MSUP-task7-journal
From Bioinformatikpedia
Scwrl
Sequence extraction from pdb-file:
/opt/SS12-Practical/scripts/repairPDB 2bfd_A.ent -chain A -seq
sequence mutated: kpqfpgasaefidklefiqpSvisgipiyrvIdrqgqiinpsedphlpkekvlklyksmtll ntmdrilyesqrEgrisfymtnygegtvgsaaaldntdlvfgareagvlmyrdyplelfmaq cygnisdlgkgrqpvygckerhfvtissplatqTpqavgaayaakrananrvvicyfgegaa segdahagfnfaatleYpiiffcrnngyaistptseqyrgdgiaargpgygimsirvdgndv favynaRkearrravaenqpflieTmtyrigstdhpVsrlrhylqgwwdeeqekawrkqsrr kvmeafeqaerkpkpSpnllfsdvyqempaqlrkqqeslaHhlqtygehypldhfdk
posmap:
snp-pos | pdb-pos-mapping |
N71S | N21S |
M82I | M32I |
Q125E | Q75E |
I213T | I158T |
C258Y | C203Y |
T310R | T255R |
A328T | A273T |
I361V | I285V |
N404S | N326S |
R429H | R351H |
Commad for SCWRL4:
/opt/SS12-Practical/scwrl4/Scwrl4 -i 2bfd_A.ent -s BCKDHA_2bfd_a.sequence_final -o model_OUT.pdb
FoldX
Mutation | total energy | Backbone Hbond | Sidechain Hbond | Van der Waals | Electrostatics | Solvation Polar | Solvation Hydrophobic | Van der Waals clashes | entropy sidechain | entropy mainchain | sloop_entropy | mloop_entropy | cis_bond | torsional clash | backbone clash | helix dipole | water bridge | disulfide | electrostatic kon | partial covalent bonds | energy Ionisation | Entropy Complex |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
N71S | 0.47 | 0.13 | 0.13 | 0.12 | 0.00 | -0.16 | 0.21 | 0.00 | -0.16 | 0.20 | 0.00 | 0.00 | 0.00 | -0.00 | -0.02 | 0.00 | 0.00 | 0.00 | 0.00 | 0.00 | 0.00 | 0.00 |
M82I | -0.12 | -0.00 | 0.00 | 0.33 | -0.03 | -0.15 | 0.24 | 0.06 | -0.31 | -0.39 | 0.00 | 0.00 | 0.00 | 0.12 | 0.04 | 0.00 | 0.00 | 0.00 | 0.00 | 0.00 | 0.00 | 0.00 |
Q125E | 1.50 | -0.01 | 3.18 | -0.05 | -0.70 | -0.04 | -0.05 | 0.15 | -1.58 | 0.07 | 0.00 | 0.00 | 0.00 | -0.03 | -0.03 | 0.55 | 0.00 | 0.00 | 0.00 | 0.00 | 0.00 | 0.00 |
I213T | 2.21 | -0.38 | -0.49 | 1.04 | 0.00 | 0.44 | 2.54 | -0.08 | -0.49 | -0.38 | 0.00 | 0.00 | 0.00 | 0.01 | -0.44 | 0.00 | 0.00 | 0.00 | 0.00 | 0.00 | 0.00 | 0.00 |
C258Y | 4.55 | 0.01 | 0.17 | -1.78 | 0.07 | 1.11 | -2.84 | 7.22 | 0.31 | 0.01 | 0.00 | 0.00 | 0.00 | 0.27 | 0.90 | -0.00 | 0.00 | 0.00 | 0.00 | 0.00 | 0.00 | 0.00 |
T310R | 8.51 | 0.02 | 0.28 | -1.67 | 0.13 | 3.01 | -1.29 | 4.89 | 1.30 | 0.04 | 0.00 | 0.00 | 0.00 | 2.22 | 0.11 | -0.42 | 0.00 | 0.00 | 0.00 | 0.00 | 0.00 | 0.00 |
A328T | 2.77 | -0.40 | -0.41 | -0.63 | -0.01 | 1.14 | -0.63 | 2.76 | 0.51 | -0.92 | 0.00 | 0.00 | 0.00 | 1.36 | -0.01 | 0.00 | 0.00 | 0.00 | 0.00 | 0.00 | 0.00 | 0.00 |
I361V | 0.50 | 0.01 | -0.01 | 0.48 | 0.00 | -0.28 | 0.86 | -0.04 | -0.55 | 0.02 | 0.00 | 0.00 | 0.00 | 0.01 | -0.07 | 0.00 | 0.00 | 0.00 | 0.00 | 0.00 | -0.01 | 0.00 |
N404S | 0.20 | 0.01 | 0.20 | 0.37 | 0.00 | -0.48 | 0.50 | -0.02 | -0.25 | -0.22 | 0.00 | 0.00 | 0.00 | 0.09 | -0.11 | 0.00 | 0.00 | 0.00 | 0.00 | 0.00 | 0.00 | 0.00 |
R429H | -0.08 | -0.14 | -0.19 | 0.37 | 0.14 | -0.50 | 0.40 | 0.03 | -0.43 | 0.26 | 0.00 | 0.00 | 0.00 | -0.19 | -0.20 | -0.07 | 0.00 | 0.00 | 0.00 | 0.00 | 0.25 | 0.00 |
Minimise
For minimise we used a slightly adapted version of the Task7_Hemochromatosis_Protocol#Minimise shell script from the heterochromatisis group.
Gromacs
repairPDB
USAGE: repairPDB <PDB FILE> [<RANGE>] [<CHAIN:] [<CHAIN:RANGE>] [OPTIONS] OPTIONS: [-offset value] offset the residue numbering [-chain char] change Chain ID [-ratom] renumber Atoms [-rres] renumber Residues [-noh] remove hydrogens [-het] do not change HETATM to ATOM for AA [-seq] protein sequence from AA [-seqrs] protein sequence from SEQRES entries [-jprot] just Protein OR [-nohoh] no water OR [-ssw cutoff] print only waters with B-value below cutoff OR [-cleansol] remove overlapping solvent for GROMACS [-dna] print DNA only OR [-nodna] do not print DNA
SCWRL
resulting sequence:
sslddkpqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlklyksmtllntmdril yesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlmyrdyplelfmaqcygnisdlgkgrqmpv hygckerhfvtissplatqipqavgaayaakrananrvvicyfgegaasegdahagfnfaatlecpiiffcrnn gyaistptseqyrgdgiaargpgygimsirvdgndvfavynatkearrravaenqpflieamtyrighhstsdd ssayrsvdevnywdkqdhpisrlrhyllsqgwwdeeqekawrkqsrrkvmeafeqaerkpkpnpnllfsdvyqe mpaqlrkqqeslarhlqtygehypldhfdk