Difference between revisions of "Multiple Sequence Alignment: ClustalW - set 1"

From Bioinformatikpedia
Line 14: Line 14:
 
 
   
tr|A9UD35|A9UD35_DELDE --------------------------------------------------
+
tr|A9UD35|A9UD35_DELDE --------------------------------------------------
tr|F5CB27|F5CB27_DELCA --------------------------------------------------
+
tr|F5CB27|F5CB27_DELCA --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN -----------------------------------MELSSP--------S
+
sp|Q2KHZ8|GLCM_BOVIN -----------------------------------MELSSP--------S
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
+
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE -----------------------------------MELSSP--------S
+
tr|F6WDY8|F6WDY8_HORSE -----------------------------------MELSSP--------S
P04062 -----------------------------------MEFSSP--------S
+
P04062 -----------------------------------MEFSSP--------S
tr|F5H241|F5H241_HUMAN -----------------------------------MEFSSP--------S
+
tr|F5H241|F5H241_HUMAN -----------------------------------MEFSSP--------S
tr|B7Z6S9|B7Z6S9_HUMAN LRWDFVLPPVGAAVSLRRRDSGTPVVFSSSNDPEGMEFSSP--------S
+
tr|B7Z6S9|B7Z6S9_HUMAN LRWDFVLPPVGAAVSLRRRDSGTPVVFSSSNDPEGMEFSSP--------S
pdb|pdb|3gxi_A ------------ARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFS
+
pdb|pdb|3gxi_A ------------ARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFS
pdb|pdb|2nt1_A ------------ARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFS
+
pdb|pdb|2nt1_A ------------ARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFS
 
 
   
tr|A9UD35|A9UD35_DELDE --------------------------------------------------
+
tr|A9UD35|A9UD35_DELDE --------------------------------------------------
tr|F5CB27|F5CB27_DELCA --------------------------------------------------
+
tr|F5CB27|F5CB27_DELCA --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN REEYPMPRGRVGIMAASLMG-------LLLLHTVSWVS------------
+
sp|Q2KHZ8|GLCM_BOVIN REEYPMPRGRVGIMAASLMG-------LLLLHTVSWVS------------
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
+
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE REGCLKCPGRVGIMAASFMG-------LLLLQAVSRAS------------
+
tr|F6WDY8|F6WDY8_HORSE REGCLKCPGRVGIMAASFMG-------LLLLQAVSRAS------------
P04062 REECPKPLSRVSIMAGSLTG-------LLLLQ-------------AVSWA
+
P04062 REECPKPLSRVSIMAGSLTG-------LLLLQ-------------AVSWA
tr|F5H241|F5H241_HUMAN REECPKPLSRVSIMAGSLTG-------LLLLQ-------------AVSWA
+
tr|F5H241|F5H241_HUMAN REECPKPLSRVSIMAGSLTG-------LLLLQ-------------AVSWA
tr|B7Z6S9|B7Z6S9_HUMAN REECPKPLSRVSIMAGSLTG-------LLLLQ-------------AVSWA
+
tr|B7Z6S9|B7Z6S9_HUMAN REECPKPLSRVSIMAGSLTG-------LLLLQ-------------AVSWA
pdb|pdb|3gxi_A RYESTRSGRRMELSMGPIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDA
+
pdb|pdb|3gxi_A RYESTRSGRRMELSMGPIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDA
pdb|pdb|2nt1_A RYESTRSGRRMELSMGPIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDA
+
pdb|pdb|2nt1_A RYESTRSGRRMELSMGPIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDA
 
 
   
tr|A9UD35|A9UD35_DELDE --------------------------------------------------
+
tr|A9UD35|A9UD35_DELDE --------------------------------------------------
tr|F5CB27|F5CB27_DELCA --------------------------------------------------
+
tr|F5CB27|F5CB27_DELCA --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN --------------------------------------------------
+
sp|Q2KHZ8|GLCM_BOVIN --------------------------------------------------
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
+
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE --------------------------------------------------
+
tr|F6WDY8|F6WDY8_HORSE --------------------------------------------------
P04062 SGARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRR
+
P04062 SGARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRR
tr|F5H241|F5H241_HUMAN S-------------------------------------------------
+
tr|F5H241|F5H241_HUMAN S-------------------------------------------------
tr|B7Z6S9|B7Z6S9_HUMAN SGARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRR
+
tr|B7Z6S9|B7Z6S9_HUMAN SGARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRR
pdb|pdb|3gxi_A AALN----------------------------------------------
+
pdb|pdb|3gxi_A AALN----------------------------------------------
pdb|pdb|2nt1_A AALN----------------------------------------------
+
pdb|pdb|2nt1_A AALN----------------------------------------------
 
 
   
tr|A9UD35|A9UD35_DELDE --------------------------------------------------
+
tr|A9UD35|A9UD35_DELDE --------------------------------------------------
tr|F5CB27|F5CB27_DELCA --------------------------------------------------
+
tr|F5CB27|F5CB27_DELCA --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN --------------------------------------------------
+
sp|Q2KHZ8|GLCM_BOVIN --------------------------------------------------
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
+
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE --------------------------------------------------
+
tr|F6WDY8|F6WDY8_HORSE --------------------------------------------------
P04062 MELSMGPIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDAAALNILALSP
+
P04062 MELSMGPIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDAAALNILALSP
tr|F5H241|F5H241_HUMAN --------------------------------------------------
+
tr|F5H241|F5H241_HUMAN --------------------------------------------------
tr|B7Z6S9|B7Z6S9_HUMAN MELSMGPIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDAAALNILALSP
+
tr|B7Z6S9|B7Z6S9_HUMAN MELSMGPIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDAAALNILALSP
pdb|pdb|3gxi_A --------------------------------------------ILALSP
+
pdb|pdb|3gxi_A --------------------------------------------ILALSP
pdb|pdb|2nt1_A --------------------------------------------ILALSP
+
pdb|pdb|2nt1_A --------------------------------------------ILALSP
 
 
   
tr|A9UD35|A9UD35_DELDE --------------------------------CNATYCDSLDPLTLPDPG
+
tr|A9UD35|A9UD35_DELDE --------------------------------CNATYCDSLDPLTLPDPG
tr|F5CB27|F5CB27_DELCA --------------------------------CNATYCDSLDPLTLPDPG
+
tr|F5CB27|F5CB27_DELCA --------------------------------CNATYCDSLDPLTLPDPG
sp|Q2KHZ8|GLCM_BOVIN --------------GARPCSPKSFGYSSVVCVCNGTYCDSLDPLTLPDPG
+
sp|Q2KHZ8|GLCM_BOVIN --------------GARPCSPKSFGYSSVVCVCNGTYCDSLDPLTLPDPG
tr|D1L2S0|D1L2S0_BALPH ----------------------------VVCVCNATYCDSLDPLTLPDPG
+
tr|D1L2S0|D1L2S0_BALPH ----------------------------VVCVCNATYCDSLDPLTLPDPG
tr|F6WDY8|F6WDY8_HORSE --------------GARPCSPKSFGYSSVVCVCNATYCDSLDPLTLPAPG
+
tr|F6WDY8|F6WDY8_HORSE --------------GARPCSPKSFGYSSVVCVCNATYCDSLDPLTLPAPG
P04062 PAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHN--
+
P04062 PAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHN--
tr|F5H241|F5H241_HUMAN --------------GIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHN--
+
tr|F5H241|F5H241_HUMAN --------------GIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHN--
tr|B7Z6S9|B7Z6S9_HUMAN PAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHN--
+
tr|B7Z6S9|B7Z6S9_HUMAN PAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHN--
pdb|pdb|3gxi_A PAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHN--
+
pdb|pdb|3gxi_A PAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHN--
pdb|pdb|2nt1_A PAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHN--
+
pdb|pdb|2nt1_A PAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHN--
. **.*: * : *
+
. **.*: * : *
   
tr|A9UD35|A9UD35_DELDE TFSRFESTRSGRRMELSLGTIQANRTGTGLLLTLQPDQKFQKVKG-----
+
tr|A9UD35|A9UD35_DELDE TFSRFESTRSGRRMELSLGTIQANRTGTGLLLTLQPDQKFQKVKG-----
tr|F5CB27|F5CB27_DELCA TFSRFESTRSGRRMELSLGTIQANRTGTGLLLTLQPD-------------
+
tr|F5CB27|F5CB27_DELCA TFSRFESTRSGRRMELSLGTIQANRTGTGLLLTLQPD-------------
sp|Q2KHZ8|GLCM_BOVIN TFSRFESTRSGRRMELSLGTIQANRTGTGLLLTLQPDQKFQKVKGFGGAM
+
sp|Q2KHZ8|GLCM_BOVIN TFSRFESTRSGRRMELSLGTIQANRTGTGLLLTLQPDQKFQKVKGFGGAM
tr|D1L2S0|D1L2S0_BALPH TFSRFESTRSGRRMELSLGAIQANRTGTGLLLTLQPD-------------
+
tr|D1L2S0|D1L2S0_BALPH TFSRFESTRSGRRMELSLGAIQANRTGTGLLLTLQPD-------------
tr|F6WDY8|F6WDY8_HORSE TFSRYESTRSGRRMELSLGAIQANRTGTGLLLTLQPDQKFQKVKGFGGAM
+
tr|F6WDY8|F6WDY8_HORSE TFSRYESTRSGRRMELSLGAIQANRTGTGLLLTLQPDQKFQKVKGFGGAM
P04062 -FSLPEED-TKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNG-----
+
P04062 -FSLPEED-TKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNG-----
tr|F5H241|F5H241_HUMAN -FSLPEED-TKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNG-----
+
tr|F5H241|F5H241_HUMAN -FSLPEED-TKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNG-----
tr|B7Z6S9|B7Z6S9_HUMAN -FGLPEED-TKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNG-----
+
tr|B7Z6S9|B7Z6S9_HUMAN -FGLPEED-TKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNG-----
pdb|pdb|3gxi_A -FSLPEED-TKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNG-----
+
pdb|pdb|3gxi_A -FSLPEED-TKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNG-----
pdb|pdb|2nt1_A -FSLPEED-TKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNG-----
+
pdb|pdb|2nt1_A -FSLPEED-TKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNG-----
*. *. : :: * ::* : ..** : ..
+
*. *. : :: * ::* : ..** : ..
   
tr|A9UD35|A9UD35_DELDE --------------------------------------------------
+
tr|A9UD35|A9UD35_DELDE --------------------------------------------------
tr|F5CB27|F5CB27_DELCA --------------------------------------------------
+
tr|F5CB27|F5CB27_DELCA --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN TDAAALNILALSPAARNLLLKSYFSEEGIEYNIIRVPMASCDFSIRTYTY
+
sp|Q2KHZ8|GLCM_BOVIN TDAAALNILALSPAARNLLLKSYFSEEGIEYNIIRVPMASCDFSIRTYTY
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
+
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE TDAAALNILALSPAARNLLLKSYFSEEGIEYNIIRVPMASCDFSIRVYTY
+
tr|F6WDY8|F6WDY8_HORSE TDAAALNILALSPAARNLLLKSYFSEEGIEYNIIRVPMASCDFSIRVYTY
P04062 --------------------------------------------------
+
P04062 --------------------------------------------------
tr|F5H241|F5H241_HUMAN --------------------------------------------------
+
tr|F5H241|F5H241_HUMAN --------------------------------------------------
tr|B7Z6S9|B7Z6S9_HUMAN --------------------------------------------------
+
tr|B7Z6S9|B7Z6S9_HUMAN --------------------------------------------------
pdb|pdb|3gxi_A --------------------------------------------------
+
pdb|pdb|3gxi_A --------------------------------------------------
pdb|pdb|2nt1_A --------------------------------------------------
+
pdb|pdb|2nt1_A --------------------------------------------------
 
 
   
tr|A9UD35|A9UD35_DELDE --------------------------------------------------
+
tr|A9UD35|A9UD35_DELDE --------------------------------------------------
tr|F5CB27|F5CB27_DELCA --------------------------------------------------
+
tr|F5CB27|F5CB27_DELCA --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN DDSPDDFQLLNFSLPEEDVKLKIPLIHQALELANRSVSLFASPWTSPTWL
+
sp|Q2KHZ8|GLCM_BOVIN DDSPDDFQLLNFSLPEEDVKLKIPLIHQALELANRSVSLFASPWTSPTWL
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
+
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE ADTPDDFQLHNFSLPEEDVKLKIPLIHQALELSQRPISLFASPWTSPTWL
+
tr|F6WDY8|F6WDY8_HORSE ADTPDDFQLHNFSLPEEDVKLKIPLIHQALELSQRPISLFASPWTSPTWL
P04062 --------------------------------------------------
+
P04062 --------------------------------------------------
tr|F5H241|F5H241_HUMAN --------------------------------------------------
+
tr|F5H241|F5H241_HUMAN --------------------------------------------------
tr|B7Z6S9|B7Z6S9_HUMAN --------------------------------------------------
+
tr|B7Z6S9|B7Z6S9_HUMAN --------------------------------------------------
pdb|pdb|3gxi_A --------------------------------------------------
+
pdb|pdb|3gxi_A --------------------------------------------------
pdb|pdb|2nt1_A --------------------------------------------------
+
pdb|pdb|2nt1_A --------------------------------------------------
 
 
   
tr|A9UD35|A9UD35_DELDE --------------------------------------------------
+
tr|A9UD35|A9UD35_DELDE --------------------------------------------------
tr|F5CB27|F5CB27_DELCA --------------------------------------------------
+
tr|F5CB27|F5CB27_DELCA --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN KTNGAVNGKGTLKGQAGDLYHKTWARYFVKFLDAYAEHKLRFWAVTAENE
+
sp|Q2KHZ8|GLCM_BOVIN KTNGAVNGKGTLKGQAGDLYHKTWARYFVKFLDAYAEHKLRFWAVTAENE
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
+
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE KTNGAVNGKGSLKGQPGDRYHQTWAKYFVKFLDAYAEHKLQFWAVTTENE
+
tr|F6WDY8|F6WDY8_HORSE KTNGAVNGKGSLKGQPGDRYHQTWAKYFVKFLDAYAEHKLQFWAVTTENE
P04062 ----AVNGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENE
+
P04062 ----AVNGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENE
tr|F5H241|F5H241_HUMAN ----AVNGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENE
+
tr|F5H241|F5H241_HUMAN ----AVNGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENE
tr|B7Z6S9|B7Z6S9_HUMAN ----AVNGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENE
+
tr|B7Z6S9|B7Z6S9_HUMAN ----AVNGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENE
pdb|pdb|3gxi_A ----AVNGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENE
+
pdb|pdb|3gxi_A ----AVNGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENE
pdb|pdb|2nt1_A ----AVNGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENE
+
pdb|pdb|2nt1_A ----AVNGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENE
+
   
tr|A9UD35|A9UD35_DELDE --------------------------------------------------
+
tr|A9UD35|A9UD35_DELDE --------------------------------------------------
tr|F5CB27|F5CB27_DELCA --------------------------------------------------
+
tr|F5CB27|F5CB27_DELCA --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN PTAGLLTGYPFQCLGFTPEHQRDFIARDLGPILANSTHRDVRLLMLDDQR
+
sp|Q2KHZ8|GLCM_BOVIN PTAGLLTGYPFQCLGFTPEHQRDFIARDLGPILANSTHRDVRLLMLDDQR
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
+
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE PSAGLISGYPFQCLGFTPEHQRDFIARDLGPTLANSTHRNVRVLMLDDQR
+
tr|F6WDY8|F6WDY8_HORSE PSAGLISGYPFQCLGFTPEHQRDFIARDLGPTLANSTHRNVRVLMLDDQR
P04062 PSAGLLSGYPFQCLGFTPEHQRDFIARDLGPTLANSTHHNVRLLMLDDQR
+
P04062 PSAGLLSGYPFQCLGFTPEHQRDFIARDLGPTLANSTHHNVRLLMLDDQR
tr|F5H241|F5H241_HUMAN PSAGLLSGYPFQCLGFTPEHQRDFIARDLGPTLANSTHHNVRLLMLDDQR
+
tr|F5H241|F5H241_HUMAN PSAGLLSGYPFQCLGFTPEHQRDFIARDLGPTLANSTHHNVRLLMLDDQR
tr|B7Z6S9|B7Z6S9_HUMAN PSAGLLSGYPFQCLGFTPEHQRDFIARDLGPTLANSTHHNVRLLMLDDQR
+
tr|B7Z6S9|B7Z6S9_HUMAN PSAGLLSGYPFQCLGFTPEHQRDFIARDLGPTLANSTHHNVRLLMLDDQR
pdb|pdb|3gxi_A PSAGLLSGYPFQCLGFTPEHQRDFIARDLGPTLANSTHHNVRLLMLDDQR
+
pdb|pdb|3gxi_A PSAGLLSGYPFQCLGFTPEHQRDFIARDLGPTLANSTHHNVRLLMLDDQR
pdb|pdb|2nt1_A PSAGLLSGYPFQCLGFTPEHQRDFIARDLGPTLANSTHHNVRLLMLDDQR
+
pdb|pdb|2nt1_A PSAGLLSGYPFQCLGFTPEHQRDFIARDLGPTLANSTHHNVRLLMLDDQR
+
   
tr|A9UD35|A9UD35_DELDE --------------------------------------------------
+
tr|A9UD35|A9UD35_DELDE --------------------------------------------------
tr|F5CB27|F5CB27_DELCA --------------------------------------------------
+
tr|F5CB27|F5CB27_DELCA --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN LLLPRWAQVVLADPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTM
+
sp|Q2KHZ8|GLCM_BOVIN LLLPRWAQVVLADPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTM
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
+
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE LLLPRWAQVVLADPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPDMM
+
tr|F6WDY8|F6WDY8_HORSE LLLPRWAQVVLADPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPDMM
P04062 LLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTM
+
P04062 LLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTM
tr|F5H241|F5H241_HUMAN LLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTM
+
tr|F5H241|F5H241_HUMAN LLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTM
tr|B7Z6S9|B7Z6S9_HUMAN LLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTM
+
tr|B7Z6S9|B7Z6S9_HUMAN LLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTM
pdb|pdb|3gxi_A LLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTM
+
pdb|pdb|3gxi_A LLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTM
pdb|pdb|2nt1_A LLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTM
+
pdb|pdb|2nt1_A LLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTM
 
 
   
tr|A9UD35|A9UD35_DELDE --------------------------------------------------
+
tr|A9UD35|A9UD35_DELDE --------------------------------------------------
tr|F5CB27|F5CB27_DELCA --------------------------------------------------
+
tr|F5CB27|F5CB27_DELCA --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN LFASEACVGSKFWEQSVRLGSWDRGMRYSHSIITNLLYHVVGWTDWNLAL
+
sp|Q2KHZ8|GLCM_BOVIN LFASEACVGSKFWEQSVRLGSWDRGMRYSHSIITNLLYHVVGWTDWNLAL
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
+
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE LFASEACVGSKFWEQSVRLGSWDRGVQYSHSIITNLLYHVAGWTDWNLAL
+
tr|F6WDY8|F6WDY8_HORSE LFASEACVGSKFWEQSVRLGSWDRGVQYSHSIITNLLYHVAGWTDWNLAL
P04062 LFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTDWNLAL
+
P04062 LFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTDWNLAL
tr|F5H241|F5H241_HUMAN LFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTDWNLAL
+
tr|F5H241|F5H241_HUMAN LFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTDWNLAL
tr|B7Z6S9|B7Z6S9_HUMAN LFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTDWNLAL
+
tr|B7Z6S9|B7Z6S9_HUMAN LFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTDWNLAL
pdb|pdb|3gxi_A LFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTDWNLAL
+
pdb|pdb|3gxi_A LFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTDWNLAL
pdb|pdb|2nt1_A LFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTDWNLAL
+
pdb|pdb|2nt1_A LFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTDWNLAL
+
   
tr|A9UD35|A9UD35_DELDE --------------------------------------------------
+
tr|A9UD35|A9UD35_DELDE --------------------------------------------------
tr|F5CB27|F5CB27_DELCA --------------------------------------------------
+
tr|F5CB27|F5CB27_DELCA --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN NPEGGPNWVRNFVDSPIIVDIAKDTFYKQPMFYHLGHFSKFIPEGSQRVG
+
sp|Q2KHZ8|GLCM_BOVIN NPEGGPNWVRNFVDSPIIVDIAKDTFYKQPMFYHLGHFSKFIPEGSQRVG
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
+
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE NPEGGPNWVRNFVDSPIIVDIAKDTFYKQPMFYHLGHFSKFIPEGSQRVG
+
tr|F6WDY8|F6WDY8_HORSE NPEGGPNWVRNFVDSPIIVDIAKDTFYKQPMFYHLGHFSKFIPEGSQRVG
P04062 NPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVG
+
P04062 NPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVG
tr|F5H241|F5H241_HUMAN NPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVG
+
tr|F5H241|F5H241_HUMAN NPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVG
tr|B7Z6S9|B7Z6S9_HUMAN NPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVG
+
tr|B7Z6S9|B7Z6S9_HUMAN NPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVG
pdb|pdb|3gxi_A NPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVG
+
pdb|pdb|3gxi_A NPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVG
pdb|pdb|2nt1_A NPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVG
+
pdb|pdb|2nt1_A NPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVG
+
   
tr|A9UD35|A9UD35_DELDE --------------------------------------------------
+
tr|A9UD35|A9UD35_DELDE --------------------------------------------------
tr|F5CB27|F5CB27_DELCA --------------------------------------------------
+
tr|F5CB27|F5CB27_DELCA --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN LVASKKSDLDTVALLRPDGSAVAVVLNRSSKDVPLTIKDPAVGFMETVSP
+
sp|Q2KHZ8|GLCM_BOVIN LVASKKSDLDTVALLRPDGSAVAVVLNRSSKDVPLTIKDPAVGFMETVSP
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
+
tr|D1L2S0|D1L2S0_BALPH --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE LDASEKTNLDTVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETVSP
+
tr|F6WDY8|F6WDY8_HORSE LDASEKTNLDTVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETVSP
P04062 LVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISP
+
P04062 LVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISP
tr|F5H241|F5H241_HUMAN LVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISP
+
tr|F5H241|F5H241_HUMAN LVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISP
tr|B7Z6S9|B7Z6S9_HUMAN LVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISP
+
tr|B7Z6S9|B7Z6S9_HUMAN LVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISP
pdb|pdb|3gxi_A LVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISP
+
pdb|pdb|3gxi_A LVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISP
pdb|pdb|2nt1_A LVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISP
+
pdb|pdb|2nt1_A LVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISP
 
 
   
tr|A9UD35|A9UD35_DELDE ------------
+
tr|A9UD35|A9UD35_DELDE ------------
tr|F5CB27|F5CB27_DELCA ------------
+
tr|F5CB27|F5CB27_DELCA ------------
sp|Q2KHZ8|GLCM_BOVIN GYSIHTYLWRRQ
+
sp|Q2KHZ8|GLCM_BOVIN GYSIHTYLWRRQ
tr|D1L2S0|D1L2S0_BALPH ------------
+
tr|D1L2S0|D1L2S0_BALPH ------------
tr|F6WDY8|F6WDY8_HORSE GYSIHTYLWRRQ
+
tr|F6WDY8|F6WDY8_HORSE GYSIHTYLWRRQ
P04062 GYSIHTYLWRRQ
+
P04062 GYSIHTYLWRRQ
tr|F5H241|F5H241_HUMAN GYSIHTYLWRRQ
+
tr|F5H241|F5H241_HUMAN GYSIHTYLWRRQ
tr|B7Z6S9|B7Z6S9_HUMAN GYSIHTYLWRRQ
+
tr|B7Z6S9|B7Z6S9_HUMAN GYSIHTYLWRRQ
pdb|pdb|3gxi_A GYSIHTYLWHRQ
+
pdb|pdb|3gxi_A GYSIHTYLWHRQ
pdb|pdb|2nt1_A GYSIHTYLWHRQ
+
pdb|pdb|2nt1_A GYSIHTYLWHRQ

Revision as of 00:15, 6 May 2013

CLUSTAL 2.1 multiple sequence alignment


tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN        --------------------------------------------------
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE      --------------------------------------------------
P04062                      --------------------------------------------------
tr|F5H241|F5H241_HUMAN      --------------------------------------------------
tr|B7Z6S9|B7Z6S9_HUMAN      MSDRLFSNPGPAPTPQGCFSRGCGWSGCILPSESYCAGPQSPVPPRRLCR
pdb|pdb|3gxi_A              --------------------------------------------------
pdb|pdb|2nt1_A              --------------------------------------------------
                                                                             
tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN        -----------------------------------MELSSP--------S
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE      -----------------------------------MELSSP--------S
P04062                      -----------------------------------MEFSSP--------S
tr|F5H241|F5H241_HUMAN      -----------------------------------MEFSSP--------S
tr|B7Z6S9|B7Z6S9_HUMAN      LRWDFVLPPVGAAVSLRRRDSGTPVVFSSSNDPEGMEFSSP--------S
pdb|pdb|3gxi_A              ------------ARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFS
pdb|pdb|2nt1_A              ------------ARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFS
                                                                             
tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN        REEYPMPRGRVGIMAASLMG-------LLLLHTVSWVS------------
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE      REGCLKCPGRVGIMAASFMG-------LLLLQAVSRAS------------
P04062                      REECPKPLSRVSIMAGSLTG-------LLLLQ-------------AVSWA
tr|F5H241|F5H241_HUMAN      REECPKPLSRVSIMAGSLTG-------LLLLQ-------------AVSWA
tr|B7Z6S9|B7Z6S9_HUMAN      REECPKPLSRVSIMAGSLTG-------LLLLQ-------------AVSWA
pdb|pdb|3gxi_A              RYESTRSGRRMELSMGPIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDA
pdb|pdb|2nt1_A              RYESTRSGRRMELSMGPIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDA
                                                                             
tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN        --------------------------------------------------
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE      --------------------------------------------------
P04062                      SGARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRR
tr|F5H241|F5H241_HUMAN      S-------------------------------------------------
tr|B7Z6S9|B7Z6S9_HUMAN      SGARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRR
pdb|pdb|3gxi_A              AALN----------------------------------------------
pdb|pdb|2nt1_A              AALN----------------------------------------------
                                                                             
tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN        --------------------------------------------------
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE      --------------------------------------------------
P04062                      MELSMGPIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDAAALNILALSP
tr|F5H241|F5H241_HUMAN      --------------------------------------------------
tr|B7Z6S9|B7Z6S9_HUMAN      MELSMGPIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDAAALNILALSP
pdb|pdb|3gxi_A              --------------------------------------------ILALSP
pdb|pdb|2nt1_A              --------------------------------------------ILALSP
                                                                             
tr|A9UD35|A9UD35_DELDE      --------------------------------CNATYCDSLDPLTLPDPG
tr|F5CB27|F5CB27_DELCA      --------------------------------CNATYCDSLDPLTLPDPG
sp|Q2KHZ8|GLCM_BOVIN        --------------GARPCSPKSFGYSSVVCVCNGTYCDSLDPLTLPDPG
tr|D1L2S0|D1L2S0_BALPH      ----------------------------VVCVCNATYCDSLDPLTLPDPG
tr|F6WDY8|F6WDY8_HORSE      --------------GARPCSPKSFGYSSVVCVCNATYCDSLDPLTLPAPG
P04062                      PAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHN--
tr|F5H241|F5H241_HUMAN      --------------GIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHN--
tr|B7Z6S9|B7Z6S9_HUMAN      PAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHN--
pdb|pdb|3gxi_A              PAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHN--
pdb|pdb|2nt1_A              PAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHN--
                                                             . **.*: * : *    
tr|A9UD35|A9UD35_DELDE      TFSRFESTRSGRRMELSLGTIQANRTGTGLLLTLQPDQKFQKVKG-----
tr|F5CB27|F5CB27_DELCA      TFSRFESTRSGRRMELSLGTIQANRTGTGLLLTLQPD-------------
sp|Q2KHZ8|GLCM_BOVIN        TFSRFESTRSGRRMELSLGTIQANRTGTGLLLTLQPDQKFQKVKGFGGAM
tr|D1L2S0|D1L2S0_BALPH      TFSRFESTRSGRRMELSLGAIQANRTGTGLLLTLQPD-------------
tr|F6WDY8|F6WDY8_HORSE      TFSRYESTRSGRRMELSLGAIQANRTGTGLLLTLQPDQKFQKVKGFGGAM
P04062                      -FSLPEED-TKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNG-----
tr|F5H241|F5H241_HUMAN      -FSLPEED-TKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNG-----
tr|B7Z6S9|B7Z6S9_HUMAN      -FGLPEED-TKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNG-----
pdb|pdb|3gxi_A              -FSLPEED-TKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNG-----
pdb|pdb|2nt1_A              -FSLPEED-TKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNG-----
                             *.  *.  :  :: *   ::*  :  ..** :  ..             
tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN        TDAAALNILALSPAARNLLLKSYFSEEGIEYNIIRVPMASCDFSIRTYTY
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE      TDAAALNILALSPAARNLLLKSYFSEEGIEYNIIRVPMASCDFSIRVYTY
P04062                      --------------------------------------------------
tr|F5H241|F5H241_HUMAN      --------------------------------------------------
tr|B7Z6S9|B7Z6S9_HUMAN      --------------------------------------------------
pdb|pdb|3gxi_A              --------------------------------------------------
pdb|pdb|2nt1_A              --------------------------------------------------
                                                                             
tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN        DDSPDDFQLLNFSLPEEDVKLKIPLIHQALELANRSVSLFASPWTSPTWL
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE      ADTPDDFQLHNFSLPEEDVKLKIPLIHQALELSQRPISLFASPWTSPTWL
P04062                      --------------------------------------------------
tr|F5H241|F5H241_HUMAN      --------------------------------------------------
tr|B7Z6S9|B7Z6S9_HUMAN      --------------------------------------------------
pdb|pdb|3gxi_A              --------------------------------------------------
pdb|pdb|2nt1_A              --------------------------------------------------
                                                                             
tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN        KTNGAVNGKGTLKGQAGDLYHKTWARYFVKFLDAYAEHKLRFWAVTAENE
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE      KTNGAVNGKGSLKGQPGDRYHQTWAKYFVKFLDAYAEHKLQFWAVTTENE
P04062                      ----AVNGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENE
tr|F5H241|F5H241_HUMAN      ----AVNGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENE
tr|B7Z6S9|B7Z6S9_HUMAN      ----AVNGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENE
pdb|pdb|3gxi_A              ----AVNGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENE
pdb|pdb|2nt1_A              ----AVNGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENE
                                                                              
tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN        PTAGLLTGYPFQCLGFTPEHQRDFIARDLGPILANSTHRDVRLLMLDDQR
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE      PSAGLISGYPFQCLGFTPEHQRDFIARDLGPTLANSTHRNVRVLMLDDQR
P04062                      PSAGLLSGYPFQCLGFTPEHQRDFIARDLGPTLANSTHHNVRLLMLDDQR
tr|F5H241|F5H241_HUMAN      PSAGLLSGYPFQCLGFTPEHQRDFIARDLGPTLANSTHHNVRLLMLDDQR
tr|B7Z6S9|B7Z6S9_HUMAN      PSAGLLSGYPFQCLGFTPEHQRDFIARDLGPTLANSTHHNVRLLMLDDQR
pdb|pdb|3gxi_A              PSAGLLSGYPFQCLGFTPEHQRDFIARDLGPTLANSTHHNVRLLMLDDQR
pdb|pdb|2nt1_A              PSAGLLSGYPFQCLGFTPEHQRDFIARDLGPTLANSTHHNVRLLMLDDQR
                                                                              
tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN        LLLPRWAQVVLADPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTM
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE      LLLPRWAQVVLADPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPDMM
P04062                      LLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTM
tr|F5H241|F5H241_HUMAN      LLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTM
tr|B7Z6S9|B7Z6S9_HUMAN      LLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTM
pdb|pdb|3gxi_A              LLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTM
pdb|pdb|2nt1_A              LLLPHWAKVVLTDPEAAKYVHGIAVHWYLDFLAPAKATLGETHRLFPNTM
                                                                             
tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN        LFASEACVGSKFWEQSVRLGSWDRGMRYSHSIITNLLYHVVGWTDWNLAL
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE      LFASEACVGSKFWEQSVRLGSWDRGVQYSHSIITNLLYHVAGWTDWNLAL
P04062                      LFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTDWNLAL
tr|F5H241|F5H241_HUMAN      LFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTDWNLAL
tr|B7Z6S9|B7Z6S9_HUMAN      LFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTDWNLAL
pdb|pdb|3gxi_A              LFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTDWNLAL
pdb|pdb|2nt1_A              LFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTDWNLAL
                                                                              
tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN        NPEGGPNWVRNFVDSPIIVDIAKDTFYKQPMFYHLGHFSKFIPEGSQRVG
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE      NPEGGPNWVRNFVDSPIIVDIAKDTFYKQPMFYHLGHFSKFIPEGSQRVG
P04062                      NPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVG
tr|F5H241|F5H241_HUMAN      NPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVG
tr|B7Z6S9|B7Z6S9_HUMAN      NPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVG
pdb|pdb|3gxi_A              NPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVG
pdb|pdb|2nt1_A              NPEGGPNWVRNFVDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVG
                                                                              
tr|A9UD35|A9UD35_DELDE      --------------------------------------------------
tr|F5CB27|F5CB27_DELCA      --------------------------------------------------
sp|Q2KHZ8|GLCM_BOVIN        LVASKKSDLDTVALLRPDGSAVAVVLNRSSKDVPLTIKDPAVGFMETVSP
tr|D1L2S0|D1L2S0_BALPH      --------------------------------------------------
tr|F6WDY8|F6WDY8_HORSE      LDASEKTNLDTVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETVSP
P04062                      LVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISP
tr|F5H241|F5H241_HUMAN      LVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISP
tr|B7Z6S9|B7Z6S9_HUMAN      LVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISP
pdb|pdb|3gxi_A              LVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISP
pdb|pdb|2nt1_A              LVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISP
                                                                             
tr|A9UD35|A9UD35_DELDE      ------------
tr|F5CB27|F5CB27_DELCA      ------------
sp|Q2KHZ8|GLCM_BOVIN        GYSIHTYLWRRQ
tr|D1L2S0|D1L2S0_BALPH      ------------
tr|F6WDY8|F6WDY8_HORSE      GYSIHTYLWRRQ
P04062                      GYSIHTYLWRRQ
tr|F5H241|F5H241_HUMAN      GYSIHTYLWRRQ
tr|B7Z6S9|B7Z6S9_HUMAN      GYSIHTYLWRRQ
pdb|pdb|3gxi_A              GYSIHTYLWHRQ
pdb|pdb|2nt1_A              GYSIHTYLWHRQ