Multiple Sequence Alignment: ClustalW - set 1

From Bioinformatikpedia
Revision as of 23:31, 5 May 2013 by Gerkej (talk | contribs) (Created page with "CLUSTAL 2.1 multiple sequence alignment tr|A9UD35|A9UD35_DELDE -------------------------------------------------- tr|F5CB27|F5CB27_DELCA -----------------------------…")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)

CLUSTAL 2.1 multiple sequence alignment


tr|A9UD35|A9UD35_DELDE -------------------------------------------------- tr|F5CB27|F5CB27_DELCA -------------------------------------------------- sp|Q2KHZ8|GLCM_BOVIN -------------------------------------------------- tr|D1L2S0|D1L2S0_BALPH -------------------------------------------------- tr|F6WDY8|F6WDY8_HORSE -------------------------------------------------- P04062 -------------------------------------------------- tr|F5H241|F5H241_HUMAN -------------------------------------------------- tr|B7Z6S9|B7Z6S9_HUMAN MSDRLFSNPGPAPTPQGCFSRGCGWSGCILPSESYCAGPQSPVPPRRLCR pdb|pdb|3gxi_A -------------------------------------------------- pdb|pdb|2nt1_A --------------------------------------------------


tr|A9UD35|A9UD35_DELDE -------------------------------------------------- tr|F5CB27|F5CB27_DELCA -------------------------------------------------- sp|Q2KHZ8|GLCM_BOVIN -----------------------------------MELSSP--------S tr|D1L2S0|D1L2S0_BALPH -------------------------------------------------- tr|F6WDY8|F6WDY8_HORSE -----------------------------------MELSSP--------S P04062 -----------------------------------MEFSSP--------S tr|F5H241|F5H241_HUMAN -----------------------------------MEFSSP--------S tr|B7Z6S9|B7Z6S9_HUMAN LRWDFVLPPVGAAVSLRRRDSGTPVVFSSSNDPEGMEFSSP--------S pdb|pdb|3gxi_A ------------ARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFS pdb|pdb|2nt1_A ------------ARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFS


tr|A9UD35|A9UD35_DELDE -------------------------------------------------- tr|F5CB27|F5CB27_DELCA -------------------------------------------------- sp|Q2KHZ8|GLCM_BOVIN REEYPMPRGRVGIMAASLMG-------LLLLHTVSWVS------------ tr|D1L2S0|D1L2S0_BALPH -------------------------------------------------- tr|F6WDY8|F6WDY8_HORSE REGCLKCPGRVGIMAASFMG-------LLLLQAVSRAS------------ P04062 REECPKPLSRVSIMAGSLTG-------LLLLQ-------------AVSWA tr|F5H241|F5H241_HUMAN REECPKPLSRVSIMAGSLTG-------LLLLQ-------------AVSWA tr|B7Z6S9|B7Z6S9_HUMAN REECPKPLSRVSIMAGSLTG-------LLLLQ-------------AVSWA pdb|pdb|3gxi_A RYESTRSGRRMELSMGPIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDA pdb|pdb|2nt1_A RYESTRSGRRMELSMGPIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDA


tr|A9UD35|A9UD35_DELDE -------------------------------------------------- tr|F5CB27|F5CB27_DELCA -------------------------------------------------- sp|Q2KHZ8|GLCM_BOVIN -------------------------------------------------- tr|D1L2S0|D1L2S0_BALPH -------------------------------------------------- tr|F6WDY8|F6WDY8_HORSE -------------------------------------------------- P04062 SGARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRR tr|F5H241|F5H241_HUMAN S------------------------------------------------- tr|B7Z6S9|B7Z6S9_HUMAN SGARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRR pdb|pdb|3gxi_A AALN---------------------------------------------- pdb|pdb|2nt1_A AALN----------------------------------------------


tr|A9UD35|A9UD35_DELDE -------------------------------------------------- tr|F5CB27|F5CB27_DELCA -------------------------------------------------- sp|Q2KHZ8|GLCM_BOVIN -------------------------------------------------- tr|D1L2S0|D1L2S0_BALPH -------------------------------------------------- tr|F6WDY8|F6WDY8_HORSE -------------------------------------------------- P04062 MELSMGPIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDAAALNILALSP tr|F5H241|F5H241_HUMAN -------------------------------------------------- tr|B7Z6S9|B7Z6S9_HUMAN MELSMGPIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDAAALNILALSP pdb|pdb|3gxi_A --------------------------------------------ILALSP pdb|pdb|2nt1_A --------------------------------------------ILALSP


tr|A9UD35|A9UD35_DELDE --------------------------------CNATYCDSLDPLTLPDPG tr|F5CB27|F5CB27_DELCA --------------------------------CNATYCDSLDPLTLPDPG sp|Q2KHZ8|GLCM_BOVIN --------------GARPCSPKSFGYSSVVCVCNGTYCDSLDPLTLPDPG tr|D1L2S0|D1L2S0_BALPH ----------------------------VVCVCNATYCDSLDPLTLPDPG tr|F6WDY8|F6WDY8_HORSE --------------GARPCSPKSFGYSSVVCVCNATYCDSLDPLTLPAPG P04062 PAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHN-- tr|F5H241|F5H241_HUMAN --------------GIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHN-- tr|B7Z6S9|B7Z6S9_HUMAN PAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHN-- pdb|pdb|3gxi_A PAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHN-- pdb|pdb|2nt1_A PAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHN--

                                                            . **.*: * : *    

tr|A9UD35|A9UD35_DELDE TFSRFESTRSGRRMELSLGTIQANRTGTGLLLTLQPDQKFQKVKG----- tr|F5CB27|F5CB27_DELCA TFSRFESTRSGRRMELSLGTIQANRTGTGLLLTLQPD------------- sp|Q2KHZ8|GLCM_BOVIN TFSRFESTRSGRRMELSLGTIQANRTGTGLLLTLQPDQKFQKVKGFGGAM tr|D1L2S0|D1L2S0_BALPH TFSRFESTRSGRRMELSLGAIQANRTGTGLLLTLQPD------------- tr|F6WDY8|F6WDY8_HORSE TFSRYESTRSGRRMELSLGAIQANRTGTGLLLTLQPDQKFQKVKGFGGAM P04062 -FSLPEED-TKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNG----- tr|F5H241|F5H241_HUMAN -FSLPEED-TKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNG----- tr|B7Z6S9|B7Z6S9_HUMAN -FGLPEED-TKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNG----- pdb|pdb|3gxi_A -FSLPEED-TKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNG----- pdb|pdb|2nt1_A -FSLPEED-TKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNG-----

                            *.  *.  :  :: *   ::*  :  ..** :  ..             

tr|A9UD35|A9UD35_DELDE -------------------------------------------------- tr|F5CB27|F5CB27_DELCA -------------------------------------------------- sp|Q2KHZ8|GLCM_BOVIN TDAAALNILALSPAARNLLLKSYFSEEGIEYNIIRVPMASCDFSIRTYTY tr|D1L2S0|D1L2S0_BALPH -------------------------------------------------- tr|F6WDY8|F6WDY8_HORSE TDAAALNILALSPAARNLLLKSYFSEEGIEYNIIRVPMASCDFSIRVYTY P04062 -------------------------------------------------- tr|F5H241|F5H241_HUMAN -------------------------------------------------- tr|B7Z6S9|B7Z6S9_HUMAN -------------------------------------------------- pdb|pdb|3gxi_A -------------------------------------------------- pdb|pdb|2nt1_A --------------------------------------------------


tr|A9UD35|A9UD35_DELDE -------------------------------------------------- tr|F5CB27|F5CB27_DELCA -------------------------------------------------- sp|Q2KHZ8|GLCM_BOVIN DDSPDDFQLLNFSLPEEDVKLKIPLIHQALELANRSVSLFASPWTSPTWL tr|D1L2S0|D1L2S0_BALPH -------------------------------------------------- tr|F6WDY8|F6WDY8_HORSE ADTPDDFQLHNFSLPEEDVKLKIPLIHQALELSQRPISLFASPWTSPTWL P04062 -------------------------------------------------- tr|F5H241|F5H241_HUMAN -------------------------------------------------- tr|B7Z6S9|B7Z6S9_HUMAN -------------------------------------------------- pdb|pdb|3gxi_A -------------------------------------------------- pdb|pdb|2nt1_A --------------------------------------------------


tr|A9UD35|A9UD35_DELDE -------------------------------------------------- tr|F5CB27|F5CB27_DELCA -------------------------------------------------- sp|Q2KHZ8|GLCM_BOVIN KTNGAVNGKGTLKGQAGDLYHKTWARYFVKFLDAYAEHKLRFWAVTAENE tr|D1L2S0|D1L2S0_BALPH -------------------------------------------------- tr|F6WDY8|F6WDY8_HORSE KTNGAVNGKGSLKGQPGDRYHQTWAKYFVKFLDAYAEHKLQFWAVTTENE P04062 ----AVNGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENE tr|F5H241|F5H241_HUMAN ----AVNGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENE tr|B7Z6S9|B7Z6S9_HUMAN ----AVNGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENE pdb|pdb|3gxi_A ----AVNGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENE pdb|pdb|2nt1_A ----AVNGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENE


tr|A9UD35|A9UD35_DELDE -------------------------------------------------- tr|F5CB27|F5CB27_DELCA -------------------------------------------------- sp|Q2KHZ8|GLCM_BOVIN PTAGLLTGYPFQCLGFTPEHQRDFIARDLGPILANSTHRDVRLLMLDDQR tr|D1L2S0|D1L2S0_BALPH -------------------------------------------------- tr|F6WDY8|F6WDY8_HORSE PSAGLISGYPFQCLGFTPEHQRDFIARDLGPTLANSTHRNVRVLMLDDQR P04062 PSAGLLSGYPFQCLGFTPEHQRDFIARDLGPTLANSTHHNVRLLMLDDQR tr|F5H241|F5H241_HUMAN PSAGLLSGYPFQCLGFTPEHQRDFIARDLGPTLANSTHHNVRLLMLDDQR tr|B7Z6S9|B7Z6S9_HUMAN PSAGLLSGYPFQCLGFTPEHQRDFIARDLGPTLANSTHHNVRLLMLDDQR pdb|pdb|3gxi_A PSAGLLSGYPFQCLGFTPEHQRDFIARDLGPTLANSTHHNVRLLMLDDQR pdb|pdb|2nt1_A PSAGLLSGYPFQCLGFTPEHQRDFIARDLGPTLANSTHHNVRLLMLDDQR


tr|A9UD35|A9UD35_DELDE -------------------------------------------------- tr|F5CB27|F5CB27_DELCA -------------------------------------------------- sp|Q2KHZ8|GLCM_BOVIN LLLPRWAQVVLADPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTM tr|D1L2S0|D1L2S0_BALPH -------------------------------------------------- tr|F6WDY8|F6WDY8_HORSE LLLPRWAQVVLADPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPDMM P04062 LLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTM tr|F5H241|F5H241_HUMAN LLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTM tr|B7Z6S9|B7Z6S9_HUMAN LLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTM pdb|pdb|3gxi_A LLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTM pdb|pdb|2nt1_A LLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTM


tr|A9UD35|A9UD35_DELDE -------------------------------------------------- tr|F5CB27|F5CB27_DELCA -------------------------------------------------- sp|Q2KHZ8|GLCM_BOVIN LFASEACVGSKFWEQSVRLGSWDRGMRYSHSIITNLLYHVVGWTDWNLAL tr|D1L2S0|D1L2S0_BALPH -------------------------------------------------- tr|F6WDY8|F6WDY8_HORSE LFASEACVGSKFWEQSVRLGSWDRGVQYSHSIITNLLYHVAGWTDWNLAL P04062 LFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTDWNLAL tr|F5H241|F5H241_HUMAN LFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTDWNLAL tr|B7Z6S9|B7Z6S9_HUMAN LFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTDWNLAL pdb|pdb|3gxi_A LFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTDWNLAL pdb|pdb|2nt1_A LFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTDWNLAL


tr|A9UD35|A9UD35_DELDE -------------------------------------------------- tr|F5CB27|F5CB27_DELCA -------------------------------------------------- sp|Q2KHZ8|GLCM_BOVIN NPEGGPNWVRNFVDSPIIVDIAKDTFYKQPMFYHLGHFSKFIPEGSQRVG tr|D1L2S0|D1L2S0_BALPH -------------------------------------------------- tr|F6WDY8|F6WDY8_HORSE NPEGGPNWVRNFVDSPIIVDIAKDTFYKQPMFYHLGHFSKFIPEGSQRVG P04062 NPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVG tr|F5H241|F5H241_HUMAN NPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVG tr|B7Z6S9|B7Z6S9_HUMAN NPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVG pdb|pdb|3gxi_A NPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVG pdb|pdb|2nt1_A NPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVG


tr|A9UD35|A9UD35_DELDE -------------------------------------------------- tr|F5CB27|F5CB27_DELCA -------------------------------------------------- sp|Q2KHZ8|GLCM_BOVIN LVASKKSDLDTVALLRPDGSAVAVVLNRSSKDVPLTIKDPAVGFMETVSP tr|D1L2S0|D1L2S0_BALPH -------------------------------------------------- tr|F6WDY8|F6WDY8_HORSE LDASEKTNLDTVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETVSP P04062 LVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISP tr|F5H241|F5H241_HUMAN LVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISP tr|B7Z6S9|B7Z6S9_HUMAN LVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISP pdb|pdb|3gxi_A LVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISP pdb|pdb|2nt1_A LVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISP


tr|A9UD35|A9UD35_DELDE ------------ tr|F5CB27|F5CB27_DELCA ------------ sp|Q2KHZ8|GLCM_BOVIN GYSIHTYLWRRQ tr|D1L2S0|D1L2S0_BALPH ------------ tr|F6WDY8|F6WDY8_HORSE GYSIHTYLWRRQ P04062 GYSIHTYLWRRQ tr|F5H241|F5H241_HUMAN GYSIHTYLWRRQ tr|B7Z6S9|B7Z6S9_HUMAN GYSIHTYLWRRQ pdb|pdb|3gxi_A GYSIHTYLWHRQ pdb|pdb|2nt1_A GYSIHTYLWHRQ