Difference between revisions of "Multiple Sequence Alignment: ClustalW - set 1"

From Bioinformatikpedia
Line 85: Line 85:
 
pdb|pdb|2nt1_A <span style="color:#0000FF">-FSLPEED-TKLKIPLIHRALQLAQRPVSLLASPWTS</span>PTWLKTNG-----
 
pdb|pdb|2nt1_A <span style="color:#0000FF">-FSLPEED-TKLKIPLIHRALQLAQRPVSLLASPWTS</span>PTWLKTNG-----
 
<span style="color:#0000FF"> *. *. : :: * ::* : ..** : .. </span>
 
<span style="color:#0000FF"> *. *. : :: * ::* : ..** : .. </span>
  +
 
 
tr|A9UD35|A9UD35_DELDE --------------------------------------------------
 
tr|A9UD35|A9UD35_DELDE --------------------------------------------------
 
tr|F5CB27|F5CB27_DELCA --------------------------------------------------
 
tr|F5CB27|F5CB27_DELCA --------------------------------------------------

Revision as of 23:46, 5 May 2013

CLUSTAL 2.1 multiple sequence alignment


tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN        --------------------------------------------------
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE      --------------------------------------------------
P04062                      --------------------------------------------------
tr|F5H241|F5H241_HUMAN      --------------------------------------------------
tr|B7Z6S9|B7Z6S9_HUMAN      MSDRLFSNPGPAPTPQGCFSRGCGWSGCILPSESYCAGPQSPVPPRRLCR
pdb|pdb|3gxi_A              --------------------------------------------------
pdb|pdb|2nt1_A              --------------------------------------------------
                                                                             

tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN        -----------------------------------MELSSP--------S
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE      -----------------------------------MELSSP--------S
P04062                      -----------------------------------MEFSSP--------S
tr|F5H241|F5H241_HUMAN      -----------------------------------MEFSSP--------S
tr|B7Z6S9|B7Z6S9_HUMAN      LRWDFVLPPVGAAVSLRRRDSGTPVVFSSSNDPEGMEFSSP--------S
pdb|pdb|3gxi_A              ------------ARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFS
pdb|pdb|2nt1_A              ------------ARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFS
                                                                             

tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN        REEYPMPRGRVGIMAASLMG-------LLLLHTVSWVS------------
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE      REGCLKCPGRVGIMAASFMG-------LLLLQAVSRAS------------
P04062                      REECPKPLSRVSIMAGSLTG-------LLLLQ-------------AVSWA
tr|F5H241|F5H241_HUMAN      REECPKPLSRVSIMAGSLTG-------LLLLQ-------------AVSWA
tr|B7Z6S9|B7Z6S9_HUMAN      REECPKPLSRVSIMAGSLTG-------LLLLQ-------------AVSWA
pdb|pdb|3gxi_A              RYESTRSGRRMELSMGPIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDA
pdb|pdb|2nt1_A              RYESTRSGRRMELSMGPIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDA
                                                                             

tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN        --------------------------------------------------
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE      --------------------------------------------------
P04062                      SGARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRR
tr|F5H241|F5H241_HUMAN      S-------------------------------------------------
tr|B7Z6S9|B7Z6S9_HUMAN      SGARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRR
pdb|pdb|3gxi_A              AALN----------------------------------------------
pdb|pdb|2nt1_A              AALN----------------------------------------------
                                                                             

tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN        --------------------------------------------------
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE      --------------------------------------------------
P04062                      MELSMGPIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDAAALNILALSP
tr|F5H241|F5H241_HUMAN      --------------------------------------------------
tr|B7Z6S9|B7Z6S9_HUMAN      MELSMGPIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDAAALNILALSP
pdb|pdb|3gxi_A              --------------------------------------------ILALSP
pdb|pdb|2nt1_A              --------------------------------------------ILALSP
                                                                             

tr|A9UD35|A9UD35_DELDE      --------------------------------CNATYCDSLDPLTLPDPG
tr|F5CB27|F5CB27_DELCA      --------------------------------CNATYCDSLDPLTLPDPG
sp|Q2KHZ8|GLCM_BOVIN        --------------GARPCSPKSFGYSSVVCVCNGTYCDSLDPLTLPDPG
tr|D1L2S0|D1L2S0_BALPH      ----------------------------VVCVCNATYCDSLDPLTLPDPG
tr|F6WDY8|F6WDY8_HORSE      --------------GARPCSPKSFGYSSVVCVCNATYCDSLDPLTLPAPG
P04062                      PAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHN--
tr|F5H241|F5H241_HUMAN      --------------GIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHN--
tr|B7Z6S9|B7Z6S9_HUMAN      PAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHN--
pdb|pdb|3gxi_A              PAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHN--
pdb|pdb|2nt1_A              PAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHN--
                                                             . **.*: * : *    

tr|A9UD35|A9UD35_DELDE      TFSRFESTRSGRRMELSLGTIQANRTGTGLLLTLQPDQKFQKVKG-----
tr|F5CB27|F5CB27_DELCA      TFSRFESTRSGRRMELSLGTIQANRTGTGLLLTLQPD-------------
sp|Q2KHZ8|GLCM_BOVIN        TFSRFESTRSGRRMELSLGTIQANRTGTGLLLTLQPDQKFQKVKGFGGAM
tr|D1L2S0|D1L2S0_BALPH      TFSRFESTRSGRRMELSLGAIQANRTGTGLLLTLQPD-------------
tr|F6WDY8|F6WDY8_HORSE      TFSRYESTRSGRRMELSLGAIQANRTGTGLLLTLQPDQKFQKVKGFGGAM
P04062                      -FSLPEED-TKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNG-----
tr|F5H241|F5H241_HUMAN      -FSLPEED-TKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNG-----
tr|B7Z6S9|B7Z6S9_HUMAN      -FGLPEED-TKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNG-----
pdb|pdb|3gxi_A              -FSLPEED-TKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNG-----
pdb|pdb|2nt1_A              -FSLPEED-TKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNG-----
                             *.  *.  :  :: *   ::*  :  ..** :  ..             

tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN        TDAAALNILALSPAARNLLLKSYFSEEGIEYNIIRVPMASCDFSIRTYTY
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE      TDAAALNILALSPAARNLLLKSYFSEEGIEYNIIRVPMASCDFSIRVYTY
P04062                      --------------------------------------------------
tr|F5H241|F5H241_HUMAN      --------------------------------------------------
tr|B7Z6S9|B7Z6S9_HUMAN      --------------------------------------------------
pdb|pdb|3gxi_A              --------------------------------------------------
pdb|pdb|2nt1_A              --------------------------------------------------
                                                                             

tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN        DDSPDDFQLLNFSLPEEDVKLKIPLIHQALELANRSVSLFASPWTSPTWL
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE      ADTPDDFQLHNFSLPEEDVKLKIPLIHQALELSQRPISLFASPWTSPTWL
P04062                      --------------------------------------------------
tr|F5H241|F5H241_HUMAN      --------------------------------------------------
tr|B7Z6S9|B7Z6S9_HUMAN      --------------------------------------------------
pdb|pdb|3gxi_A              --------------------------------------------------
pdb|pdb|2nt1_A              --------------------------------------------------
                                                                             

tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN        KTNGAVNGKGTLKGQAGDLYHKTWARYFVKFLDAYAEHKLRFWAVTAENE
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE      KTNGAVNGKGSLKGQPGDRYHQTWAKYFVKFLDAYAEHKLQFWAVTTENE
P04062                      ----AVNGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENE
tr|F5H241|F5H241_HUMAN      ----AVNGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENE
tr|B7Z6S9|B7Z6S9_HUMAN      ----AVNGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENE
pdb|pdb|3gxi_A              ----AVNGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENE
pdb|pdb|2nt1_A              ----AVNGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENE
                                                                              

tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN        PTAGLLTGYPFQCLGFTPEHQRDFIARDLGPILANSTHRDVRLLMLDDQR
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE      PSAGLISGYPFQCLGFTPEHQRDFIARDLGPTLANSTHRNVRVLMLDDQR
P04062                      PSAGLLSGYPFQCLGFTPEHQRDFIARDLGPTLANSTHHNVRLLMLDDQR
tr|F5H241|F5H241_HUMAN      PSAGLLSGYPFQCLGFTPEHQRDFIARDLGPTLANSTHHNVRLLMLDDQR
tr|B7Z6S9|B7Z6S9_HUMAN      PSAGLLSGYPFQCLGFTPEHQRDFIARDLGPTLANSTHHNVRLLMLDDQR
pdb|pdb|3gxi_A              PSAGLLSGYPFQCLGFTPEHQRDFIARDLGPTLANSTHHNVRLLMLDDQR
pdb|pdb|2nt1_A              PSAGLLSGYPFQCLGFTPEHQRDFIARDLGPTLANSTHHNVRLLMLDDQR
                                                                              

tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN        LLLPRWAQVVLADPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTM
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE      LLLPRWAQVVLADPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPDMM
P04062                      LLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTM
tr|F5H241|F5H241_HUMAN      LLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTM
tr|B7Z6S9|B7Z6S9_HUMAN      LLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTM
pdb|pdb|3gxi_A              LLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTM
pdb|pdb|2nt1_A              LLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTM
                                                                             

tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN        LFASEACVGSKFWEQSVRLGSWDRGMRYSHSIITNLLYHVVGWTDWNLAL
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE      LFASEACVGSKFWEQSVRLGSWDRGVQYSHSIITNLLYHVAGWTDWNLAL
P04062                      LFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTDWNLAL
tr|F5H241|F5H241_HUMAN      LFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTDWNLAL
tr|B7Z6S9|B7Z6S9_HUMAN      LFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTDWNLAL
pdb|pdb|3gxi_A              LFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTDWNLAL
pdb|pdb|2nt1_A              LFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTDWNLAL
                                                                              

tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN        NPEGGPNWVRNFVDSPIIVDIAKDTFYKQPMFYHLGHFSKFIPEGSQRVG
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE      NPEGGPNWVRNFVDSPIIVDIAKDTFYKQPMFYHLGHFSKFIPEGSQRVG
P04062                      NPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVG
tr|F5H241|F5H241_HUMAN      NPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVG
tr|B7Z6S9|B7Z6S9_HUMAN      NPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVG
pdb|pdb|3gxi_A              NPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVG
pdb|pdb|2nt1_A              NPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVG
                                                                              

tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN        LVASKKSDLDTVALLRPDGSAVAVVLNRSSKDVPLTIKDPAVGFMETVSP
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE      LDASEKTNLDTVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETVSP
P04062                      LVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISP
tr|F5H241|F5H241_HUMAN      LVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISP
tr|B7Z6S9|B7Z6S9_HUMAN      LVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISP
pdb|pdb|3gxi_A              LVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISP
pdb|pdb|2nt1_A              LVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISP
                                                                             

tr|A9UD35|A9UD35_DELDE      ------------
tr|F5CB27|F5CB27_DELCA      ------------
sp|Q2KHZ8|GLCM_BOVIN        GYSIHTYLWRRQ
tr|D1L2S0|D1L2S0_BALPH      ------------
tr|F6WDY8|F6WDY8_HORSE      GYSIHTYLWRRQ
P04062                      GYSIHTYLWRRQ
tr|F5H241|F5H241_HUMAN      GYSIHTYLWRRQ
tr|B7Z6S9|B7Z6S9_HUMAN      GYSIHTYLWRRQ
pdb|pdb|3gxi_A              GYSIHTYLWHRQ
pdb|pdb|2nt1_A              GYSIHTYLWHRQ