Difference between revisions of "Multiple Sequence Alignment: ClustalW - set 1"

From Bioinformatikpedia
Line 19: Line 19:
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE -----------------------------------MELSSP--------S
tr|F6WDY8|F6WDY8_HORSE -----------------------------------MELSSP--------S
P04062 -----------------------------------MEFSSP--------S
<span style="color:#a30909">P04062 -----------------------------------MEFSSP--------S</span>
tr|F5H241|F5H241_HUMAN -----------------------------------MEFSSP--------S
tr|F5H241|F5H241_HUMAN -----------------------------------MEFSSP--------S
Line 31: Line 31:
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
<span style="color:#a30909">P04062 REECPKPLSRVSIMAGSLTG-------LLLLQ-------------AVSWA</span>
Line 43: Line 43:
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE --------------------------------------------------
tr|F5H241|F5H241_HUMAN S-------------------------------------------------
tr|F5H241|F5H241_HUMAN S-------------------------------------------------
Line 55: Line 55:
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE --------------------------------------------------
tr|F5H241|F5H241_HUMAN --------------------------------------------------
tr|F5H241|F5H241_HUMAN --------------------------------------------------
Line 67: Line 67:
tr|D1L2S0|D1L2S0_BALPH ----------------------------VVCV<span style="color:#0000FF">CNATYCDSLDPLTLPDPG</span>
tr|D1L2S0|D1L2S0_BALPH ----------------------------VVCV<span style="color:#0000FF">CNATYCDSLDPLTLPDPG</span>
tr|F6WDY8|F6WDY8_HORSE --------------GARPCSPKSFGYSSVVCV<span style="color:#0000FF">CNATYCDSLDPLTLPAPG</span>
tr|F6WDY8|F6WDY8_HORSE --------------GARPCSPKSFGYSSVVCV<span style="color:#0000FF">CNATYCDSLDPLTLPAPG</span>
<span style="color:#a30909">P04062 PAQNLLLKSYFSEEGIGYNIIRVPMASCDFSI<span style="color:#0000FF">RTYTYADTPDDFQLHN--</span></span>
tr|F5H241|F5H241_HUMAN --------------GIGYNIIRVPMASCDFSI<span style="color:#0000FF">RTYTYADTPDDFQLHN--</span>
tr|F5H241|F5H241_HUMAN --------------GIGYNIIRVPMASCDFSI<span style="color:#0000FF">RTYTYADTPDDFQLHN--</span>
Line 79: Line 79:
tr|D1L2S0|D1L2S0_BALPH <span style="color:#0000FF">TFSRFESTRSGRRMELSLGAIQANRTGTGLLLTLQPD</span>-------------
tr|D1L2S0|D1L2S0_BALPH <span style="color:#0000FF">TFSRFESTRSGRRMELSLGAIQANRTGTGLLLTLQPD</span>-------------
P04062 <span style="color:#0000FF">-FSLPEED-TKLKIPLIHRALQLAQRPVSLLASPWTS</span>PTWLKTNG-----
<span style="color:#a30909">P04062 <span style="color:#0000FF">-FSLPEED-TKLKIPLIHRALQLAQRPVSLLASPWTS</span>PTWLKTNG-----</span>
tr|F5H241|F5H241_HUMAN <span style="color:#0000FF">-FSLPEED-TKLKIPLIHRALQLAQRPVSLLASPWTS</span>PTWLKTNG-----
tr|F5H241|F5H241_HUMAN <span style="color:#0000FF">-FSLPEED-TKLKIPLIHRALQLAQRPVSLLASPWTS</span>PTWLKTNG-----
Line 91: Line 91:
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
P04062 --------------------------------------------------
<span style="color:#a30909">P04062 --------------------------------------------------</span>
tr|F5H241|F5H241_HUMAN --------------------------------------------------
tr|F5H241|F5H241_HUMAN --------------------------------------------------
tr|B7Z6S9|B7Z6S9_HUMAN --------------------------------------------------
tr|B7Z6S9|B7Z6S9_HUMAN --------------------------------------------------
Line 103: Line 103:
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
P04062 --------------------------------------------------
<span style="color:#a30909">P04062 --------------------------------------------------</span>
tr|F5H241|F5H241_HUMAN --------------------------------------------------
tr|F5H241|F5H241_HUMAN --------------------------------------------------
tr|B7Z6S9|B7Z6S9_HUMAN --------------------------------------------------
tr|B7Z6S9|B7Z6S9_HUMAN --------------------------------------------------
Line 115: Line 115:
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
Line 127: Line 127:
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
Line 139: Line 139:
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
Line 151: Line 151:
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
Line 163: Line 163:
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
Line 175: Line 175:
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
Line 187: Line 187:
tr|D1L2S0|D1L2S0_BALPH ------------
tr|D1L2S0|D1L2S0_BALPH ------------
<span style="color:#a30909">P04062 GYSIHTYLWRRQ</span>

Revision as of 11:42, 6 May 2013

CLUSTAL 2.1 multiple sequence alignment

tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN        --------------------------------------------------
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE      --------------------------------------------------
P04062                      --------------------------------------------------
tr|F5H241|F5H241_HUMAN      --------------------------------------------------
pdb|pdb|3gxi_A              --------------------------------------------------
pdb|pdb|2nt1_A              --------------------------------------------------

tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN        -----------------------------------MELSSP--------S
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE      -----------------------------------MELSSP--------S
P04062                      -----------------------------------MEFSSP--------S
tr|F5H241|F5H241_HUMAN      -----------------------------------MEFSSP--------S
pdb|pdb|3gxi_A              ------------ARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFS
pdb|pdb|2nt1_A              ------------ARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFS

tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
P04062                      REECPKPLSRVSIMAGSLTG-------LLLLQ-------------AVSWA
tr|F5H241|F5H241_HUMAN      REECPKPLSRVSIMAGSLTG-------LLLLQ-------------AVSWA

tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN        --------------------------------------------------
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE      --------------------------------------------------
tr|F5H241|F5H241_HUMAN      S-------------------------------------------------
pdb|pdb|3gxi_A              AALN----------------------------------------------
pdb|pdb|2nt1_A              AALN----------------------------------------------

tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN        --------------------------------------------------
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE      --------------------------------------------------
tr|F5H241|F5H241_HUMAN      --------------------------------------------------
pdb|pdb|3gxi_A              --------------------------------------------ILALSP
pdb|pdb|2nt1_A              --------------------------------------------ILALSP

tr|A9UD35|A9UD35_DELDE      --------------------------------CNATYCDSLDPLTLPDPG
tr|F5CB27|F5CB27_DELCA      --------------------------------CNATYCDSLDPLTLPDPG
tr|D1L2S0|D1L2S0_BALPH      ----------------------------VVCVCNATYCDSLDPLTLPDPG
                                                             . **.*: * : *    

                             *.  *.  :  :: *   ::*  :  ..** :  ..             

tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
P04062                      --------------------------------------------------
tr|F5H241|F5H241_HUMAN      --------------------------------------------------
tr|B7Z6S9|B7Z6S9_HUMAN      --------------------------------------------------
pdb|pdb|3gxi_A              --------------------------------------------------
pdb|pdb|2nt1_A              --------------------------------------------------

tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
P04062                      --------------------------------------------------
tr|F5H241|F5H241_HUMAN      --------------------------------------------------
tr|B7Z6S9|B7Z6S9_HUMAN      --------------------------------------------------
pdb|pdb|3gxi_A              --------------------------------------------------
pdb|pdb|2nt1_A              --------------------------------------------------

tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------

tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------

tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------

tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------

tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------

tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------

tr|A9UD35|A9UD35_DELDE      ------------
tr|F5CB27|F5CB27_DELCA      ------------
tr|D1L2S0|D1L2S0_BALPH      ------------
P04062                      GYSIHTYLWRRQ
pdb|pdb|3gxi_A              GYSIHTYLWHRQ
pdb|pdb|2nt1_A              GYSIHTYLWHRQ