Difference between revisions of "Lab Journal - Task 5 (PAH)"

From Bioinformatikpedia
(Modeller)
Line 2: Line 2:
 
=== Modeller ===
 
=== Modeller ===
 
To use Modeller we follow the [https://i12r-studfilesrv.informatik.tu-muenchen.de/wiki/index.php/Using_Modeller_for_TASK_4 tutorial] written by the students 2011.
 
To use Modeller we follow the [https://i12r-studfilesrv.informatik.tu-muenchen.de/wiki/index.php/Using_Modeller_for_TASK_4 tutorial] written by the students 2011.
First the target sequence must be provided into PIR-format:
+
*First the target sequence must be provided into PIR-format:
  +
<code>
  +
>P1;P00439
  +
sequence:P00439:::::::0.00: 0.00
  +
MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDV
  +
NLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPW
  +
FPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYM
  +
EEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGF
  +
RLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFA
  +
QFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSE
  +
KPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQR
  +
IEVLDNTQQLKILADSINSEIGILCSALQKI*
  +
</code>
  +
 
=== Swissmodel ===
 
=== Swissmodel ===
   

Revision as of 11:06, 5 June 2013

Model calculation

Modeller

To use Modeller we follow the tutorial written by the students 2011.

  • First the target sequence must be provided into PIR-format:

>P1;P00439 sequence:P00439:::::::0.00: 0.00 MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDV NLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPW FPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYM EEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGF RLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFA QFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSE KPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQR IEVLDNTQQLKILADSINSEIGILCSALQKI*

Swissmodel

iTasser

Model evaluation