Difference between revisions of "Multiple Sequence Alignment: ClustalW - set 2"

From Bioinformatikpedia
(Created page with " CLUSTAL 2.1 multiple sequence alignment tr|E2LY19|E2LY19_MONPE ----------------------------------------MRPLAFSILL tr|K9HBW2|K9HBW2_AGABB ------------------------…")
 
Line 10: Line 10:
 
tr|B5QQZ8|B5QQZ8_LACRH --------------------------------------------------
 
tr|B5QQZ8|B5QQZ8_LACRH --------------------------------------------------
 
tr|Q21GD0|Q21GD0_SACD2 ----------------MENIFHLKKAAFIFCALTSCYNSTASSQQDDYSV
 
tr|Q21GD0|Q21GD0_SACD2 ----------------MENIFHLKKAAFIFCALTSCYNSTASSQQDDYSV
P04062 MEFSSPSREECPKPLSRVSIMAGSLTGLLLLQAVSWASGARPCIPKSFGY
+
<span style="color:#a30909">P04062 MEFSSPSREECPKPLSRVSIMAGSLTGLLLLQAVSWASGARPCIPKSFGY
 
tr|I9HH59|I9HH59_BACOV ---------------------------------------MKTQSCMNRLL
 
tr|I9HH59|I9HH59_BACOV ---------------------------------------MKTQSCMNRLL
 
 
Line 22: Line 22:
 
tr|B5QQZ8|B5QQZ8_LACRH -MTTTEKGLYPTEFWTVTAGDLAQKRDHLATPKPETTPG-----------
 
tr|B5QQZ8|B5QQZ8_LACRH -MTTTEKGLYPTEFWTVTAGDLAQKRDHLATPKPETTPG-----------
 
tr|Q21GD0|Q21GD0_SACD2 TATVSTEFNPMSSSWYTNPWPESDIPRRLEQLTPSVITQLG--------Q
 
tr|Q21GD0|Q21GD0_SACD2 TATVSTEFNPMSSSWYTNPWPESDIPRRLEQLTPSVITQLG--------Q
P04062 SSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRRMELSMGPIQANHT
+
<span style="color:#a30909">P04062 SSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRRMELSMGPIQANHT
 
tr|I9HH59|I9HH59_BACOV WITLLVIGLSGCSEESSSSEENTESGTIQDGDHTDN--------------
 
tr|I9HH59|I9HH59_BACOV WITLLVIGLSGCSEESSSSEENTESGTIQDGDHTDN--------------
 
 
Line 34: Line 34:
 
tr|B5QQZ8|B5QQZ8_LACRH -DAAKIVIDPADRHQEWIGAGAAITDAAASLIWKQSKEQRS---ALLHEM
 
tr|B5QQZ8|B5QQZ8_LACRH -DAAKIVIDPADRHQEWIGAGAAITDAAASLIWKQSKEQRS---ALLHEM
 
tr|Q21GD0|Q21GD0_SACD2 TSGTLLEVDPSTTYQTLLGLGASLEHTTVYAIRKNKTAEQQ--KEVLRSL
 
tr|Q21GD0|Q21GD0_SACD2 TSGTLLEVDPSTTYQTLLGLGASLEHTTVYAIRKNKTAEQQ--KEVLRSL
P04062 GTGLLLTLQPEQKFQKVKGFGGAMTDAAALNILALSPPAQN---LLLKSY
+
<span style="color:#a30909">P04062 GTGLLLTLQPEQKFQKVKGFGGAMTDAAALNILALSPPAQN---LLLKSY
 
tr|I9HH59|I9HH59_BACOV --ATVIQLNSSDQYQTVEGIGGGIANYENWYCQHPNKKELF---------
 
tr|I9HH59|I9HH59_BACOV --ATVIQLNSSDQYQTVEGIGGGIANYENWYCQHPNKKELF---------
 
: :. * * *..:
 
: :. * * *..:
Line 46: Line 46:
 
tr|B5QQZ8|B5QQZ8_LACRH FDPEEG----HFSTIRIPLGSCEPAS-----------QPYYTYDDVPFGE
 
tr|B5QQZ8|B5QQZ8_LACRH FDPEEG----HFSTIRIPLGSCEPAS-----------QPYYTYDDVPFGE
 
tr|Q21GD0|Q21GD0_SACD2 IDPVQG---MGMNFFRVSIGTSDFADGTRAIPAPDNAKGWYSYQDTPT--
 
tr|Q21GD0|Q21GD0_SACD2 IDPVQG---MGMNFFRVSIGTSDFADGTRAIPAPDNAKGWYSYQDTPT--
P04062 FSEEG----IGYNIIRVPMASCDFSIR------------TYTYADTPD--
+
<span style="color:#a30909">P04062 FSEEG----IGYNIIRVPMASCDFSIR------------TYTYADTPD--
 
tr|I9HH59|I9HH59_BACOV ----------DLIFKDLEISMIRIGN--------------WYEKKISG--
 
tr|I9HH59|I9HH59_BACOV ----------DLIFKDLEISMIRIGN--------------WYEKKISG--
 
:. :
 
:. :
Line 58: Line 58:
 
tr|B5QQZ8|B5QQZ8_LACRH HDASLSKFSVGEGEPGAPDATKDLKYLIPVVQEIL-----AINPAVKIMA
 
tr|B5QQZ8|B5QQZ8_LACRH HDASLSKFSVGEGEPGAPDATKDLKYLIPVVQEIL-----AINPAVKIMA
 
tr|Q21GD0|Q21GD0_SACD2 -----SPFSIAR---------DESLGIIETIRMAVEVG-VETNNELKILA
 
tr|Q21GD0|Q21GD0_SACD2 -----SPFSIAR---------DESLGIIETIRMAVEVG-VETNNELKILA
P04062 -DFQLHNFSLPE---------EDTKLKIPLIHRALQ----LAQRPVSLLA
+
<span style="color:#a30909">P04062 -DFQLHNFSLPE---------EDTKLKIPLIHRALQ----LAQRPVSLLA
 
tr|I9HH59|I9HH59_BACOV -----ENPDILK----------QQKEIMDAATQRLG------RSNFSVMM
 
tr|I9HH59|I9HH59_BACOV -----ENPDILK----------QQKEIMDAATQRLG------RSNFSVMM
 
. : . .
 
. : . .
Line 70: Line 70:
 
tr|B5QQZ8|B5QQZ8_LACRH SPWSAPAWMKSTGELKMGGHLRFGEYTNNGYAIKDTFEGVYAQYFVRYLE
 
tr|B5QQZ8|B5QQZ8_LACRH SPWSAPAWMKSTGELKMGGHLRFGEYTNNGYAIKDTFEGVYAQYFVRYLE
 
tr|Q21GD0|Q21GD0_SACD2 SPWSPPRWMREGDNMVDG------------GPLKADMLDDYAAYLRKFVE
 
tr|Q21GD0|Q21GD0_SACD2 SPWSPPRWMREGDNMVDG------------GPLKADMLDDYAAYLRKFVE
P04062 SPWTSPTWLKTNGAVNGKGS--------LKGQPGDIYHQTWARYFVKFLD
+
<span style="color:#a30909">P04062 SPWTSPTWLKTNGAVNGKGS--------LKGQPGDIYHQTWARYFVKFLD
 
tr|I9HH59|I9HH59_BACOV SNWLVAPDLIDRPKEKGATLK--------RNNEGKYMYKEFGEWCRMTLK
 
tr|I9HH59|I9HH59_BACOV SNWLVAPDLIDRPKEKGATLK--------RNNEGKYMYKEFGEWCRMTLK
 
* . : :. :
 
* . : :. :
Line 82: Line 82:
 
tr|B5QQZ8|B5QQZ8_LACRH EYRKYGIPIYAITIQNEP-SNAAA----WPAMIWKIPELAHFGYKFLRPA
 
tr|B5QQZ8|B5QQZ8_LACRH EYRKYGIPIYAITIQNEP-SNAAA----WPAMIWKIPELAHFGYKFLRPA
 
tr|Q21GD0|Q21GD0_SACD2 AYQAEGIPIYALSMQNERQFEPGA----YPGMVITWQMERDLLIEVYENF
 
tr|Q21GD0|Q21GD0_SACD2 AYQAEGIPIYALSMQNERQFEPGA----YPGMVITWQMERDLLIEVYENF
P04062 AYAEHKLQFWAVTAENEPSAGLLSG-YPFQCLGFTPEHQRDFIARDLGPT
+
<span style="color:#a30909">P04062 AYAEHKLQFWAVTAENEPSAGLLSG-YPFQCLGFTPEHQRDFIARDLGPT
 
tr|I9HH59|I9HH59_BACOV AYQEADMSPDYLSMMNEPDGDNSAGTKIRLGYGIDDSQKANYGKALDATY
 
tr|I9HH59|I9HH59_BACOV AYQEADMSPDYLSMMNEPDGDNSAGTKIRLGYGIDDSQKANYGKALDATY
 
: . :: ** .
 
: . :: ** .
Line 94: Line 94:
 
tr|B5QQZ8|B5QQZ8_LACRH LDKTFPD-----TKIYFWDGSLNVLD---VIDKPLSELVTPDEAAAFDGF
 
tr|B5QQZ8|B5QQZ8_LACRH LDKTFPD-----TKIYFWDGSLNVLD---VIDKPLSELVTPDEAAAFDGF
 
tr|Q21GD0|Q21GD0_SACD2 HNIDGNYGPELDVKLWTLDHNFDYWQ---QAKLQLDSFKAMGKDHYVDAT
 
tr|Q21GD0|Q21GD0_SACD2 HNIDGNYGPELDVKLWTLDHNFDYWQ---QAKLQLDSFKAMGKDHYVDAT
P04062 LANSTHHN----VRLLMLDDQRLLLP-----HWAKVVLTDPEAAKYVHGI
+
<span style="color:#a30909">P04062 LANSTHHN----VRLLMLDDQRLLLP-----HWAKVVLTDPEAAKYVHGI
 
tr|I9HH59|I9HH59_BACOV EAFKEVSK---RPKLIGPEVLGIGYG-------TFSNYYRDLNPDLLDAA
 
tr|I9HH59|I9HH59_BACOV EAFKEVSK---RPKLIGPEVLGIGYG-------TFSNYYRDLNPDLLDAA
 
.: : .
 
.: : .
Line 106: Line 106:
 
tr|B5QQZ8|B5QQZ8_LACRH AFHTYDGPYT----NLFKGSRLNPNWKLAMTERRC-------MIEET---
 
tr|B5QQZ8|B5QQZ8_LACRH AFHTYDGPYT----NLFKGSRLNPNWKLAMTERRC-------MIEET---
 
tr|Q21GD0|Q21GD0_SACD2 AFHHYGGVSE----NMGQLHDAHPDKDVVFTEG---------TIWG----
 
tr|Q21GD0|Q21GD0_SACD2 AFHHYGGVSE----NMGQLHDAHPDKDVVFTEG---------TIWG----
P04062 AVHWYLDFLAPAKATLGETHRLFPNTMLFASEACVGS-----KFWEQSVR
+
<span style="color:#a30909">P04062 AVHWYLDFLAPAKATLGETHRLFPNTMLFASEACVGS-----KFWEQSVR
 
tr|I9HH59|I9HH59_BACOV AFHCYHGGKTSDYKDNDRYSSAHAFKTEFQNIVRQVGNKSIMMTENCSYH
 
tr|I9HH59|I9HH59_BACOV AFHCYHGGKTSDYKDNDRYSSAHAFKTEFQNIVRQVGNKSIMMTENCSYH
 
: * * . .
 
: * * . .
Line 118: Line 118:
 
tr|B5QQZ8|B5QQZ8_LACRH -PEDASHIMFGLIGNWLVRQGLNMIDLWNIALDERGLPNQVGSTGR----
 
tr|B5QQZ8|B5QQZ8_LACRH -PEDASHIMFGLIGNWLVRQGLNMIDLWNIALDERGLPNQVGSTGR----
 
tr|Q21GD0|Q21GD0_SACD2 -LSSDGNKRSYEALIRHFRNWATGYLSWVTMTTQTLNEANQGPYNGLGAF
 
tr|Q21GD0|Q21GD0_SACD2 -LSSDGNKRSYEALIRHFRNWATGYLSWVTMTTQTLNEANQGPYNGLGAF
P04062 LGSWDRGMQYSHSIITNLLYHVVGWTDWNLALNPEGGPNWVRNFVD----
+
<span style="color:#a30909">P04062 LGSWDRGMQYSHSIITNLLYHVVGWTDWNLALNPEGGPNWVRNFVD----
 
tr|I9HH59|I9HH59_BACOV PAVPEDAVNIAHFISNSFRYANATVYLHWALLWGYADADELKKGGDGCIA
 
tr|I9HH59|I9HH59_BACOV PAVPEDAVNIAHFISNSFRYANATVYLHWALLWGYADADELKKGGDGCIA
 
 
Line 130: Line 130:
 
tr|B5QQZ8|B5QQZ8_LACRH --RGVVTIDHT-TGKVQRNLEYYMLRNFNQDVIPG---------SIVIGS
 
tr|B5QQZ8|B5QQZ8_LACRH --RGVVTIDHT-TGKVQRNLEYYMLRNFNQDVIPG---------SIVIGS
 
tr|Q21GD0|Q21GD0_SACD2 DPTLLVKYDGD-NANWYKTPEYWLMSQFSKYLKPG-------------AL
 
tr|Q21GD0|Q21GD0_SACD2 DPTLLVKYDGD-NANWYKTPEYWLMSQFSKYLKPG-------------AL
P04062 -SPIIVDITKD---TFYKQPMFYHLGHFSKFIPEG-------------SQ
+
<span style="color:#a30909">P04062 -SPIIVDITKD---TFYKQPMFYHLGHFSKFIPEG-------------SQ
 
tr|I9HH59|I9HH59_BACOV VEWPWSSSRWTTEKGYVVRSEFYGLKHFTKYVKPG--------------W
 
tr|I9HH59|I9HH59_BACOV VEWPWSSSRWTTEKGYVVRSEFYGLKHFTKYVKPG--------------W
 
: :
 
: :
Line 142: Line 142:
 
tr|B5QQZ8|B5QQZ8_LACRH TNYTQDGYTGGLGSVAFLAPDGAIAAHLYNP-------------------
 
tr|B5QQZ8|B5QQZ8_LACRH TNYTQDGYTGGLGSVAFLAPDGAIAAHLYNP-------------------
 
tr|Q21GD0|Q21GD0_SACD2 RIESNYGSLQTVTNVAFLNPDGYVVLIVANSTNGVQQFDVISEGNQFNAS
 
tr|Q21GD0|Q21GD0_SACD2 RIESNYGSLQTVTNVAFLNPDGYVVLIVANSTNGVQQFDVISEGNQFNAS
P04062 RVGLVASQKNDLDAVALMHPDGSAVVVVLNR-------------------
+
<span style="color:#a30909">P04062 RVGLVASQKNDLDAVALMHPDGSAVVVVLNR-------------------
 
tr|I9HH59|I9HH59_BACOV RRIGVDYELKEVEVVAFQDPDEYQIAVVLVN-------------------
 
tr|I9HH59|I9HH59_BACOV RRIGVDYELKEVEVVAFQDPDEYQIAVVLVN-------------------
 
.
 
.
Line 154: Line 154:
 
tr|B5QQZ8|B5QQZ8_LACRH --------------------------------------------------
 
tr|B5QQZ8|B5QQZ8_LACRH --------------------------------------------------
 
tr|Q21GD0|Q21GD0_SACD2 VPARSIATYRWKAGLGQSPHSWQAPPELPQFPYAENSIEIPGLVEAEHYD
 
tr|Q21GD0|Q21GD0_SACD2 VPARSIATYRWKAGLGQSPHSWQAPPELPQFPYAENSIEIPGLVEAEHYD
P04062 --------------------------------------------------
+
<span style="color:#a30909">P04062 --------------------------------------------------
 
tr|I9HH59|I9HH59_BACOV --------------------------------------------------
 
tr|I9HH59|I9HH59_BACOV --------------------------------------------------
 
 
Line 166: Line 166:
 
tr|B5QQZ8|B5QQZ8_LACRH --------------------SGKPLDAAVTINNDGPVTWQHVTVPAWGTV
 
tr|B5QQZ8|B5QQZ8_LACRH --------------------SGKPLDAAVTINNDGPVTWQHVTVPAWGTV
 
tr|Q21GD0|Q21GD0_SACD2 LGGAGAAYADVSTGNNGGVLRADDVDIEANANGYHIGWLDAGEWLEYSVN
 
tr|Q21GD0|Q21GD0_SACD2 LGGAGAAYADVSTGNNGGVLRADDVDIEANANGYHIGWLDAGEWLEYSVN
P04062 -----------------------------------------------SSK
+
<span style="color:#a30909">P04062 -----------------------------------------------SSK
 
tr|I9HH59|I9HH59_BACOV ------------------------------YSEQEEKTVRLENIGSKEVS
 
tr|I9HH59|I9HH59_BACOV ------------------------------YSEQEEKTVRLENIGSKEVS
 
 
Line 178: Line 178:
 
tr|B5QQZ8|B5QQZ8_LACRH TLH-----------------------------------------------
 
tr|B5QQZ8|B5QQZ8_LACRH TLH-----------------------------------------------
 
tr|Q21GD0|Q21GD0_SACD2 VNQGQSFDVLIASASASSGGQFHFEVNGESVSPILVTPATGGWKTFVSTL
 
tr|Q21GD0|Q21GD0_SACD2 VNQGQSFDVLIASASASSGGQFHFEVNGESVSPILVTPATGGWKTFVSTL
P04062 DVP-----------------------------------------------
+
<span style="color:#a30909">P04062 DVP-----------------------------------------------
 
tr|I9HH59|I9HH59_BACOV SIR-----------------------------------------------
 
tr|I9HH59|I9HH59_BACOV SIR-----------------------------------------------
 
 
Line 190: Line 190:
 
tr|B5QQZ8|B5QQZ8_LACRH ---KAFGPVNESAPRQDEDFKLNPYPANLMDDWAPGKGVNANKK------
 
tr|B5QQZ8|B5QQZ8_LACRH ---KAFGPVNESAPRQDEDFKLNPYPANLMDDWAPGKGVNANKK------
 
tr|Q21GD0|Q21GD0_SACD2 HRGLQLNAGEQVLRLVIDGGEFNIDSFHIVPAGSMEPPVQEDICEEATVS
 
tr|Q21GD0|Q21GD0_SACD2 HRGLQLNAGEQVLRLVIDGGEFNIDSFHIVPAGSMEPPVQEDICEEATVS
P04062 ---LTIKDPAVG------------FLETISPGYSIHTYLWRRQ-------
+
<span style="color:#a30909">P04062 ---LTIKDPAVG------------FLETISPGYSIHTYLWRRQ-------
 
tr|I9HH59|I9HH59_BACOV ---KVIQTDTQKESWYQELKNTDPFVELVLPKMSVTTVYFKFKTN-----
 
tr|I9HH59|I9HH59_BACOV ---KVIQTDTQKESWYQELKNTDPFVELVLPKMSVTTVYFKFKTN-----
 
 
Line 202: Line 202:
 
tr|B5QQZ8|B5QQZ8_LACRH --------------------------------------------------
 
tr|B5QQZ8|B5QQZ8_LACRH --------------------------------------------------
 
tr|Q21GD0|Q21GD0_SACD2 ILAGKIQAESYCLASGIQTENTSDQGGGENIGWIDAGDSVDYGVSVANAG
 
tr|Q21GD0|Q21GD0_SACD2 ILAGKIQAESYCLASGIQTENTSDQGGGENIGWIDAGDSVDYGVSVANAG
P04062 --------------------------------------------------
+
<span style="color:#a30909">P04062 --------------------------------------------------
 
tr|I9HH59|I9HH59_BACOV --------------------------------------------------
 
tr|I9HH59|I9HH59_BACOV --------------------------------------------------
 
 
Line 214: Line 214:
 
tr|B5QQZ8|B5QQZ8_LACRH --------------------------------------------------
 
tr|B5QQZ8|B5QQZ8_LACRH --------------------------------------------------
 
tr|Q21GD0|Q21GD0_SACD2 SYTLNLRVASQNGGGEIALSVGDTVLANVQIPGTGGWQNWQTISVPVQLS
 
tr|Q21GD0|Q21GD0_SACD2 SYTLNLRVASQNGGGEIALSVGDTVLANVQIPGTGGWQNWQTISVPVQLS
P04062 --------------------------------------------------
+
<span style="color:#a30909">P04062 --------------------------------------------------
 
tr|I9HH59|I9HH59_BACOV --------------------------------------------------
 
tr|I9HH59|I9HH59_BACOV --------------------------------------------------
 
 
Line 226: Line 226:
 
tr|B5QQZ8|B5QQZ8_LACRH --------------------------------------------------
 
tr|B5QQZ8|B5QQZ8_LACRH --------------------------------------------------
 
tr|Q21GD0|Q21GD0_SACD2 AGYQQLHFVFINGGLNINWFEFVETDNPTDPTDPTDPAAELEEGAYYIIN
 
tr|Q21GD0|Q21GD0_SACD2 AGYQQLHFVFINGGLNINWFEFVETDNPTDPTDPTDPAAELEEGAYYIIN
P04062 --------------------------------------------------
+
<span style="color:#a30909">P04062 --------------------------------------------------
 
tr|I9HH59|I9HH59_BACOV --------------------------------------------------
 
tr|I9HH59|I9HH59_BACOV --------------------------------------------------
 
 
Line 233: Line 233:
 
tr|K9HBW2|K9HBW2_AGABB --------------------------------------------------
 
tr|K9HBW2|K9HBW2_AGABB --------------------------------------------------
 
tr|H6CEV7|H6CEV7_9BACL --------------------------------------------------
 
tr|H6CEV7|H6CEV7_9BACL --------------------------------------------------
tr|B1VPJ0|B1VPJ0_STRGG --------------------------------------------------
+
tr|B1VPJ0|B1VPJ0_STRGG --------------------------------------------------
 
tr|I1WBF3|I1WBF3_BIFAR --------------------------------------------------
 
tr|I1WBF3|I1WBF3_BIFAR --------------------------------------------------
 
tr|D0TN48|D0TN48_9BACE --------------------------------------------------
 
tr|D0TN48|D0TN48_9BACE --------------------------------------------------
 
tr|B5QQZ8|B5QQZ8_LACRH --------------------------------------------------
 
tr|B5QQZ8|B5QQZ8_LACRH --------------------------------------------------
 
tr|Q21GD0|Q21GD0_SACD2 EASGKALDVSGVSTSNGTNVQQWSYSGGLNQQWIAQHVSGNTFELVSLNS
 
tr|Q21GD0|Q21GD0_SACD2 EASGKALDVSGVSTSNGTNVQQWSYSGGLNQQWIAQHVSGNTFELVSLNS
P04062 --------------------------------------------------
+
<span style="color:#a30909">P04062 --------------------------------------------------
 
tr|I9HH59|I9HH59_BACOV --------------------------------------------------
 
tr|I9HH59|I9HH59_BACOV --------------------------------------------------
 
 
Line 250: Line 250:
 
tr|B5QQZ8|B5QQZ8_LACRH --------------------------------------------------
 
tr|B5QQZ8|B5QQZ8_LACRH --------------------------------------------------
 
tr|Q21GD0|Q21GD0_SACD2 GSCLDADNGSDNAHQWACEGNTNQQWVIEGQSDGTYLIRTKAGNEVLEVQ
 
tr|Q21GD0|Q21GD0_SACD2 GSCLDADNGSDNAHQWACEGNTNQQWVIEGQSDGTYLIRTKAGNEVLEVQ
P04062 --------------------------------------------------
+
<span style="color:#a30909">P04062 --------------------------------------------------
 
tr|I9HH59|I9HH59_BACOV --------------------------------------------------
 
tr|I9HH59|I9HH59_BACOV --------------------------------------------------
 
 
Line 262: Line 262:
 
tr|B5QQZ8|B5QQZ8_LACRH -----------------------------
 
tr|B5QQZ8|B5QQZ8_LACRH -----------------------------
 
tr|Q21GD0|Q21GD0_SACD2 GGSANNGANVRTASSVNNNRQKWRFNDVE
 
tr|Q21GD0|Q21GD0_SACD2 GGSANNGANVRTASSVNNNRQKWRFNDVE
P04062 -----------------------------
+
<span style="color:#a30909">P04062 -----------------------------</span>
 
tr|I9HH59|I9HH59_BACOV -----------------------------
 
tr|I9HH59|I9HH59_BACOV -----------------------------

Revision as of 11:48, 6 May 2013

CLUSTAL 2.1 multiple sequence alignment


tr|E2LY19|E2LY19_MONPE      ----------------------------------------MRPLAFSILL
tr|K9HBW2|K9HBW2_AGABB      ----------------------------------------MQQFAIILIL
tr|H6CEV7|H6CEV7_9BACL      ------------------MKKLQKQRRANLWLLVAAAAILIFAVLVSMVI
tr|B1VPJ0|B1VPJ0_STRGG      ------------------------------------------MAALGVDA
tr|I1WBF3|I1WBF3_BIFAR      ---------------------------------------------MIQAF
tr|D0TN48|D0TN48_9BACE      -----------------------MIDMRNIALTFLGCFTILAACSNSDDA
tr|B5QQZ8|B5QQZ8_LACRH      --------------------------------------------------
tr|Q21GD0|Q21GD0_SACD2      ----------------MENIFHLKKAAFIFCALTSCYNSTASSQQDDYSV
P04062                      MEFSSPSREECPKPLSRVSIMAGSLTGLLLLQAVSWASGARPCIPKSFGY
tr|I9HH59|I9HH59_BACOV      ---------------------------------------MKTQSCMNRLL
                                                                              

tr|E2LY19|E2LY19_MONPE      SVCTPIAGQQIWDIWQTTWDRSKLFTSTPANPPINFGTPSS---------
tr|K9HBW2|K9HBW2_AGABB      ASCVS-AQYAIWDTWSTTWERSNLFTSFKPNPPISFGPVSG---------
tr|H6CEV7|H6CEV7_9BACL      QKILKPEAEHDVSMWLTTPDPANRLTQQAPIHWKNDNSKESI---EKAAI
tr|B1VPJ0|B1VPJ0_STRGG      SVGTARAADPAAQVWITTPDGAKKLSPEGNVPFTGS--------------
tr|I1WBF3|I1WBF3_BIFAR      STYANAQGTTLAAAFAPLGNACLRVGRTPESTAHAS--------------
tr|D0TN48|D0TN48_9BACE      EKPVTPVPTGDVTIYATTSSLTRDLTRDAVNFSSKDN-------------
tr|B5QQZ8|B5QQZ8_LACRH      -MTTTEKGLYPTEFWTVTAGDLAQKRDHLATPKPETTPG-----------
tr|Q21GD0|Q21GD0_SACD2      TATVSTEFNPMSSSWYTNPWPESDIPRRLEQLTPSVITQLG--------Q
P04062                      SSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRRMELSMGPIQANHT
tr|I9HH59|I9HH59_BACOV      WITLLVIGLSGCSEESSSSEENTESGTIQDGDHTDN--------------
                                                                              

tr|E2LY19|E2LY19_MONPE      IGQADIVVNDNQVLQNIYGFGSSLTDNSAMLMNNLKQRNSGNYWNMLNYL
tr|K9HBW2|K9HBW2_AGABB      TGQADIRIDDTSTFQSVWGFGGSLTDSSALTLNNLKSRNSASYRSLLNYL
tr|H6CEV7|H6CEV7_9BACL      SDTLTVEVKPDIRYQKMEGFGAAVSGSSAYLMNHGMSANQR--DQLLNDL
tr|B1VPJ0|B1VPJ0_STRGG      PQAVDIRVDASDKGQKFTGAGASVTGASAHLLQS-LPQAQR--TTVLRSL
tr|I1WBF3|I1WBF3_BIFAR      --APTLSIDTTRVRQPIDGFGASITEATSWLWHNRVTDKER----CIRDL
tr|D0TN48|D0TN48_9BACE      LAPTSITLNPTEQYQTMDGFGAAITGATCFNLLQMKPEDRH---AFLTET
tr|B5QQZ8|B5QQZ8_LACRH      -DAAKIVIDPADRHQEWIGAGAAITDAAASLIWKQSKEQRS---ALLHEM
tr|Q21GD0|Q21GD0_SACD2      TSGTLLEVDPSTTYQTLLGLGASLEHTTVYAIRKNKTAEQQ--KEVLRSL
P04062                      GTGLLLTLQPEQKFQKVKGFGGAMTDAAALNILALSPPAQN---LLLKSY
tr|I9HH59|I9HH59_BACOV      --ATVIQLNSSDQYQTVEGIGGGIANYENWYCQHPNKKELF---------
                                 : :.     *   * *..:                          

tr|E2LY19|E2LY19_MONPE      FSPTDGANAAGLTYIRVPLGASDFS------------SSVYSFDDTAN--
tr|K9HBW2|K9HBW2_AGABB      FNPTDDMNAAGFSYMRIPLGASDFS------------ASAYSYDDTPG--
tr|H6CEV7|H6CEV7_9BACL      FTASG----IQLSYIRHTIGASDYSVDEQGQ------PASYTYDDVATGK
tr|B1VPJ0|B1VPJ0_STRGG      FSSEGDG--IGLNYLRQPLGSTDFDANGN----------AYTYEDTRG--
tr|I1WBF3|I1WBF3_BIFAR      FSPRDG---IGISMLRQPIGPSDHVS------------APYRFVRRFP--
tr|D0TN48|D0TN48_9BACE      FSDDKG---FGFSYIRISIGCSDFS------------LSEYTCCDTKG--
tr|B5QQZ8|B5QQZ8_LACRH      FDPEEG----HFSTIRIPLGSCEPAS-----------QPYYTYDDVPFGE
tr|Q21GD0|Q21GD0_SACD2      IDPVQG---MGMNFFRVSIGTSDFADGTRAIPAPDNAKGWYSYQDTPT--
P04062                      FSEEG----IGYNIIRVPMASCDFSIR------------TYTYADTPD--
tr|I9HH59|I9HH59_BACOV      ----------DLIFKDLEISMIRIGN--------------WYEKKISG--
                                              :.                    :         

tr|E2LY19|E2LY19_MONPE      -DRSLNTFNVN----------RAPSYLFTVLKDIQ-----SVNPLIKVHV
tr|K9HBW2|K9HBW2_AGABB      -DTSFNNFDIN----------RTPSYVFSVLNDIK-----AVNNIMRFHF
tr|H6CEV7|H6CEV7_9BACL      -DYELNHFSIA----------KDR-DVIDVLKQIM-----RRNQDLQIMG
tr|B1VPJ0|B1VPJ0_STRGG      ------AFSID----------RDRSQIIPVLKQAT-----AINPAIRFMG
tr|I1WBF3|I1WBF3_BIFAR      -DRKLSSLNFT----------PEMERVLPMVEAANNCALATQSHALNIMA
tr|D0TN48|D0TN48_9BACE      ----IEHFALQS---------EEKDYILPILKEIL-----SINPSIKVIA
tr|B5QQZ8|B5QQZ8_LACRH      HDASLSKFSVGEGEPGAPDATKDLKYLIPVVQEIL-----AINPAVKIMA
tr|Q21GD0|Q21GD0_SACD2      -----SPFSIAR---------DESLGIIETIRMAVEVG-VETNNELKILA
P04062                      -DFQLHNFSLPE---------EDTKLKIPLIHRALQ----LAQRPVSLLA
tr|I9HH59|I9HH59_BACOV      -----ENPDILK----------QQKEIMDAATQRLG------RSNFSVMM
                                     .                 :                 . .  

tr|E2LY19|E2LY19_MONPE      IPWSPPAWMKNSNTMKG-------------GSLNSNQVQTYAQYLLKSLQ
tr|K9HBW2|K9HBW2_AGABB      IPWSPPGWMKDSGTMKG-------------GALKPELVDEYATYLLKCVQ
tr|H6CEV7|H6CEV7_9BACL      TPWTAPPWMKYGEQIYNGW---------YLDYTDPRVYSAYADYFVRYIQ
tr|B1VPJ0|B1VPJ0_STRGG      SPWSPPAWMKTDNSLNG-------------GSLRPEHYQAYADYLVKAIR
tr|I1WBF3|I1WBF3_BIFAR      SPWSAPWWMKTNLSVLGKRRYTR-----ITGHLRRGMYAAYARYITGFAR
tr|D0TN48|D0TN48_9BACE      APWTCPKWMKVKSLTDLTPLDSW-----TNGQLNPAYYQDYATYFVKWVQ
tr|B5QQZ8|B5QQZ8_LACRH      SPWSAPAWMKSTGELKMGGHLRFGEYTNNGYAIKDTFEGVYAQYFVRYLE
tr|Q21GD0|Q21GD0_SACD2      SPWSPPRWMREGDNMVDG------------GPLKADMLDDYAAYLRKFVE
P04062                      SPWTSPTWLKTNGAVNGKGS--------LKGQPGDIYHQTWARYFVKFLD
tr|I9HH59|I9HH59_BACOV      SNWLVAPDLIDRPKEKGATLK--------RNNEGKYMYKEFGEWCRMTLK
                              *  .  :                               :. :      

tr|E2LY19|E2LY19_MONPE      GFRNNGIPLYAISVQNEPQNNNPT----YPTSTYSPQLEAQVGSALRSLM
tr|K9HBW2|K9HBW2_AGABB      GWNSKGFRAYAVSAQNEPLNSNPT----YPTSKLTAAQEAQIGLRLRSLL
tr|H6CEV7|H6CEV7_9BACL      AYANEGVPIQAISIQNEPEFTTSK----YPSMSMGAAEQAKFIKQYLGPA
tr|B1VPJ0|B1VPJ0_STRGG      AYGQEGITLTDLTAQNEPEFATS-----YPSMSMTSAQQADFLR-VLDRA
tr|I1WBF3|I1WBF3_BIFAR      LYAQRGLPLFALTVTNEPDYPQSR----WPSMAMTPREQAEFVARHLRPM
tr|D0TN48|D0TN48_9BACE      AFNAEGIDIYAVTPQNEP-LNRGN----SASLYMSWEEQRDFVKTALGPK
tr|B5QQZ8|B5QQZ8_LACRH      EYRKYGIPIYAITIQNEP-SNAAA----WPAMIWKIPELAHFGYKFLRPA
tr|Q21GD0|Q21GD0_SACD2      AYQAEGIPIYALSMQNERQFEPGA----YPGMVITWQMERDLLIEVYENF
P04062                      AYAEHKLQFWAVTAENEPSAGLLSG-YPFQCLGFTPEHQRDFIARDLGPT
tr|I9HH59|I9HH59_BACOV      AYQEADMSPDYLSMMNEPDGDNSAGTKIRLGYGIDDSQKANYGKALDATY
                             :    .    ::  **                       .         

tr|E2LY19|E2LY19_MONPE      NNNGFGS-----VKLIGYDHNWDNA-----GTYPVQLMDAAP--NAFAGV
tr|K9HBW2|K9HBW2_AGABB      NSNGFSD-----TKIVGYDHNWSNA-----GGYPVQLMQDAG--SAFDGV
tr|H6CEV7|H6CEV7_9BACL      LSRNHLP-----TQIIAFDHNWDIG-----SDYAKTVLGDEQARSYTHGT
tr|B1VPJ0|B1VPJ0_STRGG      LTAANLP-----TNILAYDHNWDH------PNYPLDVFARTGGIQRIIGA
tr|I1WBF3|I1WBF3_BIFAR      LDHAGLDG----TRILCWDHNYSTDHYP-DGAFVRDMYADSAALAACAGS
tr|D0TN48|D0TN48_9BACE      FKTAGLA-----TKIYAYDHNYDYSDIETEKNYPGKMYEDAAASQYLAGA
tr|B5QQZ8|B5QQZ8_LACRH      LDKTFPD-----TKIYFWDGSLNVLD---VIDKPLSELVTPDEAAAFDGF
tr|Q21GD0|Q21GD0_SACD2      HNIDGNYGPELDVKLWTLDHNFDYWQ---QAKLQLDSFKAMGKDHYVDAT
P04062                      LANSTHHN----VRLLMLDDQRLLLP-----HWAKVVLTDPEAAKYVHGI
tr|I9HH59|I9HH59_BACOV      EAFKEVSK---RPKLIGPEVLGIGYG-------TFSNYYRDLNPDLLDAA
                                         .:   :                             . 

tr|E2LY19|E2LY19_MONPE      AFHCYAGSVS----QQDQFRNRYPNKEVYFTECSG-------TLGS----
tr|K9HBW2|K9HBW2_AGABB      SFHCYAGNVS----QQDTFHSQFSDKQIYFTECSG-------TFGS----
tr|H6CEV7|H6CEV7_9BACL      AFHCYKGEPT----AMTDVHHAFPDKPVYMTECSG-------GAWS---P
tr|B1VPJ0|B1VPJ0_STRGG      AFHCYGGAPA----AQKQIADAG--KRVFFTECSG-------TDSANPAT
tr|I1WBF3|I1WBF3_BIFAR      AWHYYGGSAR----TMSRIHDAFPNKGIWVTEASG-------GDWG---P
tr|D0TN48|D0TN48_9BACE      AYHNYGGNRE----ELLNIHKAYPEKELLFTETSI-------GTWNS-GR
tr|B5QQZ8|B5QQZ8_LACRH      AFHTYDGPYT----NLFKGSRLNPNWKLAMTERRC-------MIEET---
tr|Q21GD0|Q21GD0_SACD2      AFHHYGGVSE----NMGQLHDAHPDKDVVFTEG---------TIWG----
P04062                      AVHWYLDFLAPAKATLGETHRLFPNTMLFASEACVGS-----KFWEQSVR
tr|I9HH59|I9HH59_BACOV      AFHCYHGGKTSDYKDNDRYSSAHAFKTEFQNIVRQVGNKSIMMTENCSYH
                            : * * .                       .                   

tr|E2LY19|E2LY19_MONPE      DWWTDLKVRLKSFSV-----------------------------------
tr|K9HBW2|K9HBW2_AGABB      DWWSDIKWYMDNIAIGSIERSSHTGLMWNIALDGSGNPKLPGTSSCGGPG
tr|H6CEV7|H6CEV7_9BACL      GFGDDLSWDMSKLIIGAPRNWSQNVLFWNIVLDPSGGPTNGGCTN-----
tr|B1VPJ0|B1VPJ0_STRGG      TFGDTLKWHAENLVVQNMRNGGETVINWNLALDRNGGPHQGHCTNR----
tr|I1WBF3|I1WBF3_BIFAR      RNFTPALLSLGTAVIDMMNNWARSAVLWNIALDEHGGPDYYYLRNDRRHS
tr|D0TN48|D0TN48_9BACE      DLSKRLLEDMKEVALGTINNWCRGVIVWNLMLDNDRAPNREGGCQT----
tr|B5QQZ8|B5QQZ8_LACRH      -PEDASHIMFGLIGNWLVRQGLNMIDLWNIALDERGLPNQVGSTGR----
tr|Q21GD0|Q21GD0_SACD2      -LSSDGNKRSYEALIRHFRNWATGYLSWVTMTTQTLNEANQGPYNGLGAF
P04062                      LGSWDRGMQYSHSIITNLLYHVVGWTDWNLALNPEGGPNWVRNFVD----
tr|I9HH59|I9HH59_BACOV      PAVPEDAVNIAHFISNSFRYANATVYLHWALLWGYADADELKKGGDGCIA
                                                                              

tr|E2LY19|E2LY19_MONPE      ----LFQVN-----ACSVVHGQYLLG------------------------
tr|K9HBW2|K9HBW2_AGABB      -CRPLVTVNS--DGTWSVNQEFYALAQASKAILPRDVGGPFGKRIGVSVG
tr|H6CEV7|H6CEV7_9BACL      -CRGVVTIDPL-SGAVTKNVEYYALGHASKFVRPG-------------AV
tr|B1VPJ0|B1VPJ0_STRGG      -CNGIVEID---GGQVTRNAEFYVLGHVSKFVKAG-------------AT
tr|I1WBF3|I1WBF3_BIFAR      ENRGLITVRD--DGSIRRNADYYALGHFSKYVPIG-------------SH
tr|D0TN48|D0TN48_9BACE      -CYGAVDISNSDYKTIIRNSHYYIIAHLSSVVKPG-------------AV
tr|B5QQZ8|B5QQZ8_LACRH      --RGVVTIDHT-TGKVQRNLEYYMLRNFNQDVIPG---------SIVIGS
tr|Q21GD0|Q21GD0_SACD2      DPTLLVKYDGD-NANWYKTPEYWLMSQFSKYLKPG-------------AL
P04062                      -SPIIVDITKD---TFYKQPMFYHLGHFSKFIPEG-------------SQ
tr|I9HH59|I9HH59_BACOV      VEWPWSSSRWTTEKGYVVRSEFYGLKHFTKYVKPG--------------W
                                                  : :                         

tr|E2LY19|E2LY19_MONPE      ----------KLVNHVYAEKEWIILHLGSL--------------------
tr|K9HBW2|K9HBW2_AGABB      GELNWALRVSAFVTGRVDSSEWQRYSIVVLN-------------------
tr|H6CEV7|H6CEV7_9BACL      RIDSTHY-SGSIETVAYRNPDGTLVLIALP--------------------
tr|B1VPJ0|B1VPJ0_STRGG      RIGSTSQGAGGVQNVAFQNSDGSRAAVVVNTGSGAQRFSLTDNGKSLAYT
tr|I1WBF3|I1WBF3_BIFAR      CVECALDHAQGVRAAAFLTPTGTLVAVLAN--------------------
tr|D0TN48|D0TN48_9BACE      RIGASGYADSNIMYSAFENPDGTYAFVLMNN-------------------
tr|B5QQZ8|B5QQZ8_LACRH      TNYTQDGYTGGLGSVAFLAPDGAIAAHLYNP-------------------
tr|Q21GD0|Q21GD0_SACD2      RIESNYGSLQTVTNVAFLNPDGYVVLIVANSTNGVQQFDVISEGNQFNAS
P04062                      RVGLVASQKNDLDAVALMHPDGSAVVVVLNR-------------------
tr|I9HH59|I9HH59_BACOV      RRIGVDYELKEVEVVAFQDPDEYQIAVVLVN-------------------
                                       .                                      

tr|E2LY19|E2LY19_MONPE      --------------------------------------------------
tr|K9HBW2|K9HBW2_AGABB      --------------------------------------------------
tr|H6CEV7|H6CEV7_9BACL      --------------------------------------------------
tr|B1VPJ0|B1VPJ0_STRGG      LPAGAVATFTWDGSGGTTEPPAGSIDPAAWYQVRNAGSGACLDAADWGTA
tr|I1WBF3|I1WBF3_BIFAR      --------------------------------------------------
tr|D0TN48|D0TN48_9BACE      --------------------------------------------------
tr|B5QQZ8|B5QQZ8_LACRH      --------------------------------------------------
tr|Q21GD0|Q21GD0_SACD2      VPARSIATYRWKAGLGQSPHSWQAPPELPQFPYAENSIEIPGLVEAEHYD
P04062                      --------------------------------------------------
tr|I9HH59|I9HH59_BACOV      --------------------------------------------------
                                                                              

tr|E2LY19|E2LY19_MONPE      --------------------------------------------------
tr|K9HBW2|K9HBW2_AGABB      -------------------WDDSVGGWNPQPVRATIEFRGTQASYTFPVG
tr|H6CEV7|H6CEV7_9BACL      -------------------IRERTGRHLRFG---------------REAK
tr|B1VPJ0|B1VPJ0_STRGG      NGTALQQWSCGAGANQGWQFRPTSGGHYQVVNRHNAKVWDVVGGSGGTAD
tr|I1WBF3|I1WBF3_BIFAR      ------------------------------------------------ER
tr|D0TN48|D0TN48_9BACE      -----------------------------------------------NEK
tr|B5QQZ8|B5QQZ8_LACRH      --------------------SGKPLDAAVTINNDGPVTWQHVTVPAWGTV
tr|Q21GD0|Q21GD0_SACD2      LGGAGAAYADVSTGNNGGVLRADDVDIEANANGYHIGWLDAGEWLEYSVN
P04062                      -----------------------------------------------SSK
tr|I9HH59|I9HH59_BACOV      ------------------------------YSEQEEKTVRLENIGSKEVS
                                                                              

tr|E2LY19|E2LY19_MONPE      --------------------------------------------------
tr|K9HBW2|K9HBW2_AGABB      VTT-----------------------------------------------
tr|H6CEV7|H6CEV7_9BACL      FSQ-----------------------------------------------
tr|B1VPJ0|B1VPJ0_STRGG      GTK-----------------------------------------------
tr|I1WBF3|I1WBF3_BIFAR      AES-----------------------------------------------
tr|D0TN48|D0TN48_9BACE      TKK-----------------------------------------------
tr|B5QQZ8|B5QQZ8_LACRH      TLH-----------------------------------------------
tr|Q21GD0|Q21GD0_SACD2      VNQGQSFDVLIASASASSGGQFHFEVNGESVSPILVTPATGGWKTFVSTL
P04062                      DVP-----------------------------------------------
tr|I9HH59|I9HH59_BACOV      SIR-----------------------------------------------
                                                                              

tr|E2LY19|E2LY19_MONPE      --------------------------------------------------
tr|K9HBW2|K9HBW2_AGABB      ---LWWYAPSTSFDVCGSSNTEEQGPMVFLNDQQGQVPLNF---------
tr|H6CEV7|H6CEV7_9BACL      ---LHFHPSQ----------RLPFNGILRLHDTASQQCL-----------
tr|B1VPJ0|B1VPJ0_STRGG      ---VHLWSYEGGANQQWRPEALAGGGQYRFVARHSGKCLGVDNSSTADGA
tr|I1WBF3|I1WBF3_BIFAR      ---IWVQCEVD-----------DSGIGVRLPSRSLTTVLRR---------
tr|D0TN48|D0TN48_9BACE      ---ITLSDGKR-------------HFAYDVPGKSVTSYRWAKSE------
tr|B5QQZ8|B5QQZ8_LACRH      ---KAFGPVNESAPRQDEDFKLNPYPANLMDDWAPGKGVNANKK------
tr|Q21GD0|Q21GD0_SACD2      HRGLQLNAGEQVLRLVIDGGEFNIDSFHIVPAGSMEPPVQEDICEEATVS
P04062                      ---LTIKDPAVG------------FLETISPGYSIHTYLWRRQ-------
tr|I9HH59|I9HH59_BACOV      ---KVIQTDTQKESWYQELKNTDPFVELVLPKMSVTTVYFKFKTN-----
                                                                              

tr|E2LY19|E2LY19_MONPE      --------------------------------------------------
tr|K9HBW2|K9HBW2_AGABB      --------------------------------------------------
tr|H6CEV7|H6CEV7_9BACL      --------------------------------------------------
tr|B1VPJ0|B1VPJ0_STRGG      RLSQQPCSGSPAQAFTLTR-------------------------------
tr|I1WBF3|I1WBF3_BIFAR      --------------------------------------------------
tr|D0TN48|D0TN48_9BACE      --------------------------------------------------
tr|B5QQZ8|B5QQZ8_LACRH      --------------------------------------------------
tr|Q21GD0|Q21GD0_SACD2      ILAGKIQAESYCLASGIQTENTSDQGGGENIGWIDAGDSVDYGVSVANAG
P04062                      --------------------------------------------------
tr|I9HH59|I9HH59_BACOV      --------------------------------------------------
                                                                              

tr|E2LY19|E2LY19_MONPE      --------------------------------------------------
tr|K9HBW2|K9HBW2_AGABB      --------------------------------------------------
tr|H6CEV7|H6CEV7_9BACL      --------------------------------------------------
tr|B1VPJ0|B1VPJ0_STRGG      --------------------------------------------------
tr|I1WBF3|I1WBF3_BIFAR      --------------------------------------------------
tr|D0TN48|D0TN48_9BACE      --------------------------------------------------
tr|B5QQZ8|B5QQZ8_LACRH      --------------------------------------------------
tr|Q21GD0|Q21GD0_SACD2      SYTLNLRVASQNGGGEIALSVGDTVLANVQIPGTGGWQNWQTISVPVQLS
P04062                      --------------------------------------------------
tr|I9HH59|I9HH59_BACOV      --------------------------------------------------
                                                                              

tr|E2LY19|E2LY19_MONPE      --------------------------------------------------
tr|K9HBW2|K9HBW2_AGABB      --------------------------------------------------
tr|H6CEV7|H6CEV7_9BACL      --------------------------------------------------
tr|B1VPJ0|B1VPJ0_STRGG      --------------------------------------------------
tr|I1WBF3|I1WBF3_BIFAR      --------------------------------------------------
tr|D0TN48|D0TN48_9BACE      --------------------------------------------------
tr|B5QQZ8|B5QQZ8_LACRH      --------------------------------------------------
tr|Q21GD0|Q21GD0_SACD2      AGYQQLHFVFINGGLNINWFEFVETDNPTDPTDPTDPAAELEEGAYYIIN
P04062                      --------------------------------------------------
tr|I9HH59|I9HH59_BACOV      --------------------------------------------------
                                                                              

tr|E2LY19|E2LY19_MONPE      --------------------------------------------------
tr|K9HBW2|K9HBW2_AGABB      --------------------------------------------------
tr|H6CEV7|H6CEV7_9BACL      --------------------------------------------------
tr|B1VPJ0|B1VPJ0_STRGG      --------------------------------------------------
tr|I1WBF3|I1WBF3_BIFAR      --------------------------------------------------
tr|D0TN48|D0TN48_9BACE      --------------------------------------------------
tr|B5QQZ8|B5QQZ8_LACRH      --------------------------------------------------
tr|Q21GD0|Q21GD0_SACD2      EASGKALDVSGVSTSNGTNVQQWSYSGGLNQQWIAQHVSGNTFELVSLNS
P04062                      --------------------------------------------------
tr|I9HH59|I9HH59_BACOV      --------------------------------------------------
                                                                              

tr|E2LY19|E2LY19_MONPE      --------------------------------------------------
tr|K9HBW2|K9HBW2_AGABB      --------------------------------------------------
tr|H6CEV7|H6CEV7_9BACL      --------------------------------------------------
tr|B1VPJ0|B1VPJ0_STRGG      --------------------------------------------------
tr|I1WBF3|I1WBF3_BIFAR      --------------------------------------------------
tr|D0TN48|D0TN48_9BACE      --------------------------------------------------
tr|B5QQZ8|B5QQZ8_LACRH      --------------------------------------------------
tr|Q21GD0|Q21GD0_SACD2      GSCLDADNGSDNAHQWACEGNTNQQWVIEGQSDGTYLIRTKAGNEVLEVQ
P04062                      --------------------------------------------------
tr|I9HH59|I9HH59_BACOV      --------------------------------------------------
                                                                              

tr|E2LY19|E2LY19_MONPE      -----------------------------
tr|K9HBW2|K9HBW2_AGABB      -----------------------------
tr|H6CEV7|H6CEV7_9BACL      -----------------------------
tr|B1VPJ0|B1VPJ0_STRGG      -----------------------------
tr|I1WBF3|I1WBF3_BIFAR      -----------------------------
tr|D0TN48|D0TN48_9BACE      -----------------------------
tr|B5QQZ8|B5QQZ8_LACRH      -----------------------------
tr|Q21GD0|Q21GD0_SACD2      GGSANNGANVRTASSVNNNRQKWRFNDVE
P04062                      -----------------------------
tr|I9HH59|I9HH59_BACOV      -----------------------------