|F5CB37|F5CB37_PSECS --------------------------------------------------
+
<span style="color:#045a21">tr|F5CB37|F5CB37_PSECS --------------------------------------------------</span>
tr|A9UD54|A9UD54_PHOPH --------------------------------------------------
+
<span style="color:#045a21">tr|A9UD54|A9UD54_PHOPH --------------------------------------------------</span>
tr|A9UD58|A9UD58_INIGE --------------------------------------------------
+
<span style="color:#045a21">tr|A9UD58|A9UD58_INIGE --------------------------------------------------</span>
tr|G9BHQ3|G9BHQ3_BALAC --------------------------------------------------
+
<span style="color:#045a21">tr|G9BHQ5|G9BHQ3_BALAC --------------------------------------------------</span>
tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------
+
<span style="color:#045a21">tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------</span>
 
tr|B5DYA3|B5DYA3_DROPS YKQPIYYAIGHFSKFLPAQSVRIETRIEGENNSFSQLSVVGFQRPDGSVA
 
tr|B5DYA3|B5DYA3_DROPS YKQPIYYAIGHFSKFLPAQSVRIETRIEGENNSFSQLSVVGFQRPDGSVA
 
tr|B4JTN5|B4JTN5_DROGR YKQPMFYVMGHFSKLVPEGSVHIEAVASNIN-----LDCIAFIRPDNKIV
 
tr|B4JTN5|B4JTN5_DROGR YKQPMFYVMGHFSKLVPEGSVHIEAVASNIN-----LDCIAFIRPDNKIV
Line 292: Line 292:
 
tr|C6A5Q0|C6A5Q0_BIFLB VVLLNQAERDIPVN-IRMGGLL--------------------------VA
 
tr|C6A5Q0|C6A5Q0_BIFLB VVLLNQAERDIPVN-IRMGGLL--------------------------VA
 
<span style="color:#a30909">P04062 VVVLNRSSKDVPLTIKDPAVG---------------------------FL</span>
 
<span style="color:#a30909">P04062 VVVLNRSSKDVPLTIKDPAVG---------------------------FL</span>
pdb|pdb|1y7v_A VVVLNRSSKDVPLTIKDPAVG---------------------------FL
+
<span style="color:#045a21">pdb|pdb|1y7v_A VVVLNRSSKDVPLTIKDPAVG---------------------------FL</span>
pdb|pdb|2nsx_B VVVLNRSSKDVPLTIKDPAVG---------------------------FL
+
<span style="color:#045a21">pdb|pdb|2nsx_B VVVLNRSSKDVPLTIKDPAVG---------------------------FL</span>
tr|F5CB37|F5CB37_PSECS --------------------------------------------------
+
<span style="color:#045a21">tr|F5CB37|F5CB37_PSECS --------------------------------------------------</span>
tr|A9UD54|A9UD54_PHOPH --------------------------------------------------
+
<span style="color:#045a21">tr|A9UD54|A9UD54_PHOPH --------------------------------------------------</span>
tr|A9UD58|A9UD58_INIGE --------------------------------------------------
+
<span style="color:#045a21">tr|A9UD58|A9UD58_INIGE --------------------------------------------------</span>
tr|G9BHQ3|G9BHQ3_BALAC --------------------------------------------------
+
<span style="color:#045a21">tr|G9BHQ5|G9BHQ3_BALAC --------------------------------------------------</span>
tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------
+
<span style="color:#045a21">tr|G9BHQ5|G9BHQ5_SOUCH --------------------------------------------------</span>
 
tr|B5DYA3|B5DYA3_DROPS LIVYNGQNLPVDVALNDSQSG---------------------------AF
 
tr|B5DYA3|B5DYA3_DROPS LIVYNGQNLPVDVALNDSQSG---------------------------AF
 
tr|B4JTN5|B4JTN5_DROGR AVLFNSGRADLDITIVDTIRG---------------------------EL
 
tr|B4JTN5|B4JTN5_DROGR AVLFNSGRADLDITIVDTIRG---------------------------EL
Line 314: Line 314:
 
tr|C6A5Q0|C6A5Q0_BIFLB DVPLPARTLSTLVFTE------
 
tr|C6A5Q0|C6A5Q0_BIFLB DVPLPARTLSTLVFTE------
 
<span style="color:#a30909">P04062 ETISPGYSIHTYLWRRQ-----</span>
 
<span style="color:#a30909">P04062 ETISPGYSIHTYLWRRQ-----</span>
pdb|pdb|1y7v_A ETISPGYSIHTYLWHRQ-----
+
<span style="color:#045a21">pdb|pdb|1y7v_A ETISPGYSIHTYLWHRQ-----</span>
pdb|pdb|2nsx_B ETISPGYSIHTYLWHRQ-----
+
<span style="color:#045a21">pdb|pdb|2nsx_B ETISPGYSIHTYLWHRQ-----</span>
tr|F5CB37|F5CB37_PSECS ----------------------
+
<span style="color:#045a21">tr|F5CB37|F5CB37_PSECS ----------------------</span>
tr|A9UD54|A9UD54_PHOPH ----------------------
+
<span style="color:#045a21">tr|A9UD54|A9UD54_PHOPH ----------------------</span>
tr|A9UD58|A9UD58_INIGE ----------------------
+
<span style="color:#045a21">tr|A9UD58|A9UD58_INIGE ----------------------</span>
tr|G9BHQ3|G9BHQ3_BALAC ----------------------
+
<span style="color:#045a21">tr|G9BHQ5|G9BHQ3_BALAC ----------------------</span>
tr|G9BHQ5|G9BHQ5_SOUCH ----------------------
+
<span style="color:#045a21">tr|G9BHQ5|G9BHQ5_SOUCH ----------------------</span>
 
tr|B5DYA3|B5DYA3_DROPS NLLLPPRSWHTVLYK-------
 
tr|B5DYA3|B5DYA3_DROPS NLLLPPRSWHTVLYK-------
 
tr|B4JTN5|B4JTN5_DROGR KVNVPAKSIHTLYYN-------
 
tr|B4JTN5|B4JTN5_DROGR KVNVPAKSIHTLYYN-------

Revision as of 12:05, 6 May 2013

CLUSTAL 2.1 multiple sequence alignment


tr|J2STU0|J2STU0_9FLAO      --------------------------------------------------
tr|D4SV88|D4SV88_9XANT      --------------------------------------------------
tr|C6A5Q0|C6A5Q0_BIFLB      --------------------------------------------------
P04062                      ------------------------------------MEFSSPSREECPKP
pdb|pdb|1y7v_A              --------------------------------------------------
pdb|pdb|2nsx_B              --------------------------------------------------
tr|F5CB37|F5CB37_PSECS      --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH      --------------------------------------------------
tr|A9UD58|A9UD58_INIGE      --------------------------------------------------
tr|G9BHQ5|G9BHQ3_BALAC      --------------------------------------------------
tr|G9BHQ5|G9BHQ5_SOUCH      --------------------------------------------------
tr|B5DYA3|B5DYA3_DROPS      --------------------------------------------------
tr|B4JTN5|B4JTN5_DROGR      --------------------------------------------------
tr|E1ZYU8|E1ZYU8_CAMFO      --------------------------------------------------
tr|F4X220|F4X220_ACREC      MATPNELQTRNFDSLLVIPSAARNNMFSLEERFEILKTYFQSQCCVAETV
tr|D0TIX6|D0TIX6_9BACE      --------------------------------------------------
tr|F4E6W5|F4E6W5_BACAM      --------------------------------------------------
tr|B1QKT0|B1QKT0_CLOBO      --------------------------------------------------
tr|E5UPZ0|E5UPZ0_9BACE      --------------------------------------------------
tr|G9MUP6|G9MUP6_HYPVG      --------------------------------------------------
                                                                              

tr|J2STU0|J2STU0_9FLAO      -----------------------------MKKIIVSCFFISVAGNANAQN
tr|D4SV88|D4SV88_9XANT      --------------------------------------------------
tr|C6A5Q0|C6A5Q0_BIFLB      ----------------------------MMKALKTTVHYDVTAG------
P04062                      LSRVSIMAGSLTGLLLLQAVSWASGARPCIPKSFGYSSVVCVCNATYCDS
pdb|pdb|1y7v_A              -------------------------ARPCIPKSFGYSSVVCVCNATYCDS
pdb|pdb|2nsx_B              -------------------------ARPCIPKSFGYSSVVCVCNATYCDS
tr|F5CB37|F5CB37_PSECS      ------------------------------------------CNATYCDS
tr|A9UD54|A9UD54_PHOPH      ------------------------------------------CNATYCDS
tr|A9UD58|A9UD58_INIGE      ------------------------------------------CNATYCDS
tr|G9BHQ5|G9BHQ3_BALAC      -----------------------------------------------CDS
tr|G9BHQ5|G9BHQ5_SOUCH      -----------------------------------------------CDS
tr|B5DYA3|B5DYA3_DROPS      -MKEIWLCFLFAVAAISAQPGGTASTQLPCDLRETPHGSVCVCNSTYCDY
tr|B4JTN5|B4JTN5_DROGR      MLKRKSIGLLGAFVLLIAIIGGQAKT-VPCKLKDVKYGKVCVCTADYCDY
tr|E1ZYU8|E1ZYU8_CAMFO      --------------------------------------------------
tr|F4X220|F4X220_ACREC      RILKRNMGRDRAPTEGAIRKLVRKVRDECIPRSFGNNSIVCVCNSTYCDT
tr|D0TIX6|D0TIX6_9BACE      -------------------------MVLFSLLMVLICLNACSGAKTSDNV
tr|F4E6W5|F4E6W5_BACAM      MFFKKGLYMTLAFLLLSFLLSGSMETEVYATDRKAPDKNKVRVWYSSEKD
tr|B1QKT0|B1QKT0_CLOBO      ------------------------------------------------MK
tr|E5UPZ0|E5UPZ0_9BACE      -------------------------------MKKLSYLFAVAASAACLCA
tr|G9MUP6|G9MUP6_HYPVG      --------------------------------------------------
                                                                              

tr|J2STU0|J2STU0_9FLAO      YWKKNAGKTARVILTNSTTNEKLADKGTVKF-------------------
tr|D4SV88|D4SV88_9XANT      ---MRASTAAAPVVGHALT-------------------------------
tr|C6A5Q0|C6A5Q0_BIFLB      --RTHTEQTELSVMDEAMN-------------------------------
P04062                      FDPPTFPALGTFSRYESTRSGRR-----MELSMG----------------
pdb|pdb|1y7v_A              FDPPTFPALGTFSRYESTRSGRR-----MELSMG----------------
pdb|pdb|2nsx_B              FDPPTFPALGTFSRYESTRSGRR-----MELSMG----------------
tr|F5CB37|F5CB37_PSECS      LDPLTLPDPGTFSRFESTRSGRR-----MELSLG----------------
tr|A9UD54|A9UD54_PHOPH      LDPLTLPDPGTFSRFESTRSGRR-----MELSLG----------------
tr|A9UD58|A9UD58_INIGE      LDPLTLPDPGTFSRFESTRSGRR-----MELSLG----------------
tr|G9BHQ5|G9BHQ3_BALAC      LDPLALPDPGTFSRFESTRSGRR-----MELSLG----------------
tr|G9BHQ5|G9BHQ5_SOUCH      LDPLTLPDPGTFSRFESTRSGRR-----MELSLG----------------
tr|B5DYA3|B5DYA3_DROPS      LEQPELNEGSRIVVISSSKDGLR-----FKVTTGDLSNKAPLVVEDKQST
tr|B4JTN5|B4JTN5_DROGR      LDNPTLSKDDDFAIISSSKQGLR-----FELNTGSFGSKDTYAIEDYVEP
tr|E1ZYU8|E1ZYU8_CAMFO      --------------------------------------------------
tr|F4X220|F4X220_ACREC      VSKQKLQQ-NQLLWYTSTQDGKRMQSSIMN--------------------
tr|D0TIX6|D0TIX6_9BACE      TVYVTTNDRAKDFVRSEIALG-----------------------------
tr|F4E6W5|F4E6W5_BACAM      PASRTWYDGPKEVKYALDEQTPLT--------------------------
tr|B1QKT0|B1QKT0_CLOBO      FIQYKTTKKDKFLKNEINN-------------------------------
tr|E5UPZ0|E5UPZ0_9BACE      CTDVTDVLPAEQIPADARS-------------------------------
tr|G9MUP6|G9MUP6_HYPVG      --MKAFALAAVGLVALTVP-------------------------------
                                                                              

tr|J2STU0|J2STU0_9FLAO      ---------------------------EKFAQPKENEACIFVDPDFKYQK
tr|D4SV88|D4SV88_9XANT      ----------------------------------EKENSIFVNPQRQFQQ
tr|C6A5Q0|C6A5Q0_BIFLB      ------------------------------TEHIVESNVVGIYPDYTFQM
P04062                      ---------------------------PIQANHTGTGLLLTLQPEQKFQK
pdb|pdb|1y7v_A              ---------------------------PIQANHTGTGLLLTLQPEQKFQK
pdb|pdb|2nsx_B              ---------------------------PIQANHTGTGLLLTLQPEQKFQK
tr|F5CB37|F5CB37_PSECS      ---------------------------TIQANRTGTGLLLTLQPD-----
tr|A9UD54|A9UD54_PHOPH      ---------------------------TIQANRTGTGLLLTLQPD-----
tr|A9UD58|A9UD58_INIGE      ---------------------------TIQANRTGT--------------
tr|G9BHQ5|G9BHQ3_BALAC      ---------------------------TIQANRTGTGLLLTLQPDQKFQK
tr|G9BHQ5|G9BHQ5_SOUCH      ---------------------------TIQANRTGTGLLLTLQPDQKFQK
tr|B5DYA3|B5DYA3_DROPS      DENFHAEAIVVDQHRAWLNLASIPQRLFINASVKTVSVSVKRD--QRYQN
tr|B4JTN5|B4JTN5_DROGR      ASKFAASNDTILSKLWDQAIDSIFSQSATPASSITRSVTLKLDRSKRFQK
tr|E1ZYU8|E1ZYU8_CAMFO      -----------------------------------MSKVLTLDSNKKHQQ
tr|F4X220|F4X220_ACREC      ---------------------------FSAKNESEIDLVLTVDINQKFQK
tr|D0TIX6|D0TIX6_9BACE      ------------------------------DKQAASPSVITIDPSVRYQT
tr|F4E6W5|F4E6W5_BACAM      ----------------------------LTKKKASDSTAVYIDPSHRYQS
tr|B1QKT0|B1QKT0_CLOBO      ---------------------------------TTDERPTLHVSQIENRI
tr|E5UPZ0|E5UPZ0_9BACE      ----------------------------------TLGADVVLQWNNEEQT
tr|G9MUP6|G9MUP6_HYPVG      ---------------------------------TTSATSIKINTNSKLQR
                                                                              

tr|J2STU0|J2STU0_9FLAO      LIGIGGAVTDAAAETFYKLPKAKQKEIIDAYYG-KNGLGYTIVRTNMNSC
tr|D4SV88|D4SV88_9XANT      VLGIGGAITDSSAETFAKLPKRAQRALLTAYYDPQQGIGYTLARTTIHSS
tr|C6A5Q0|C6A5Q0_BIFLB      MEGYGCSLTESACYLLSKMDSATRKEALAQWFG-PAGMDAWFVRVHIDSC
P04062                      VKGFGGAMTDAAALNILALS-PPAQNLLLKSYFSEEGIGYNIIRVPMASC
pdb|pdb|1y7v_A              VKGFGGAMTDAAALNILALS-PPAQNLLLKSYFSEEGIGYNIIRVPMASC
pdb|pdb|2nsx_B              VKGFGGAMTDAAALNILALS-PPAQNLLLKSYFSEEGIGYNIIRVPMASC
tr|F5CB37|F5CB37_PSECS      --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH      --------------------------------------------------
tr|A9UD58|A9UD58_INIGE      --------------------------------------------------
tr|G9BHQ5|G9BHQ3_BALAC      VK------------------------------------------------
tr|G9BHQ5|G9BHQ5_SOUCH      VK------------------------------------------------
tr|B5DYA3|B5DYA3_DROPS      VTNFGGALTGTVSHLLQLLP-TELQDHVYKSYYHDDGIAYNSIRTSIGGC
tr|B4JTN5|B4JTN5_DROGR      IEGFGGSFTGAVSYLLNNFKEQDIQDHLYKSYYAADGLGFNLLRISIGGC
tr|E1ZYU8|E1ZYU8_CAMFO      IFGFGGAMTDAAALNIRTLS-NETQRQLLESYFGSTGIGYTFSRIPIAGT
tr|F4X220|F4X220_ACREC      IQGFGGAMTDAAALNIKSLS-NNTQQILLESYFGSKGIGYTFTRIPIAGT
tr|D0TIX6|D0TIX6_9BACE      MDGFGAAVTGSTCYNLMRMAPEDRTAFLKETFSDTEGMGYSYIRISIGCS
tr|F4E6W5|F4E6W5_BACAM      VLGIGSSLEESTISNLSKMSPGKRKEVLKKLVDPNEGIGMDVMRITIGTS
tr|B1QKT0|B1QKT0_CLOBO      IEGFGSCFNELGMKALNHLDKDERNKVLDQLFSIKGDCRFNLCRMPIGAS
tr|E5UPZ0|E5UPZ0_9BACE      IDGFGVAQAGWSDYLYAHRKRQEIMDVMFGQDGLRLSILRGEVFPHYDET
tr|G9MUP6|G9MUP6_HYPVG      IDGFGFSQAFGRASQFQAAEPEMRKKALDLLFDTKTGAGFSIIRNWIPST
                                                                              

tr|J2STU0|J2STU0_9FLAO      DFSSDS-YTYVED-----NDTSLKSFSLAHDEKYKIPMIKEAQKSIG--S
tr|D4SV88|D4SV88_9XANT      DFSSGS-YTYIKE-----GDAALKSFSVKHDAKYRIPMLRQAIAAAG--G
tr|C6A5Q0|C6A5Q0_BIFLB      DYSLSE-YQAVEDP---LADPELETFSIDRDRQYILPVLKEAMAMAG--H
P04062                      DFSIRT-YTYADTP---DDFQLHN--FSLPEEDTKLKIPLIHRALQLAQR
pdb|pdb|1y7v_A              DFSIRT-YTYADTP---DDFQLHN--FSLPEEDTKLKIPLIHRALQLAQR
pdb|pdb|2nsx_B              DFSIRT-YTYADTP---DDFQLHN--FSLPEEDTKLKIPLIHRALQLAQR
tr|F5CB37|F5CB37_PSECS      --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH      --------------------------------------------------
tr|A9UD58|A9UD58_INIGE      --------------------------------------------------
tr|G9BHQ5|G9BHQ3_BALAC      --------------------------------------------------
tr|G9BHQ5|G9BHQ5_SOUCH      --------------------------------------------------
tr|B5DYA3|B5DYA3_DROPS      DFDLEP-WAYNELP---RNDVALSNFTELDPRDLQKIEQLKRLKSVARME
tr|B4JTN5|B4JTN5_DROGR      DFDLNP-WAYNEEP---QNEVVLTGMDKLHERDVLRVGQIKRMKEVSGET
tr|E1ZYU8|E1ZYU8_CAMFO      DFSTRP-YTYDDVP----NDFTLSNFSLVGEDDYKIEYLHRIKNIMSDPE
tr|F4X220|F4X220_ACREC      DFSMRP-YTYDDVP----DDLMLSHFGLVEEDDYKIKYLHNIKKIMSNPD
tr|D0TIX6|D0TIX6_9BACE      DFSLSE-YTCCDTK---GVENFALQ---SEEKEYVIPILKEILAISP---
tr|F4E6W5|F4E6W5_BACAM      DFTAQEFYTYDDMP---EGRKDPKLRHFSIQKDIDLHITATIKEALAINP
tr|B1QKT0|B1QKT0_CLOBO      DY-ATEWYSYNENE----NDFDMEKFSIQKDKRLLIPYIKEALKRNP---
tr|E5UPZ0|E5UPZ0_9BACE      TFNMDEDINLSLDDPFFDIDFNRDENRVAEGIAQRNGQLWIMKKAKQEYG
tr|G9MUP6|G9MUP6_HYPVG      TALSIE-----------PNSPGLASNKPNYTWDGDDEGQIWFTKQAVSYG
                                                                              

tr|J2STU0|J2STU0_9FLAO      SFKLYFSPWSPPAWMKSNKDMLK-----------------------GGRL
tr|D4SV88|D4SV88_9XANT      TLTTFASPWSAPAFMKDSKTMLK-----------------------GGKL
tr|C6A5Q0|C6A5Q0_BIFLB      PIHVLLSPWSPPAQWKTPPEMTRNDASVYGGEEGDVIDLSKPGRCFGGRL
P04062                      PVSLLASPWTSPTWLKTNGAVNGKGSL-------------------KGQP
pdb|pdb|1y7v_A              PVSLLASPWTSPTWLKTNGAVNGKGSL-------------------KGQP
pdb|pdb|2nsx_B              PVSLLASPWTSPTWLKTNGAVNGKGSL-------------------KGQP
tr|F5CB37|F5CB37_PSECS      --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH      --------------------------------------------------
tr|A9UD58|A9UD58_INIGE      --------------------------------------------------
tr|G9BHQ5|G9BHQ3_BALAC      --------------------------------------------------
tr|G9BHQ5|G9BHQ5_SOUCH      --------------------------------------------------
tr|B5DYA3|B5DYA3_DROPS      ELKIMAAAWSAPPWMKTN----DRWTG-------------------FGQL
tr|B4JTN5|B4JTN5_DROGR      NLRIKGAAWSPPKWMKTN----NEWTG-------------------FGQL
tr|E1ZYU8|E1ZYU8_CAMFO      TLRIFTTSWSAPAWMKN-----TNNIK-------------------WGAL
tr|F4X220|F4X220_ACREC      EFRILTTAWSAPAWMKS-----SKSIT-------------------WGIL
tr|D0TIX6|D0TIX6_9BACE      SIKILGSPWTCPRWMKVDNLKDLRPFES----------------WTSGQL
tr|F4E6W5|F4E6W5_BACAM      KLKIIASPWSPPAWMKTNENLKR------------------------GKL
tr|B1QKT0|B1QKT0_CLOBO      NIILTASPWSPPTWMKTQKAYNFGTLR----------------------F
tr|E5UPZ0|E5UPZ0_9BACE      VDKLIFSVWSAPAYMKSNGSTSQ------------------------GFL
tr|G9MUP6|G9MUP6_HYPVG      VKTIYADAWSAPGYMKTNGDEATPGYLCG--------------STGHTCS
                                                                              

tr|J2STU0|J2STU0_9FLAO      ENQYYQTWANYYIKFIQEYEKQGLNIWGLTVQNEPMA------TQTWESC
tr|D4SV88|D4SV88_9XANT      LPEYAQAWATYYTRFIAAYEKAGIPIWGISLQNEPMA------VQTWESM
tr|C6A5Q0|C6A5Q0_BIFLB      KPEYYSSWARYLVRFISAYMAEGVPVTMLSIQNEAAA------ATSWDSC
P04062                      GDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQCLGF
pdb|pdb|1y7v_A              GDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQCLGF
pdb|pdb|2nsx_B              GDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQCLGF
tr|F5CB37|F5CB37_PSECS      --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH      --------------------------------------------------
tr|A9UD58|A9UD58_INIGE      --------------------------------------------------
tr|G9BHQ5|G9BHQ3_BALAC      --------------------------------------------------
tr|G9BHQ5|G9BHQ5_SOUCH      --------------------------------------------------
tr|B5DYA3|B5DYA3_DROPS      KSEYYQTWALYHLKFLELMQSKNMPIWAISTGNEPLNGVIGFFFVHFMSM
tr|B4JTN5|B4JTN5_DROGR      KREYYQTWANYHLKWLDLMESNGLPIWAISTGNEPLNGIFFMFFVKFMSL
tr|E1ZYU8|E1ZYU8_CAMFO      NPEYYQLYADYIKKFFDAYKERGINIWGMTPGNEPIDGLVP--FFPFNSM
tr|F4X220|F4X220_ACREC      KSEYYQLYADYIVKFFDAYKERGINIWGITPGNEPLNGFIP--FFTFNSM
tr|D0TIX6|D0TIX6_9BACE      NPAYYQDYATYFVKWIQAMEAEGIPIEAITPQNEPLN------RGNSASL
tr|F4E6W5|F4E6W5_BACAM      KDKYISELAVYFRKFIEAYEKQGIPIYAMTLQNEPLL------EIDYPSM
tr|B1QKT0|B1QKT0_CLOBO      EEKVLKVYSLYFVKFVQAYEEEGITIHQVYVQNEVVA------DQKFPSC
tr|E5UPZ0|E5UPZ0_9BACE      KRGSYQAFADYLSNFCDAYTAAGLPVYAISPANEPEY------AASWNSC
tr|G9MUP6|G9MUP6_HYPVG      TGDWRQAFANYLVQYVKFYKQEGLDITHLGFLNEPDY------IASYSQM
                                                                              

tr|J2STU0|J2STU0_9FLAO      LYTAEE--EGNFLKNNLGPTLWKNGYKD-KKIMIWDHNR-------DLMF
tr|D4SV88|D4SV88_9XANT      LFSAEE--ERDFLKHHLGPTMASAGYGE-RKIIVWDHNR-------DMMV
tr|C6A5Q0|C6A5Q0_BIFLB      LWTGDQ--EREFLKHHLYPAMEEAGLTDAVKIFIWDHNK-------ERAI
P04062                      --TPEH--QRDFIARDLGPTLANSTHHNVRLLMLDDQRL-------LLPH
pdb|pdb|1y7v_A              --TPEH--QRDFIARDLGPTLANSTHHNVRLLMLDDQRL-------LLPH
pdb|pdb|2nsx_B              --TPEH--QRDFIARDLGPTLANSTHHNVRLLMLDDQRL-------LLPH
tr|F5CB37|F5CB37_PSECS      --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH      --------------------------------------------------
tr|A9UD58|A9UD58_INIGE      --------------------------------------------------
tr|G9BHQ5|G9BHQ3_BALAC      --------------------------------------------------
tr|G9BHQ5|G9BHQ5_SOUCH      --------------------------------------------------
tr|B5DYA3|B5DYA3_DROPS      GWTPWQ--QAIWLSDHLGPTIRNSTQKPVLIFGNDDQRY-------TFPS
tr|B4JTN5|B4JTN5_DROGR      GWTPQM--QAVWLNDYLGPTIRNSKHKDIIIFGNDDQRF-------TSPL
tr|E1ZYU8|E1ZYU8_CAMFO      MWLPRE--GADWVVNHLAPTLSKAGYKDLIYMAMDDQRM-------LLP-
tr|F4X220|F4X220_ACREC      GWTPNT--SAVWTVKHLAPTLTNAGYN-PLYIAMDDQRF-------EIP-
tr|D0TIX6|D0TIX6_9BACE      FMGWEE--QLSFVRDALGPKLKETGLKTKIYAFDHNYNY-------DNML
tr|F4E6W5|F4E6W5_BACAM      YMPPSQ--QRK-LAQALKKEMKKHLIDTKIWIYDHNASG-------AWN-
tr|B1QKT0|B1QKT0_CLOBO      RWTGDQ--LRDFIKNYLGLAFEKHNISSEIWLGTINAPEPYVEWLEDYTQ
tr|E5UPZ0|E5UPZ0_9BACE      LWLPGTTTLGPFIVNNLGPKLRQTHPETRIIFGENAQWSAILG---FIMG
tr|G9MUP6|G9MUP6_HYPVG      QISPSAQEAISFIPTLYETVKREHLDLRLTCCDATGWDT-----------
                                                                              

tr|J2STU0|J2STU0_9FLAO      ---QRATTTLSDPETSKYASGIGYHWY--EVWHNKTQLFDNVIETYRAFP
tr|D4SV88|D4SV88_9XANT      ---HRAHVIFDDPEAAKYAWGMGFHWY--ETWAGFEPMVENVAAVAQAYP
tr|C6A5Q0|C6A5Q0_BIFLB      ---EHIDEFMSDPEAAKEVGGFAYHWYSGDHFEALSMLRGKYPDKVLMHS
P04062                      ---WAKVVLT-DPEAAKYVHGIAVHWY-----LDFLAPAKATLGETHRLF
pdb|pdb|1y7v_A              ---WAKVVLT-DPEAAKYVHGIAVHWY-----LDFLAPAKATLGETHRLF
pdb|pdb|2nsx_B              ---WAKVVLT-DPEAAKYVHGIAVHWY-----LDFLAPAKATLGETHRLF
tr|F5CB37|F5CB37_PSECS      --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH      --------------------------------------------------
tr|A9UD58|A9UD58_INIGE      --------------------------------------------------
tr|G9BHQ5|G9BHQ3_BALAC      --------------------------------------------------
tr|G9BHQ5|G9BHQ5_SOUCH      --------------------------------------------------
tr|B5DYA3|B5DYA3_DROPS      ---WFRKMRSSRSNSLSYLDGLAVHWY-----WDELVGPQLIDQAHAEMP
tr|B4JTN5|B4JTN5_DROGR      ---WFKMMNRTRPNSVDYIDGVALHWY-----WDEIFGNSFIHKTNKYME
tr|E1ZYU8|E1ZYU8_CAMFO      ---WYVETMFTNQKAKEVFSGTAIHWY-----ADKQFSPDRLTRTHNKYP
tr|F4X220|F4X220_ACREC      ---WFTELMFEYPKTKELFSGTAVHWY-----ADEIFSPIRLSQLHDKYP
tr|D0TIX6|D0TIX6_9BACE      EQQGYPMKIYEDENAASFLTGAAYHNYG--------GDREELNNVNGKFP
tr|F4E6W5|F4E6W5_BACAM      ----YIPPILDDKKGNQAADGIAFHDY--------DGDLSVMSEIGRRYP
tr|B1QKT0|B1QKT0_CLOBO      DFDVYAGLVLRDPKAYKYVKGVGYQWAG----------KNAIQRSVEAFP
tr|E5UPZ0|E5UPZ0_9BACE      SKNYVRDILNLNPKITNFPVIAAGHGY--------VDPVTGKDPAIEPFS
tr|G9MUP6|G9MUP6_HYPVG      --QANYTNYLMAAGMQKYLDIISSHMYS---------SDATFPLKTNLPT
                                                                              

tr|J2STU0|J2STU0_9FLAO      DKFLAFTEGCKEVFKMSGIEDVKLGE---------------------LYG
tr|D4SV88|D4SV88_9XANT      DKHLLLTEAAVEKFDPAKLQYWPNGE---------------------RYG
tr|C6A5Q0|C6A5Q0_BIFLB      ESCGLHIPGKVTMLDMTDEQIEALPDGDYKTMVQTTTPNEMDFNDATAYA
P04062                      PNTMLFASEACVGSKFW--EQSVRLG---------------SWDRGMQYS
pdb|pdb|1y7v_A              PNTMLFASEACVGSKFW--EQSVRLG---------------SWDRGMQYS
pdb|pdb|2nsx_B              PNTMLFASEACVGSKFW--EQSVRLG---------------SWDRGMQYS
tr|F5CB37|F5CB37_PSECS      --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH      --------------------------------------------------
tr|A9UD58|A9UD58_INIGE      --------------------------------------------------
tr|G9BHQ5|G9BHQ3_BALAC      --------------------------------------------------
tr|G9BHQ5|G9BHQ5_SOUCH      --------------------------------------------------
tr|B5DYA3|B5DYA3_DROPS      NMLLLNTESCIGDKPWQ--THGPELG---------------SWQRGENYM
tr|B4JTN5|B4JTN5_DROGR      NKIQIISESCIGDKPWQ--KAAPLLG---------------SWERGEKMA
tr|E1ZYU8|E1ZYU8_CAMFO      NKFMLITEACTGTFPTNPFEPKVSLG---------------SWSRGELYM
tr|F4X220|F4X220_ACREC      DKFILMSEACTGSSPFN--KEKVILG---------------SWKRGQKYA
tr|D0TIX6|D0TIX6_9BACE      DKELIFTETSIGMWNDGRNLEKCLMED---------------------ME
tr|F4E6W5|F4E6W5_BACAM      DKSIHLTERSVWG---------------------------------TEGA
tr|B1QKT0|B1QKT0_CLOBO      EKRFIQTENECGNGKNTWIYAEYVFN------------------------
tr|E5UPZ0|E5UPZ0_9BACE      KAESKGIPVWLTEISDPTESYDATMTS------------------GLKWA
tr|G9MUP6|G9MUP6_HYPVG      WLTEAGVETSSAPFTTTWYDDGALNEG------------------MTWAS
                                                                              

tr|J2STU0|J2STU0_9FLAO      KNMINDFNRGTALWTDWNVLLDETGGPNHVG--NFCFAPIIGDTKTGEVH
tr|D4SV88|D4SV88_9XANT      TAIINDLNHGAVGWTDWNILLDQHGGPNHVG--NYCFAPVHADTRTGEVI
tr|C6A5Q0|C6A5Q0_BIFLB      HDIIGDLNHGMQRWIDWNMIVDRQGGPRHTP--GGFAAPIVAED-DGRYT
P04062                      HSIITNLLYHVVGWTDWNLALNPEGGPNWVR--NFVDSPIIVDITKDT-F
pdb|pdb|1y7v_A              HSIITNLLYHVVGWTDWNLALNPEGGPNWVR--NFVDSPIIVDITKDT-F
pdb|pdb|2nsx_B              HSIITNLLYHVVGWTDWNLALNPEGGPNWVR--NFVDSPIIVDITKDT-F
tr|F5CB37|F5CB37_PSECS      --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH      --------------------------------------------------
tr|A9UD58|A9UD58_INIGE      --------------------------------------------------
tr|G9BHQ5|G9BHQ3_BALAC      --------------------------------------------------
tr|G9BHQ5|G9BHQ5_SOUCH      --------------------------------------------------
tr|B5DYA3|B5DYA3_DROPS      RAYIQDFQHNFNGWLDWNLVLDEKGGPNYVN--NFVDAPIIVNATSRSEI
tr|B4JTN5|B4JTN5_DROGR      RSMMSHLQDGFHGWIDWNIILDEEGGPNYVD--NFVDAPVIADTITYTEF
tr|E1ZYU8|E1ZYU8_CAMFO      LDIIENLSHYVSGWVDWNLALNKTGGPNWVE--NYVDSPIIVIP-EEDQF
tr|F4X220|F4X220_ACREC      LNIIENLSHWMVGWIDWNMALDEYGAPNWAK--NYVDSPIIVMP-QTDEF
tr|D0TIX6|D0TIX6_9BACE      ETALGTVNNWCKAVIVWNLMLDNERGPNREGGCQTCYGAVDIDRSDYKTI
tr|F4E6W5|F4E6W5_BACAM      DRIAQYFRNGASSYNAWVTMLDSQIKTHHWIG-TPDPTLFIQDAKNPDRY
tr|B1QKT0|B1QKT0_CLOBO      -LFRHYIVNGVNGYMYWNAVLEPKGMSTWGWE----QNSMITVNPETKEV
tr|E5UPZ0|E5UPZ0_9BACE      KKFHRFLCEANTGAIVWWAGAIPDGG---------TTEGLINIEKNRVDY
tr|G9MUP6|G9MUP6_HYPVG      KLATGFVDAGLSAYLFWEGFEISQNQ-----------SASHLVDVLGQDP
                                                                              

tr|J2STU0|J2STU0_9FLAO      YTYEYYY-IGHLSKYIKPNAHRVASSTNESG-----LLSTSFMNENGQLV
tr|D4SV88|D4SV88_9XANT      YTPSYWY-IGHFSKFIRPGARRVSAASSRSN-----LATTAFRNTDGSLA
tr|C6A5Q0|C6A5Q0_BIFLB      LTISYRY-IREIAQAIKPNAVVLGTSTYSRD-----IEAVSARNADGSIG
P04062                      YKQPMFYHLGHFSKFIPEGSQRVGLVASQKND----LDAVALMHPDGSAV
pdb|pdb|1y7v_A              YKQPMFYHLGHFSKFIPEGSQRVGLVASQKND----LDAVALMHPDGSAV
pdb|pdb|2nsx_B              YKQPMFYHLGHFSKFIPEGSQRVGLVASQKND----LDAVALMHPDGSAV
tr|F5CB37|F5CB37_PSECS      --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH      --------------------------------------------------
tr|A9UD58|A9UD58_INIGE      --------------------------------------------------
tr|G9BHQ5|G9BHQ3_BALAC      --------------------------------------------------
tr|G9BHQ5|G9BHQ5_SOUCH      --------------------------------------------------
tr|B5DYA3|B5DYA3_DROPS      YKQPIYYAIGHFSKFLPAQSVRIETRIEGENNSFSQLSVVGFQRPDGSVA
tr|B4JTN5|B4JTN5_DROGR      YKQPMFYVMGHFSKLVPEGSVHIEAVASNIN-----LDCIAFIRPDNKIV
tr|E1ZYU8|E1ZYU8_CAMFO      YKQPMFYAIAHFSKFVPRNSYVIFS-TLEERFKEENIKSIAFLTPEQKIV
tr|F4X220|F4X220_ACREC      YKQPMFYAISHFSQFVPRNSYRILS-TGLE--DNPNIKTIAFLTPENCIT
tr|D0TIX6|D0TIX6_9BACE      TRNSHYYIIGHLSSVVKPGAVRIGSKGYTADG----IMYSAFENLDGTEA
tr|F4E6W5|F4E6W5_BACAM      WNIPIYHMTGNFSKFVDRGAKRIESNYGSKNT----VSNVSFLNPDQSIV
tr|B1QKT0|B1QKT0_CLOBO      MYNPEFYVMKHFSHFVQKGAKRLTTSGVDS------VDTVAFKNLDESII
tr|E5UPZ0|E5UPZ0_9BACE      EVTKRCEVFGNFSRYIPVGSKRISAQYDFEQG----YMVSGYKYGDNGYT
tr|G9MUP6|G9MUP6_HYPVG      EPSSIYYAFTMWSRFIRPGANRVAVSGALPN-----VITAAFQNTDKSVI
                                                                              

tr|J2STU0|J2STU0_9FLAO      TVIMNDSDHDTE--------------------------------------
tr|D4SV88|D4SV88_9XANT      MVVMNASDVAIAYN-LYVG-EA--------------------------SS
tr|C6A5Q0|C6A5Q0_BIFLB      VVLLNQAERDIPVN-IRMGGLL--------------------------VA
P04062                      VVVLNRSSKDVPLTIKDPAVG---------------------------FL
pdb|pdb|1y7v_A              VVVLNRSSKDVPLTIKDPAVG---------------------------FL
pdb|pdb|2nsx_B              VVVLNRSSKDVPLTIKDPAVG---------------------------FL
tr|F5CB37|F5CB37_PSECS      --------------------------------------------------
tr|A9UD54|A9UD54_PHOPH      --------------------------------------------------
tr|A9UD58|A9UD58_INIGE      --------------------------------------------------
tr|G9BHQ5|G9BHQ3_BALAC      --------------------------------------------------
tr|G9BHQ5|G9BHQ5_SOUCH      --------------------------------------------------
tr|B5DYA3|B5DYA3_DROPS      LIVYNGQNLPVDVALNDSQSG---------------------------AF
tr|B4JTN5|B4JTN5_DROGR      AVLFNSGRADLDITIVDTIRG---------------------------EL
tr|E1ZYU8|E1ZYU8_CAMFO      IVIVNKGKNPIPLTIKDTVRGK--------------------------TI
tr|F4X220|F4X220_ACREC      VVAVNKAYTPSTITIKNKNKNN--------------------------VV
tr|D0TIX6|D0TIX6_9BACE      LVLLNNTDGTKNITVNSGERS----------------------------F
tr|F4E6W5|F4E6W5_BACAM      TVVINQTSAEQKFHVVSEDRQ----------------------------F
tr|B1QKT0|B1QKT0_CLOBO      IVISNKNDDSRIANIEFTG--E--------------------------IF
tr|E5UPZ0|E5UPZ0_9BACE      VVAINPADHEVVISLALESAQVSGALQGYVTDDTRKWELVEAVQPADGVY
tr|G9MUP6|G9MUP6_HYPVG      VIFTNSGNSSQLADVAIPTGKKSSAQVWLTDNNHRVHETN--FKRQSSSI
                                                                              

tr|J2STU0|J2STU0_9FLAO      ----------------------
tr|D4SV88|D4SV88_9XANT      TLQIPAHAIQTVVLGP------
tr|C6A5Q0|C6A5Q0_BIFLB      DVPLPARTLSTLVFTE------
P04062                      ETISPGYSIHTYLWRRQ-----
pdb|pdb|1y7v_A              ETISPGYSIHTYLWHRQ-----
pdb|pdb|2nsx_B              ETISPGYSIHTYLWHRQ-----
tr|F5CB37|F5CB37_PSECS      ----------------------
tr|A9UD54|A9UD54_PHOPH      ----------------------
tr|A9UD58|A9UD58_INIGE      ----------------------
tr|G9BHQ5|G9BHQ3_BALAC      ----------------------
tr|G9BHQ5|G9BHQ5_SOUCH      ----------------------
tr|B5DYA3|B5DYA3_DROPS      NLLLPPRSWHTVLYK-------
tr|B4JTN5|B4JTN5_DROGR      KVNVPAKSIHTLYYN-------
tr|E1ZYU8|E1ZYU8_CAMFO      SVTLPGKSFHTISYSA------
tr|F4X220|F4X220_ACREC      NVCLPAKSFNTLLYLAQE----
tr|D0TIX6|D0TIX6_9BACE      TYEVPAKAVASFRWNLY-----
tr|F4E6W5|F4E6W5_BACAM      EAVIPAKTVATYKWQHKK----
tr|B1QKT0|B1QKT0_CLOBO      EVELEGHSFNTIVLE-------
tr|E5UPZ0|E5UPZ0_9BACE      TLTLPARSVVSYTGTVLSSSSL
tr|G9MUP6|G9MUP6_HYPVG      EVAVPPNSVVTVKFTSR-----