Multiple Sequence Alignment: ClustalW - set 2

From Bioinformatikpedia
Revision as of 12:07, 6 May 2013 by Gerkej (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)

The native protein is colored red in the Alignment.


CLUSTAL 2.1 multiple sequence alignment


tr|E2LY19|E2LY19_MONPE      ----------------------------------------MRPLAFSILL
tr|K9HBW2|K9HBW2_AGABB      ----------------------------------------MQQFAIILIL
tr|H6CEV7|H6CEV7_9BACL      ------------------MKKLQKQRRANLWLLVAAAAILIFAVLVSMVI
tr|B1VPJ0|B1VPJ0_STRGG      ------------------------------------------MAALGVDA
tr|I1WBF3|I1WBF3_BIFAR      ---------------------------------------------MIQAF
tr|D0TN48|D0TN48_9BACE      -----------------------MIDMRNIALTFLGCFTILAACSNSDDA
tr|B5QQZ8|B5QQZ8_LACRH      --------------------------------------------------
tr|Q21GD0|Q21GD0_SACD2      ----------------MENIFHLKKAAFIFCALTSCYNSTASSQQDDYSV
P04062                      MEFSSPSREECPKPLSRVSIMAGSLTGLLLLQAVSWASGARPCIPKSFGY
tr|I9HH59|I9HH59_BACOV      ---------------------------------------MKTQSCMNRLL
                                                                              

tr|E2LY19|E2LY19_MONPE      SVCTPIAGQQIWDIWQTTWDRSKLFTSTPANPPINFGTPSS---------
tr|K9HBW2|K9HBW2_AGABB      ASCVS-AQYAIWDTWSTTWERSNLFTSFKPNPPISFGPVSG---------
tr|H6CEV7|H6CEV7_9BACL      QKILKPEAEHDVSMWLTTPDPANRLTQQAPIHWKNDNSKESI---EKAAI
tr|B1VPJ0|B1VPJ0_STRGG      SVGTARAADPAAQVWITTPDGAKKLSPEGNVPFTGS--------------
tr|I1WBF3|I1WBF3_BIFAR      STYANAQGTTLAAAFAPLGNACLRVGRTPESTAHAS--------------
tr|D0TN48|D0TN48_9BACE      EKPVTPVPTGDVTIYATTSSLTRDLTRDAVNFSSKDN-------------
tr|B5QQZ8|B5QQZ8_LACRH      -MTTTEKGLYPTEFWTVTAGDLAQKRDHLATPKPETTPG-----------
tr|Q21GD0|Q21GD0_SACD2      TATVSTEFNPMSSSWYTNPWPESDIPRRLEQLTPSVITQLG--------Q
P04062                      SSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRRMELSMGPIQANHT
tr|I9HH59|I9HH59_BACOV      WITLLVIGLSGCSEESSSSEENTESGTIQDGDHTDN--------------
                                                                              

tr|E2LY19|E2LY19_MONPE      IGQADIVVNDNQVLQNIYGFGSSLTDNSAMLMNNLKQRNSGNYWNMLNYL
tr|K9HBW2|K9HBW2_AGABB      TGQADIRIDDTSTFQSVWGFGGSLTDSSALTLNNLKSRNSASYRSLLNYL
tr|H6CEV7|H6CEV7_9BACL      SDTLTVEVKPDIRYQKMEGFGAAVSGSSAYLMNHGMSANQR--DQLLNDL
tr|B1VPJ0|B1VPJ0_STRGG      PQAVDIRVDASDKGQKFTGAGASVTGASAHLLQS-LPQAQR--TTVLRSL
tr|I1WBF3|I1WBF3_BIFAR      --APTLSIDTTRVRQPIDGFGASITEATSWLWHNRVTDKER----CIRDL
tr|D0TN48|D0TN48_9BACE      LAPTSITLNPTEQYQTMDGFGAAITGATCFNLLQMKPEDRH---AFLTET
tr|B5QQZ8|B5QQZ8_LACRH      -DAAKIVIDPADRHQEWIGAGAAITDAAASLIWKQSKEQRS---ALLHEM
tr|Q21GD0|Q21GD0_SACD2      TSGTLLEVDPSTTYQTLLGLGASLEHTTVYAIRKNKTAEQQ--KEVLRSL
P04062                      GTGLLLTLQPEQKFQKVKGFGGAMTDAAALNILALSPPAQN---LLLKSY
tr|I9HH59|I9HH59_BACOV      --ATVIQLNSSDQYQTVEGIGGGIANYENWYCQHPNKKELF---------
                                 : :.     *   * *..:                          

tr|E2LY19|E2LY19_MONPE      FSPTDGANAAGLTYIRVPLGASDFS------------SSVYSFDDTAN--
tr|K9HBW2|K9HBW2_AGABB      FNPTDDMNAAGFSYMRIPLGASDFS------------ASAYSYDDTPG--
tr|H6CEV7|H6CEV7_9BACL      FTASG----IQLSYIRHTIGASDYSVDEQGQ------PASYTYDDVATGK
tr|B1VPJ0|B1VPJ0_STRGG      FSSEGDG--IGLNYLRQPLGSTDFDANGN----------AYTYEDTRG--
tr|I1WBF3|I1WBF3_BIFAR      FSPRDG---IGISMLRQPIGPSDHVS------------APYRFVRRFP--
tr|D0TN48|D0TN48_9BACE      FSDDKG---FGFSYIRISIGCSDFS------------LSEYTCCDTKG--
tr|B5QQZ8|B5QQZ8_LACRH      FDPEEG----HFSTIRIPLGSCEPAS-----------QPYYTYDDVPFGE
tr|Q21GD0|Q21GD0_SACD2      IDPVQG---MGMNFFRVSIGTSDFADGTRAIPAPDNAKGWYSYQDTPT--
P04062                      FSEEG----IGYNIIRVPMASCDFSIR------------TYTYADTPD--
tr|I9HH59|I9HH59_BACOV      ----------DLIFKDLEISMIRIGN--------------WYEKKISG--
                                              :.                    :         

tr|E2LY19|E2LY19_MONPE      -DRSLNTFNVN----------RAPSYLFTVLKDIQ-----SVNPLIKVHV
tr|K9HBW2|K9HBW2_AGABB      -DTSFNNFDIN----------RTPSYVFSVLNDIK-----AVNNIMRFHF
tr|H6CEV7|H6CEV7_9BACL      -DYELNHFSIA----------KDR-DVIDVLKQIM-----RRNQDLQIMG
tr|B1VPJ0|B1VPJ0_STRGG      ------AFSID----------RDRSQIIPVLKQAT-----AINPAIRFMG
tr|I1WBF3|I1WBF3_BIFAR      -DRKLSSLNFT----------PEMERVLPMVEAANNCALATQSHALNIMA
tr|D0TN48|D0TN48_9BACE      ----IEHFALQS---------EEKDYILPILKEIL-----SINPSIKVIA
tr|B5QQZ8|B5QQZ8_LACRH      HDASLSKFSVGEGEPGAPDATKDLKYLIPVVQEIL-----AINPAVKIMA
tr|Q21GD0|Q21GD0_SACD2      -----SPFSIAR---------DESLGIIETIRMAVEVG-VETNNELKILA
P04062                      -DFQLHNFSLPE---------EDTKLKIPLIHRALQ----LAQRPVSLLA
tr|I9HH59|I9HH59_BACOV      -----ENPDILK----------QQKEIMDAATQRLG------RSNFSVMM
                                     .                 :                 . .  

tr|E2LY19|E2LY19_MONPE      IPWSPPAWMKNSNTMKG-------------GSLNSNQVQTYAQYLLKSLQ
tr|K9HBW2|K9HBW2_AGABB      IPWSPPGWMKDSGTMKG-------------GALKPELVDEYATYLLKCVQ
tr|H6CEV7|H6CEV7_9BACL      TPWTAPPWMKYGEQIYNGW---------YLDYTDPRVYSAYADYFVRYIQ
tr|B1VPJ0|B1VPJ0_STRGG      SPWSPPAWMKTDNSLNG-------------GSLRPEHYQAYADYLVKAIR
tr|I1WBF3|I1WBF3_BIFAR      SPWSAPWWMKTNLSVLGKRRYTR-----ITGHLRRGMYAAYARYITGFAR
tr|D0TN48|D0TN48_9BACE      APWTCPKWMKVKSLTDLTPLDSW-----TNGQLNPAYYQDYATYFVKWVQ
tr|B5QQZ8|B5QQZ8_LACRH      SPWSAPAWMKSTGELKMGGHLRFGEYTNNGYAIKDTFEGVYAQYFVRYLE
tr|Q21GD0|Q21GD0_SACD2      SPWSPPRWMREGDNMVDG------------GPLKADMLDDYAAYLRKFVE
P04062                      SPWTSPTWLKTNGAVNGKGS--------LKGQPGDIYHQTWARYFVKFLD
tr|I9HH59|I9HH59_BACOV      SNWLVAPDLIDRPKEKGATLK--------RNNEGKYMYKEFGEWCRMTLK
                              *  .  :                               :. :      

tr|E2LY19|E2LY19_MONPE      GFRNNGIPLYAISVQNEPQNNNPT----YPTSTYSPQLEAQVGSALRSLM
tr|K9HBW2|K9HBW2_AGABB      GWNSKGFRAYAVSAQNEPLNSNPT----YPTSKLTAAQEAQIGLRLRSLL
tr|H6CEV7|H6CEV7_9BACL      AYANEGVPIQAISIQNEPEFTTSK----YPSMSMGAAEQAKFIKQYLGPA
tr|B1VPJ0|B1VPJ0_STRGG      AYGQEGITLTDLTAQNEPEFATS-----YPSMSMTSAQQADFLR-VLDRA
tr|I1WBF3|I1WBF3_BIFAR      LYAQRGLPLFALTVTNEPDYPQSR----WPSMAMTPREQAEFVARHLRPM
tr|D0TN48|D0TN48_9BACE      AFNAEGIDIYAVTPQNEP-LNRGN----SASLYMSWEEQRDFVKTALGPK
tr|B5QQZ8|B5QQZ8_LACRH      EYRKYGIPIYAITIQNEP-SNAAA----WPAMIWKIPELAHFGYKFLRPA
tr|Q21GD0|Q21GD0_SACD2      AYQAEGIPIYALSMQNERQFEPGA----YPGMVITWQMERDLLIEVYENF
P04062                      AYAEHKLQFWAVTAENEPSAGLLSG-YPFQCLGFTPEHQRDFIARDLGPT
tr|I9HH59|I9HH59_BACOV      AYQEADMSPDYLSMMNEPDGDNSAGTKIRLGYGIDDSQKANYGKALDATY
                             :    .    ::  **                       .         

tr|E2LY19|E2LY19_MONPE      NNNGFGS-----VKLIGYDHNWDNA-----GTYPVQLMDAAP--NAFAGV
tr|K9HBW2|K9HBW2_AGABB      NSNGFSD-----TKIVGYDHNWSNA-----GGYPVQLMQDAG--SAFDGV
tr|H6CEV7|H6CEV7_9BACL      LSRNHLP-----TQIIAFDHNWDIG-----SDYAKTVLGDEQARSYTHGT
tr|B1VPJ0|B1VPJ0_STRGG      LTAANLP-----TNILAYDHNWDH------PNYPLDVFARTGGIQRIIGA
tr|I1WBF3|I1WBF3_BIFAR      LDHAGLDG----TRILCWDHNYSTDHYP-DGAFVRDMYADSAALAACAGS
tr|D0TN48|D0TN48_9BACE      FKTAGLA-----TKIYAYDHNYDYSDIETEKNYPGKMYEDAAASQYLAGA
tr|B5QQZ8|B5QQZ8_LACRH      LDKTFPD-----TKIYFWDGSLNVLD---VIDKPLSELVTPDEAAAFDGF
tr|Q21GD0|Q21GD0_SACD2      HNIDGNYGPELDVKLWTLDHNFDYWQ---QAKLQLDSFKAMGKDHYVDAT
P04062                      LANSTHHN----VRLLMLDDQRLLLP-----HWAKVVLTDPEAAKYVHGI
tr|I9HH59|I9HH59_BACOV      EAFKEVSK---RPKLIGPEVLGIGYG-------TFSNYYRDLNPDLLDAA
                                         .:   :                             . 

tr|E2LY19|E2LY19_MONPE      AFHCYAGSVS----QQDQFRNRYPNKEVYFTECSG-------TLGS----
tr|K9HBW2|K9HBW2_AGABB      SFHCYAGNVS----QQDTFHSQFSDKQIYFTECSG-------TFGS----
tr|H6CEV7|H6CEV7_9BACL      AFHCYKGEPT----AMTDVHHAFPDKPVYMTECSG-------GAWS---P
tr|B1VPJ0|B1VPJ0_STRGG      AFHCYGGAPA----AQKQIADAG--KRVFFTECSG-------TDSANPAT
tr|I1WBF3|I1WBF3_BIFAR      AWHYYGGSAR----TMSRIHDAFPNKGIWVTEASG-------GDWG---P
tr|D0TN48|D0TN48_9BACE      AYHNYGGNRE----ELLNIHKAYPEKELLFTETSI-------GTWNS-GR
tr|B5QQZ8|B5QQZ8_LACRH      AFHTYDGPYT----NLFKGSRLNPNWKLAMTERRC-------MIEET---
tr|Q21GD0|Q21GD0_SACD2      AFHHYGGVSE----NMGQLHDAHPDKDVVFTEG---------TIWG----
P04062                      AVHWYLDFLAPAKATLGETHRLFPNTMLFASEACVGS-----KFWEQSVR
tr|I9HH59|I9HH59_BACOV      AFHCYHGGKTSDYKDNDRYSSAHAFKTEFQNIVRQVGNKSIMMTENCSYH
                            : * * .                       .                   

tr|E2LY19|E2LY19_MONPE      DWWTDLKVRLKSFSV-----------------------------------
tr|K9HBW2|K9HBW2_AGABB      DWWSDIKWYMDNIAIGSIERSSHTGLMWNIALDGSGNPKLPGTSSCGGPG
tr|H6CEV7|H6CEV7_9BACL      GFGDDLSWDMSKLIIGAPRNWSQNVLFWNIVLDPSGGPTNGGCTN-----
tr|B1VPJ0|B1VPJ0_STRGG      TFGDTLKWHAENLVVQNMRNGGETVINWNLALDRNGGPHQGHCTNR----
tr|I1WBF3|I1WBF3_BIFAR      RNFTPALLSLGTAVIDMMNNWARSAVLWNIALDEHGGPDYYYLRNDRRHS
tr|D0TN48|D0TN48_9BACE      DLSKRLLEDMKEVALGTINNWCRGVIVWNLMLDNDRAPNREGGCQT----
tr|B5QQZ8|B5QQZ8_LACRH      -PEDASHIMFGLIGNWLVRQGLNMIDLWNIALDERGLPNQVGSTGR----
tr|Q21GD0|Q21GD0_SACD2      -LSSDGNKRSYEALIRHFRNWATGYLSWVTMTTQTLNEANQGPYNGLGAF
P04062                      LGSWDRGMQYSHSIITNLLYHVVGWTDWNLALNPEGGPNWVRNFVD----
tr|I9HH59|I9HH59_BACOV      PAVPEDAVNIAHFISNSFRYANATVYLHWALLWGYADADELKKGGDGCIA
                                                                              

tr|E2LY19|E2LY19_MONPE      ----LFQVN-----ACSVVHGQYLLG------------------------
tr|K9HBW2|K9HBW2_AGABB      -CRPLVTVNS--DGTWSVNQEFYALAQASKAILPRDVGGPFGKRIGVSVG
tr|H6CEV7|H6CEV7_9BACL      -CRGVVTIDPL-SGAVTKNVEYYALGHASKFVRPG-------------AV
tr|B1VPJ0|B1VPJ0_STRGG      -CNGIVEID---GGQVTRNAEFYVLGHVSKFVKAG-------------AT
tr|I1WBF3|I1WBF3_BIFAR      ENRGLITVRD--DGSIRRNADYYALGHFSKYVPIG-------------SH
tr|D0TN48|D0TN48_9BACE      -CYGAVDISNSDYKTIIRNSHYYIIAHLSSVVKPG-------------AV
tr|B5QQZ8|B5QQZ8_LACRH      --RGVVTIDHT-TGKVQRNLEYYMLRNFNQDVIPG---------SIVIGS
tr|Q21GD0|Q21GD0_SACD2      DPTLLVKYDGD-NANWYKTPEYWLMSQFSKYLKPG-------------AL
P04062                      -SPIIVDITKD---TFYKQPMFYHLGHFSKFIPEG-------------SQ
tr|I9HH59|I9HH59_BACOV      VEWPWSSSRWTTEKGYVVRSEFYGLKHFTKYVKPG--------------W
                                                  : :                         

tr|E2LY19|E2LY19_MONPE      ----------KLVNHVYAEKEWIILHLGSL--------------------
tr|K9HBW2|K9HBW2_AGABB      GELNWALRVSAFVTGRVDSSEWQRYSIVVLN-------------------
tr|H6CEV7|H6CEV7_9BACL      RIDSTHY-SGSIETVAYRNPDGTLVLIALP--------------------
tr|B1VPJ0|B1VPJ0_STRGG      RIGSTSQGAGGVQNVAFQNSDGSRAAVVVNTGSGAQRFSLTDNGKSLAYT
tr|I1WBF3|I1WBF3_BIFAR      CVECALDHAQGVRAAAFLTPTGTLVAVLAN--------------------
tr|D0TN48|D0TN48_9BACE      RIGASGYADSNIMYSAFENPDGTYAFVLMNN-------------------
tr|B5QQZ8|B5QQZ8_LACRH      TNYTQDGYTGGLGSVAFLAPDGAIAAHLYNP-------------------
tr|Q21GD0|Q21GD0_SACD2      RIESNYGSLQTVTNVAFLNPDGYVVLIVANSTNGVQQFDVISEGNQFNAS
P04062                      RVGLVASQKNDLDAVALMHPDGSAVVVVLNR-------------------
tr|I9HH59|I9HH59_BACOV      RRIGVDYELKEVEVVAFQDPDEYQIAVVLVN-------------------
                                       .                                      

tr|E2LY19|E2LY19_MONPE      --------------------------------------------------
tr|K9HBW2|K9HBW2_AGABB      --------------------------------------------------
tr|H6CEV7|H6CEV7_9BACL      --------------------------------------------------
tr|B1VPJ0|B1VPJ0_STRGG      LPAGAVATFTWDGSGGTTEPPAGSIDPAAWYQVRNAGSGACLDAADWGTA
tr|I1WBF3|I1WBF3_BIFAR      --------------------------------------------------
tr|D0TN48|D0TN48_9BACE      --------------------------------------------------
tr|B5QQZ8|B5QQZ8_LACRH      --------------------------------------------------
tr|Q21GD0|Q21GD0_SACD2      VPARSIATYRWKAGLGQSPHSWQAPPELPQFPYAENSIEIPGLVEAEHYD
P04062                      --------------------------------------------------
tr|I9HH59|I9HH59_BACOV      --------------------------------------------------
                                                                              

tr|E2LY19|E2LY19_MONPE      --------------------------------------------------
tr|K9HBW2|K9HBW2_AGABB      -------------------WDDSVGGWNPQPVRATIEFRGTQASYTFPVG
tr|H6CEV7|H6CEV7_9BACL      -------------------IRERTGRHLRFG---------------REAK
tr|B1VPJ0|B1VPJ0_STRGG      NGTALQQWSCGAGANQGWQFRPTSGGHYQVVNRHNAKVWDVVGGSGGTAD
tr|I1WBF3|I1WBF3_BIFAR      ------------------------------------------------ER
tr|D0TN48|D0TN48_9BACE      -----------------------------------------------NEK
tr|B5QQZ8|B5QQZ8_LACRH      --------------------SGKPLDAAVTINNDGPVTWQHVTVPAWGTV
tr|Q21GD0|Q21GD0_SACD2      LGGAGAAYADVSTGNNGGVLRADDVDIEANANGYHIGWLDAGEWLEYSVN
P04062                      -----------------------------------------------SSK
tr|I9HH59|I9HH59_BACOV      ------------------------------YSEQEEKTVRLENIGSKEVS
                                                                              

tr|E2LY19|E2LY19_MONPE      --------------------------------------------------
tr|K9HBW2|K9HBW2_AGABB      VTT-----------------------------------------------
tr|H6CEV7|H6CEV7_9BACL      FSQ-----------------------------------------------
tr|B1VPJ0|B1VPJ0_STRGG      GTK-----------------------------------------------
tr|I1WBF3|I1WBF3_BIFAR      AES-----------------------------------------------
tr|D0TN48|D0TN48_9BACE      TKK-----------------------------------------------
tr|B5QQZ8|B5QQZ8_LACRH      TLH-----------------------------------------------
tr|Q21GD0|Q21GD0_SACD2      VNQGQSFDVLIASASASSGGQFHFEVNGESVSPILVTPATGGWKTFVSTL
P04062                      DVP-----------------------------------------------
tr|I9HH59|I9HH59_BACOV      SIR-----------------------------------------------
                                                                              

tr|E2LY19|E2LY19_MONPE      --------------------------------------------------
tr|K9HBW2|K9HBW2_AGABB      ---LWWYAPSTSFDVCGSSNTEEQGPMVFLNDQQGQVPLNF---------
tr|H6CEV7|H6CEV7_9BACL      ---LHFHPSQ----------RLPFNGILRLHDTASQQCL-----------
tr|B1VPJ0|B1VPJ0_STRGG      ---VHLWSYEGGANQQWRPEALAGGGQYRFVARHSGKCLGVDNSSTADGA
tr|I1WBF3|I1WBF3_BIFAR      ---IWVQCEVD-----------DSGIGVRLPSRSLTTVLRR---------
tr|D0TN48|D0TN48_9BACE      ---ITLSDGKR-------------HFAYDVPGKSVTSYRWAKSE------
tr|B5QQZ8|B5QQZ8_LACRH      ---KAFGPVNESAPRQDEDFKLNPYPANLMDDWAPGKGVNANKK------
tr|Q21GD0|Q21GD0_SACD2      HRGLQLNAGEQVLRLVIDGGEFNIDSFHIVPAGSMEPPVQEDICEEATVS
P04062                      ---LTIKDPAVG------------FLETISPGYSIHTYLWRRQ-------
tr|I9HH59|I9HH59_BACOV      ---KVIQTDTQKESWYQELKNTDPFVELVLPKMSVTTVYFKFKTN-----
                                                                              

tr|E2LY19|E2LY19_MONPE      --------------------------------------------------
tr|K9HBW2|K9HBW2_AGABB      --------------------------------------------------
tr|H6CEV7|H6CEV7_9BACL      --------------------------------------------------
tr|B1VPJ0|B1VPJ0_STRGG      RLSQQPCSGSPAQAFTLTR-------------------------------
tr|I1WBF3|I1WBF3_BIFAR      --------------------------------------------------
tr|D0TN48|D0TN48_9BACE      --------------------------------------------------
tr|B5QQZ8|B5QQZ8_LACRH      --------------------------------------------------
tr|Q21GD0|Q21GD0_SACD2      ILAGKIQAESYCLASGIQTENTSDQGGGENIGWIDAGDSVDYGVSVANAG
P04062                      --------------------------------------------------
tr|I9HH59|I9HH59_BACOV      --------------------------------------------------
                                                                              

tr|E2LY19|E2LY19_MONPE      --------------------------------------------------
tr|K9HBW2|K9HBW2_AGABB      --------------------------------------------------
tr|H6CEV7|H6CEV7_9BACL      --------------------------------------------------
tr|B1VPJ0|B1VPJ0_STRGG      --------------------------------------------------
tr|I1WBF3|I1WBF3_BIFAR      --------------------------------------------------
tr|D0TN48|D0TN48_9BACE      --------------------------------------------------
tr|B5QQZ8|B5QQZ8_LACRH      --------------------------------------------------
tr|Q21GD0|Q21GD0_SACD2      SYTLNLRVASQNGGGEIALSVGDTVLANVQIPGTGGWQNWQTISVPVQLS
P04062                      --------------------------------------------------
tr|I9HH59|I9HH59_BACOV      --------------------------------------------------
                                                                              

tr|E2LY19|E2LY19_MONPE      --------------------------------------------------
tr|K9HBW2|K9HBW2_AGABB      --------------------------------------------------
tr|H6CEV7|H6CEV7_9BACL      --------------------------------------------------
tr|B1VPJ0|B1VPJ0_STRGG      --------------------------------------------------
tr|I1WBF3|I1WBF3_BIFAR      --------------------------------------------------
tr|D0TN48|D0TN48_9BACE      --------------------------------------------------
tr|B5QQZ8|B5QQZ8_LACRH      --------------------------------------------------
tr|Q21GD0|Q21GD0_SACD2      AGYQQLHFVFINGGLNINWFEFVETDNPTDPTDPTDPAAELEEGAYYIIN
P04062                      --------------------------------------------------
tr|I9HH59|I9HH59_BACOV      --------------------------------------------------
                                                                              

tr|E2LY19|E2LY19_MONPE      --------------------------------------------------
tr|K9HBW2|K9HBW2_AGABB      --------------------------------------------------
tr|H6CEV7|H6CEV7_9BACL      --------------------------------------------------
tr|B1VPJ0|B1VPJ0_STRGG      --------------------------------------------------
tr|I1WBF3|I1WBF3_BIFAR      --------------------------------------------------
tr|D0TN48|D0TN48_9BACE      --------------------------------------------------
tr|B5QQZ8|B5QQZ8_LACRH      --------------------------------------------------
tr|Q21GD0|Q21GD0_SACD2      EASGKALDVSGVSTSNGTNVQQWSYSGGLNQQWIAQHVSGNTFELVSLNS
P04062                      --------------------------------------------------
tr|I9HH59|I9HH59_BACOV      --------------------------------------------------
                                                                              

tr|E2LY19|E2LY19_MONPE      --------------------------------------------------
tr|K9HBW2|K9HBW2_AGABB      --------------------------------------------------
tr|H6CEV7|H6CEV7_9BACL      --------------------------------------------------
tr|B1VPJ0|B1VPJ0_STRGG      --------------------------------------------------
tr|I1WBF3|I1WBF3_BIFAR      --------------------------------------------------
tr|D0TN48|D0TN48_9BACE      --------------------------------------------------
tr|B5QQZ8|B5QQZ8_LACRH      --------------------------------------------------
tr|Q21GD0|Q21GD0_SACD2      GSCLDADNGSDNAHQWACEGNTNQQWVIEGQSDGTYLIRTKAGNEVLEVQ
P04062                      --------------------------------------------------
tr|I9HH59|I9HH59_BACOV      --------------------------------------------------
                                                                              

tr|E2LY19|E2LY19_MONPE      -----------------------------
tr|K9HBW2|K9HBW2_AGABB      -----------------------------
tr|H6CEV7|H6CEV7_9BACL      -----------------------------
tr|B1VPJ0|B1VPJ0_STRGG      -----------------------------
tr|I1WBF3|I1WBF3_BIFAR      -----------------------------
tr|D0TN48|D0TN48_9BACE      -----------------------------
tr|B5QQZ8|B5QQZ8_LACRH      -----------------------------
tr|Q21GD0|Q21GD0_SACD2      GGSANNGANVRTASSVNNNRQKWRFNDVE
P04062                      -----------------------------
tr|I9HH59|I9HH59_BACOV      -----------------------------