Homology Based Structure Predictions Hemochromatosis Alignments

From Bioinformatikpedia
Revision as of 12:21, 4 June 2012 by Joerdensv (talk | contribs) (Modeller)

Modeller

1K5NA

simple modeller alignment

>P1;1K5N
structureX:1K5N:   1 :A:+276 :A:MOL_ID  1; MOLECULE  MAJOR HISTOCOMPATIBILITY COMPLEX MOLECULE HLA-B*2 CHAIN  A; FRAGMENT  HLA-B*2709 HEAVY CHAIN, EXTRACELLULAR DOMAIN; SYNONYM  LYMPHOCYTE ANTIGEN HLA-B27; ENGINEERED  YES; MOL_ID  2; MOLECULE  BETA-2-MICROGLOBULIN, LIGHT CHAIN; CHAIN  B; ENGINEERED  YES; MOL_ID  3; MOLECULE  NONAMERIC MODEL PEPTIDE M9; CHAIN  C; ENGINEERED  YES:MOL_ID  1; ORGANISM_SCIENTIFIC  HOMO SAPIENS; ORGANISM_COMMON  HUMAN; ORGANISM_TAXID  9606; GENE  HLA-B OR HLAB; EXPRESSION_SYSTEM  ESCHERICHIA COLI; EXPRESSION_SYSTEM_TAXID  562; MOL_ID  2; ORGANISM_SCIENTIFIC  HOMO SAPIENS; ORGANISM_COMMON  HUMAN; ORGANISM_TAXID  9606; GENE  B2M; EXPRESSION_SYSTEM  ESCHERICHIA COLI; EXPRESSION_SYSTEM_TAXID  562; MOL_ID  3; SYNTHETIC  YES; OTHER_DETAILS  THIS PEPTIDE WAS CHEMICALLY SYNTHESISED.: 1.09: 0.12
-------------------------GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAP
WIEQE-GPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQHAYDGKDYI
ALNEDLSSWTAADTAAQITQRKWEAARV-AEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
ATLRCWALGFYPAEITLTWQRDGED-QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTL
RWEP-------------------------------------------------*
>P1;Q30201
sequence:Q30201:     : :     : ::: 0.00: 0.00
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHE--SRRVEPRTP
WVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKE-SHTLQVILGCEMQEDNST-EGYWKYGYDGQDHL
EFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHH-VTSSV
TTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIV
IWEPSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*


2d modeller alignment

>P1;1K5N
structureX:1K5N:   1 :A:+276 :A:MOL_ID  1; MOLECULE  MAJOR HISTOCOMPATIBILITY COMPLEX MOLECULE HLA-B*2 CHAIN  A; FRAGMENT  HLA-B*2709 HEAVY CHAIN, EXTRACELLULAR DOMAIN; SYNONYM  LYMPHOCYTE ANTIGEN HLA-B27; ENGINEERED  YES; MOL_ID  2; MOLECULE  BETA-2-MICROGLOBULIN, LIGHT CHAIN; CHAIN  B; ENGINEERED  YES; MOL_ID  3; MOLECULE  NONAMERIC MODEL PEPTIDE M9; CHAIN  C; ENGINEERED  YES:MOL_ID  1; ORGANISM_SCIENTIFIC  HOMO SAPIENS; ORGANISM_COMMON  HUMAN; ORGANISM_TAXID  9606; GENE  HLA-B OR HLAB; EXPRESSION_SYSTEM  ESCHERICHIA COLI; EXPRESSION_SYSTEM_TAXID  562; MOL_ID  2; ORGANISM_SCIENTIFIC  HOMO SAPIENS; ORGANISM_COMMON  HUMAN; ORGANISM_TAXID  9606; GENE  B2M; EXPRESSION_SYSTEM  ESCHERICHIA COLI; EXPRESSION_SYSTEM_TAXID  562; MOL_ID  3; SYNTHETIC  YES; OTHER_DETAILS  THIS PEPTIDE WAS CHEMICALLY SYNTHESISED.: 1.09: 0.12
-G------------------------SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAP
WIE-QEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQHAYDGKDYI
ALNEDLSSWTAADTAAQITQRKWEAARV-AEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
ATLRCWALGFYPAEITLTWQRDGEDQT-QDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTL
RWEP-------------------------------------------------*
>P1;Q30201
sequence:Q30201:     : :     : ::: 0.00: 0.00
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYD--HESRRVEPRTP
WVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSK-ESHTLQVILGCEMQEDNS-TEGYWKYGYDGQDHL
EFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSS-V
TTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIV
IWEPSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*

1ZS8A

simple modeller alignment

>P1;1ZS8
structureX:1ZS8:   1 :A:+261 :A:MOL_ID  1; MOLECULE  HISTOCOMPATIBILITY 2, M REGION LOCUS 10.5; CHAIN  A, C, E, G, I; ENGINEERED  YES; MOL_ID  2; MOLECULE  BETA-2-MICROGLOBULIN; CHAIN  B, D, F, H, J; ENGINEERED  YES:MOL_ID  1; ORGANISM_SCIENTIFIC  MUS MUSCULUS; ORGANISM_COMMON  HOUSE MOUSE; ORGANISM_TAXID  10090; GENE  M10.5; EXPRESSION_SYSTEM  TRICHOPLUSIA NI; EXPRESSION_SYSTEM_COMMON  CABBAGE LOOPER; EXPRESSION_SYSTEM_TAXID  7111; EXPRESSION_SYSTEM_STRAIN  TN5; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS; EXPRESSION_SYSTEM_PLASMID  PACUW31; MOL_ID  2; ORGANISM_SCIENTIFIC  HOMO SAPIENS; ORGANISM_COMMON  HUMAN; ORGANISM_TAXID  9606; GENE  B2M; EXPRESSION_SYSTEM  TRICHOPLUSIA NI; EXPRESSION_SYSTEM_COMMON  CABBAGE LOOPER; EXPRESSION_SYSTEM_TAXID  7111; EXPRESSION_SYSTEM_STRAIN  TN5; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS; EXPRESSION_SYSTEM_PLASMID  PACUW31: 3.00: 0.31
--------------------------SHWLKTFRIVIMEPGILEPRFIQVSYVDSIQYQGFDSRSG-MQPRAAWM
KQEPPEYWKNETEHAMGASLLARRTLIYMVTENNNKKNDYHTLQEVFGCNVAHDGSFLGGHYGLTYYGYDYIILN
EDLNSWTTEGKVG-------GKFNSVTEGWRTYLKGECTERFLRCLDLGKETLLRSDAPRTHVTHKVT---VTLR
CWALGFYPADITLTWKRDGKN-HTQDMELPDTRPAGDGTFQKWAAVVVPFGEELRYTCHVHHEGLPGPLTLKWG-
-------------------------------------------------*
>P1;Q30201
sequence:Q30201:     : :     : ::: 0.00: 0.00
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWV
SSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNS-TEGYWKYGYDGQDHLEFC
PDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLR
CRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEP
SPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*


2d modeller alignment

>P1;1ZS8
structureX:1ZS8:   1 :A:+261 :A:MOL_ID  1; MOLECULE  HISTOCOMPATIBILITY 2, M REGION LOCUS 10.5; CHAIN  A, C, E, G, I; ENGINEERED  YES; MOL_ID  2; MOLECULE  BETA-2-MICROGLOBULIN; CHAIN  B, D, F, H, J; ENGINEERED  YES:MOL_ID  1; ORGANISM_SCIENTIFIC  MUS MUSCULUS; ORGANISM_COMMON  HOUSE MOUSE; ORGANISM_TAXID  10090; GENE  M10.5; EXPRESSION_SYSTEM  TRICHOPLUSIA NI; EXPRESSION_SYSTEM_COMMON  CABBAGE LOOPER; EXPRESSION_SYSTEM_TAXID  7111; EXPRESSION_SYSTEM_STRAIN  TN5; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS; EXPRESSION_SYSTEM_PLASMID  PACUW31; MOL_ID  2; ORGANISM_SCIENTIFIC  HOMO SAPIENS; ORGANISM_COMMON  HUMAN; ORGANISM_TAXID  9606; GENE  B2M; EXPRESSION_SYSTEM  TRICHOPLUSIA NI; EXPRESSION_SYSTEM_COMMON  CABBAGE LOOPER; EXPRESSION_SYSTEM_TAXID  7111; EXPRESSION_SYSTEM_STRAIN  TN5; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS; EXPRESSION_SYSTEM_PLASMID  PACUW31: 3.00: 0.31
--------SHWLKTFRIVIMEPGIL-------------E-----PRFIQVSYVDSIQYQGFDSRS-GMQPRAAWM
KQE-PPEYWKNETEHAMGASLLARRTLIYMVTENNNKKNDYHTLQEVFGCNVAHDGSFLGGHYGLTYYGYDYIIL
NEDLNSWTTEG------KVG-GKFNSVTEGWRTYLKGECTERFLRCLDLGKETLLRSDAPRTHVTHKVT---VTL
RCWALGFYPADITLTWKRDGKN-HTQDMELPDTRPAGDGTFQKWAAVVVPFGEELRYTCHVHHEGLPGPL-----
-----TLKWG----------------------------------------*
>P1;Q30201
sequence:Q30201:     : :     : ::: 0.00: 0.00
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWV
SSRISSQMWLQLSQSLKGWDHMFTVDF-WTIMENHNHSKESHTLQVILGCEMQEDNS-TEGYWKYGYDGQDHLEF
CPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTL
RCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWE
PSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*


2IADB

simple modeller alignment

>P1;2IAD
structureX:2IAD:   2S:B:+201 :B:MOL_ID  1; MOLECULE  MHC CLASS II I-AD; CHAIN  A; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B ARE COVALENTLY LI INFLUENZA HEMAGGLUTININ PEPTIDE; ENGINEERED  YES; MOL_ID  2; MOLECULE  MHC CLASS II I-AD; CHAIN  B; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B ARE COVALENTLY LI INFLUENZA HEMAGGLUTININ PEPTIDE; ENGINEERED  YES:MOL_ID  1; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B; ORGANISM_SCIENTIFIC  MUS MUSCULUS; ORGANISM_COMMON  HOUSE MOUSE; ORGANISM_TAXID  10090; STRAIN  BALB-C; CELL_LINE  S2; ORGAN  TAIL; EXPRESSION_SYSTEM  DROSOPHILA MELANOGASTER; EXPRESSION_SYSTEM_COMMON  FRUIT FLY; EXPRESSION_SYSTEM_TAXID  7227; EXPRESSION_SYSTEM_CELL_LINE  S2; MOL_ID  2; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B; ORGANISM_SCIENTIFIC  MUS MUSCULUS; ORGANISM_COMMON  HOUSE MOUSE; ORGANISM_TAXID  10090; STRAIN  BALB/C; CELL_LINE  S2; ORGAN  TAIL; EXPRESSION_SYSTEM  DROSOPHILA MELANOGASTER; EXPRESSION_SYSTEM_COMMON  FRUIT FLY; EXPRESSION_SYSTEM_TAXID  7227; EXPRESSION_SYSTEM_CELL_LINE  S2: 2.40: 0.25
---------------GHATQGVTAASSHERHFVVQFKGE-------------------CYYTNGTQRIRLVT---
-------------------------------------------------------------RYIYNREEYVRYDS
DVGEYRAVTELGRPDAEYWNSQPEILERTRAEVDTACRHNYEGPETSTSLRRLEQPNVAISLSRTEALNHHNTLV
CSVTDFYPAKIKVRWFRNGQE-ETVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSLKSPITVEWSS
-------------------------------------------------*
>P1;Q30201
sequence:Q30201:     : :     : ::: 0.00: 0.00
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWV
SSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCP
DTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQL-LELGRGVLDQQVPPLVKVTHHVTSSVTTLR
CRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEP
SPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*

2d modeller alignment

>P1;2IAD
structureX:2IAD:   2S:B:+201 :B:MOL_ID  1; MOLECULE  MHC CLASS II I-AD; CHAIN  A; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B ARE COVALENTLY LI INFLUENZA HEMAGGLUTININ PEPTIDE; ENGINEERED  YES; MOL_ID  2; MOLECULE  MHC CLASS II I-AD; CHAIN  B; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B ARE COVALENTLY LI INFLUENZA HEMAGGLUTININ PEPTIDE; ENGINEERED  YES:MOL_ID  1; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B; ORGANISM_SCIENTIFIC  MUS MUSCULUS; ORGANISM_COMMON  HOUSE MOUSE; ORGANISM_TAXID  10090; STRAIN  BALB-C; CELL_LINE  S2; ORGAN  TAIL; EXPRESSION_SYSTEM  DROSOPHILA MELANOGASTER; EXPRESSION_SYSTEM_COMMON  FRUIT FLY; EXPRESSION_SYSTEM_TAXID  7227; EXPRESSION_SYSTEM_CELL_LINE  S2; MOL_ID  2; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B; ORGANISM_SCIENTIFIC  MUS MUSCULUS; ORGANISM_COMMON  HOUSE MOUSE; ORGANISM_TAXID  10090; STRAIN  BALB/C; CELL_LINE  S2; ORGAN  TAIL; EXPRESSION_SYSTEM  DROSOPHILA MELANOGASTER; EXPRESSION_SYSTEM_COMMON  FRUIT FLY; EXPRESSION_SYSTEM_TAXID  7227; EXPRESSION_SYSTEM_CELL_LINE  S2: 2.40: 0.25
-G-HATQGV-------TAA------SSHERH--F---------VVQFKGECYYTN--------GTQRIRLVTRYI
YNR---EEYVRYDSDV-G-------EYRAVTE--------------LG------RPDAEYWNSQ----------P
EILERTRAEVD---T---ACRHNYEGPETSTSLRR--LEQPNVAISLSR------TEAL---NHH-----NTLVC
SVTDFYPAKIKVRWFRNGQE-ETVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSLKSPITVEW--S
-S----------------------------------------------*
>P1;Q30201
sequence:Q30201:     : :     : ::: 0.00: 0.00
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWV
SSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCP
DTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRC
RALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPS
PSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*

3DBXA

simple modeller alignment

>P1;3DBX
structureX:3DBX:   7 :A:+279 :A:MOL_ID  1; MOLECULE  CD1-2 ANTIGEN; CHAIN  A; FRAGMENT  ECTODOMAIN OF CHICKEN CD1-2, UNP RESIDUES 20-302; ENGINEERED  YES; MOL_ID  2; MOLECULE  BETA-2-MICROGLOBULIN; CHAIN  B; SYNONYM  BETA-2-MICROGLOBULIN FORM PI 5.3; ENGINEERED  YES:MOL_ID  1; ORGANISM_SCIENTIFIC  GALLUS GALLUS; ORGANISM_COMMON  CHICKEN; ORGANISM_TAXID  9031; GENE  CD1-2; EXPRESSION_SYSTEM  SPODOPTERA FRUGIPERDA; EXPRESSION_SYSTEM_TAXID  7108; EXPRESSION_SYSTEM_STRAIN  SF9; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS SHUTTLE VECTOR; EXPRESSION_SYSTEM_PLASMID  PBACPHP10; MOL_ID  2; ORGANISM_SCIENTIFIC  HOMO SAPIENS; ORGANISM_COMMON  HUMAN; ORGANISM_TAXID  9606; GENE  B2M, CDABP0092, HDCMA22P; EXPRESSION_SYSTEM  SPODOPTERA FRUGIPERDA; EXPRESSION_SYSTEM_TAXID  7108; EXPRESSION_SYSTEM_STRAIN  SF9; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS SHUTTLE VECTOR; EXPRESSION_SYSTEM_PLASMID  PBACPHP10: 2.00: 0.22
PEESQFFQLFYTLLLGNV------------------SSTELTGMAL------LADVPIMVLDPHTWNLNICRPWV
QE-ITAETEVKKILSFSMVGIRNTIRFMHEMTAKAGLDYPRVFQIHTGCKLYTNGTRWSFVNIGEGGRDLVTYEL
SRERWVPQRSTLLAKVMSNTLTDLRAVSGFLEHIFSSSFPNYILMLHEEGRTDLERRVPPMAVVFARTAGQVQLL
LVCRVTSFYPRPIAVTWLRDGREVPPSPALSTGTVLPNADLTYQLRSTLLVSPQDGHGYACRVQHCSLGDRSLLV
PW-------------------------------------------------HH*
>P1;Q30201
sequence:Q30201:     : :     : ::: 0.00: 0.00
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWV
SSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCP
DTLDWRAAEPRAWPTKLEWERHKIRARQN--RAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTL
R-CRALNYYPQNITMKWLKDKQPMDAK-EFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGL-DQPLIV
IWEPSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*

2d modeller alignment

>P1;3DBX
structureX:3DBX:   7 :A:+279 :A:MOL_ID  1; MOLECULE  CD1-2 ANTIGEN; CHAIN  A; FRAGMENT  ECTODOMAIN OF CHICKEN CD1-2, UNP RESIDUES 20-302; ENGINEERED  YES; MOL_ID  2; MOLECULE  BETA-2-MICROGLOBULIN; CHAIN  B; SYNONYM  BETA-2-MICROGLOBULIN FORM PI 5.3; ENGINEERED  YES:MOL_ID  1; ORGANISM_SCIENTIFIC  GALLUS GALLUS; ORGANISM_COMMON  CHICKEN; ORGANISM_TAXID  9031; GENE  CD1-2; EXPRESSION_SYSTEM  SPODOPTERA FRUGIPERDA; EXPRESSION_SYSTEM_TAXID  7108; EXPRESSION_SYSTEM_STRAIN  SF9; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS SHUTTLE VECTOR; EXPRESSION_SYSTEM_PLASMID  PBACPHP10; MOL_ID  2; ORGANISM_SCIENTIFIC  HOMO SAPIENS; ORGANISM_COMMON  HUMAN; ORGANISM_TAXID  9606; GENE  B2M, CDABP0092, HDCMA22P; EXPRESSION_SYSTEM  SPODOPTERA FRUGIPERDA; EXPRESSION_SYSTEM_TAXID  7108; EXPRESSION_SYSTEM_STRAIN  SF9; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS SHUTTLE VECTOR; EXPRESSION_SYSTEM_PLASMID  PBACPHP10: 2.00: 0.22
------PEESQFFQLFYTLLLGNV--S----------STELTGMALLA-----DVPIMVLDPH-TWNLNICRPWV
Q-EITAETEVKKILSFSMVGIRNTIRFMHEMTAKAGLDYPRVFQIHTGCKLYTNGTRWSFVNIGEGGRDLVTYEL
SRERWVPQRSTLLAKVMSNTLTDLRAVSGFLEHIFSSSFPNYILMLHEEGRTDLERRVPPMAVVFARTAGQVQLL
LVCRVTSFYPRPIAVTWLRDGREVPPSPALSTGTVLPNADLTYQLRSTLLVSPQDGHGYACRVQHCSLGDRSLLV
PWH------------------------------------------H-------
>P1;Q30201
sequence:Q30201:     : :     : ::: 0.00: 0.00
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWV
SSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCP
DTLDWRAAEPRAWPTKLEWERHKIRARQN--RAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSV-TT
LRCRALNYYPQNITMKWLKDKQPMD-AKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGL-DQPLIV
IWEPSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*

MSA1

>P1;1K5NA
structureX:1K5N:1    :A:+276 :A:MOL_ID  1; MOLECULE  MAJOR HISTOCOMPATIBILITY COMPLEX MOLECULE HLA-B*2 CHAIN  A; FRAGMENT  HLA-B*2709 HEAVY CHAIN, EXTRACELLULAR DOMAIN; SYNONYM  LYMPHOCYTE ANTIGEN HLA-B27; ENGINEERED  YES; MOL_ID  2; MOLECULE  BETA-2-MICROGLOBULIN, LIGHT CHAIN; CHAIN  B; ENGINEERED  YES; MOL_ID  3; MOLECULE  NONAMERIC MODEL PEPTIDE M9; CHAIN  C; ENGINEERED  YES:MOL_ID  1; ORGANISM_SCIENTIFIC  HOMO SAPIENS; ORGANISM_COMMON  HUMAN; ORGANISM_TAXID  9606; GENE  HLA-B OR HLAB; EXPRESSION_SYSTEM  ESCHERICHIA COLI; EXPRESSION_SYSTEM_TAXID  562; MOL_ID  2; ORGANISM_SCIENTIFIC  HOMO SAPIENS; ORGANISM_COMMON  HUMAN; ORGANISM_TAXID  9606; GENE  B2M; EXPRESSION_SYSTEM  ESCHERICHIA COLI; EXPRESSION_SYSTEM_TAXID  562; MOL_ID  3; SYNTHETIC  YES; OTHER_DETAILS  THIS PEPTIDE WAS CHEMICALLY SYNTHESISED.: 1.09: 0.12
GSHSMRYFHTSVSRPGRGE-----------------------PRFITVGYVDDTLFVRFDSDAASPREEPRAPWI
EQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQHAYDGKDYIALN
EDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLR
CWALGFYPAEITLTWQRDGEDQ--TQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGL-PKPLT---
---------------------------------------------LRWEP*
>P1;1ZS8A
structureX:1ZS8:1    :A:+261 :A:MOL_ID  1; MOLECULE  HISTOCOMPATIBILITY 2, M REGION LOCUS 10.5; CHAIN  A, C, E, G, I; ENGINEERED  YES; MOL_ID  2; MOLECULE  BETA-2-MICROGLOBULIN; CHAIN  B, D, F, H, J; ENGINEERED  YES:MOL_ID  1; ORGANISM_SCIENTIFIC  MUS MUSCULUS; ORGANISM_COMMON  HOUSE MOUSE; ORGANISM_TAXID  10090; GENE  M10.5; EXPRESSION_SYSTEM  TRICHOPLUSIA NI; EXPRESSION_SYSTEM_COMMON  CABBAGE LOOPER; EXPRESSION_SYSTEM_TAXID  7111; EXPRESSION_SYSTEM_STRAIN  TN5; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS; EXPRESSION_SYSTEM_PLASMID  PACUW31; MOL_ID  2; ORGANISM_SCIENTIFIC  HOMO SAPIENS; ORGANISM_COMMON  HUMAN; ORGANISM_TAXID  9606; GENE  B2M; EXPRESSION_SYSTEM  TRICHOPLUSIA NI; EXPRESSION_SYSTEM_COMMON  CABBAGE LOOPER; EXPRESSION_SYSTEM_TAXID  7111; EXPRESSION_SYSTEM_STRAIN  TN5; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS; EXPRESSION_SYSTEM_PLASMID  PACUW31: 3.00: 0.31
-SHWLKTFRIVIMEPGILE-----------------------PRFIQVSYVDSIQYQGFDSRSGM---QPRAAWM
KQEPPEYWKNETEHAMGASLLARRTLIYMVTENNNKKNDYHTLQEVFGCNVAHDGSFLGGHYGLTYYGYDYIILN
EDLNSWTTEGKVGG------KFNSVTEGWRTYLKGECTERFLRCLDLGKETLLRSDAPRTHVTHKV----TVTLR
CWALGFYPADITLTWKRDGKNH--TQDMELPDTRPAGDGTFQKWAAVVVPFGEELRYTCHVHHEGL-PGPLT---
---------------------------------------------LKWG-*
>P1;2IADB
structureX:2IAD:2S   :B:+201 :B:MOL_ID  1; MOLECULE  MHC CLASS II I-AD; CHAIN  A; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B ARE COVALENTLY LI INFLUENZA HEMAGGLUTININ PEPTIDE; ENGINEERED  YES; MOL_ID  2; MOLECULE  MHC CLASS II I-AD; CHAIN  B; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B ARE COVALENTLY LI INFLUENZA HEMAGGLUTININ PEPTIDE; ENGINEERED  YES:MOL_ID  1; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B; ORGANISM_SCIENTIFIC  MUS MUSCULUS; ORGANISM_COMMON  HOUSE MOUSE; ORGANISM_TAXID  10090; STRAIN  BALB-C; CELL_LINE  S2; ORGAN  TAIL; EXPRESSION_SYSTEM  DROSOPHILA MELANOGASTER; EXPRESSION_SYSTEM_COMMON  FRUIT FLY; EXPRESSION_SYSTEM_TAXID  7227; EXPRESSION_SYSTEM_CELL_LINE  S2; MOL_ID  2; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B; ORGANISM_SCIENTIFIC  MUS MUSCULUS; ORGANISM_COMMON  HOUSE MOUSE; ORGANISM_TAXID  10090; STRAIN  BALB/C; CELL_LINE  S2; ORGAN  TAIL; EXPRESSION_SYSTEM  DROSOPHILA MELANOGASTER; EXPRESSION_SYSTEM_COMMON  FRUIT FLY; EXPRESSION_SYSTEM_TAXID  7227; EXPRESSION_SYSTEM_CELL_LINE  S2: 2.40: 0.25
GHATQGVTAASSHERHFVV-----------------------QFKGECYYTNGTQRIRLVTRYIY----------
NREEYVRYDSDVGEYRAVTELGRPDAEYWNSQ-------------------------------------------
----------------------PEILERTRAEVDTACRHNYEGPETSTSLRRLEQPNVAISLSRTEALNHHNTLV
CSVTDFYPAKIKVRWFRNGQEE--TVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSL-KSPIT---
---------------------------------------------VEWSS*
>P1;3DBXA
structureX:3DBX:7    :A:+279 :A:MOL_ID  1; MOLECULE  CD1-2 ANTIGEN; CHAIN  A; FRAGMENT  ECTODOMAIN OF CHICKEN CD1-2, UNP RESIDUES 20-302; ENGINEERED  YES; MOL_ID  2; MOLECULE  BETA-2-MICROGLOBULIN; CHAIN  B; SYNONYM  BETA-2-MICROGLOBULIN FORM PI 5.3; ENGINEERED  YES:MOL_ID  1; ORGANISM_SCIENTIFIC  GALLUS GALLUS; ORGANISM_COMMON  CHICKEN; ORGANISM_TAXID  9031; GENE  CD1-2; EXPRESSION_SYSTEM  SPODOPTERA FRUGIPERDA; EXPRESSION_SYSTEM_TAXID  7108; EXPRESSION_SYSTEM_STRAIN  SF9; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS SHUTTLE VECTOR; EXPRESSION_SYSTEM_PLASMID  PBACPHP10; MOL_ID  2; ORGANISM_SCIENTIFIC  HOMO SAPIENS; ORGANISM_COMMON  HUMAN; ORGANISM_TAXID  9606; GENE  B2M, CDABP0092, HDCMA22P; EXPRESSION_SYSTEM  SPODOPTERA FRUGIPERDA; EXPRESSION_SYSTEM_TAXID  7108; EXPRESSION_SYSTEM_STRAIN  SF9; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS SHUTTLE VECTOR; EXPRESSION_SYSTEM_PLASMID  PBACPHP10: 2.00: 0.22
PEESQFFQLFYTLLLGNVS-----------------------STELTGMALLADVPIMVLDPHTWNLNICRPWVQ
EITAETEVKKILSFSMVGIRNTIRFMHEMTAKAGLDYPRVFQIHTGCKLYTNGTRWSFVNIGEGGRDLVTYELSR
ERWVPQRSTLLAKVMSNTLTDLRAVSGFLEHIFSSSFPNYILMLHEEGRTDLERRVPPMAVVFARTAGQVQLLLV
CRVTSFYPRPIAVTWLRDGREVPPSPALSTGTVLPNADLTYQLRSTLLVSPQDGHGYACRVQHCSLGDRSLL---
---------------------------------------------VPWHH* 
>P1;Q30201
sequence:Q30201:     : :     : ::: 0.00: 0.00
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWV
SSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCP
DTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVT-TLR
CRALNYYPQNITMKWLKDKQPMD-AKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWE
PSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*

MSA2

>P1;1ZS8A
structureX:1ZS8:1    :A:+261 :A:MOL_ID  1; MOLECULE  HISTOCOMPATIBILITY 2, M REGION LOCUS 10.5; CHAIN  A, C, E, G, I; ENGINEERED  YES; MOL_ID  2; MOLECULE  BETA-2-MICROGLOBULIN; CHAIN  B, D, F, H, J; ENGINEERED  YES:MOL_ID  1; ORGANISM_SCIENTIFIC  MUS MUSCULUS; ORGANISM_COMMON  HOUSE MOUSE; ORGANISM_TAXID  10090; GENE  M10.5; EXPRESSION_SYSTEM  TRICHOPLUSIA NI; EXPRESSION_SYSTEM_COMMON  CABBAGE LOOPER; EXPRESSION_SYSTEM_TAXID  7111; EXPRESSION_SYSTEM_STRAIN  TN5; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS; EXPRESSION_SYSTEM_PLASMID  PACUW31; MOL_ID  2; ORGANISM_SCIENTIFIC  HOMO SAPIENS; ORGANISM_COMMON  HUMAN; ORGANISM_TAXID  9606; GENE  B2M; EXPRESSION_SYSTEM  TRICHOPLUSIA NI; EXPRESSION_SYSTEM_COMMON  CABBAGE LOOPER; EXPRESSION_SYSTEM_TAXID  7111; EXPRESSION_SYSTEM_STRAIN  TN5; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS; EXPRESSION_SYSTEM_PLASMID  PACUW31: 3.00: 0.31
SHWLKTFRI--VIMEPGILEPRFIQVSYVDSIQYQGFDSRSGMQPRAAWMK----QEPPEYWKNETEHAMGASLL
ARRTLIYMVTENNNKKNDYHTLQEVFGCNVAHDGSFL-------------------------GGHYGLTYYGYDY
IILNEDLNSWTTEGKVGGKFNSVTEGWRTYLKGECTERFLRCLDLGKETLLRSDAPRTHV-----THKVTVTLRC
WALGFYPADITLTWKRDGKN--HTQDMELPDTRPAGDGTFQKWAAVVVPFGEELRYTCHVHHEGLPG-PLT----
--------------------------------------------LKWG-*
>P1;2IADB
structureX:2IAD:2S   :B:+201 :B:MOL_ID  1; MOLECULE  MHC CLASS II I-AD; CHAIN  A; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B ARE COVALENTLY LI INFLUENZA HEMAGGLUTININ PEPTIDE; ENGINEERED  YES; MOL_ID  2; MOLECULE  MHC CLASS II I-AD; CHAIN  B; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B ARE COVALENTLY LI INFLUENZA HEMAGGLUTININ PEPTIDE; ENGINEERED  YES:MOL_ID  1; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B; ORGANISM_SCIENTIFIC  MUS MUSCULUS; ORGANISM_COMMON  HOUSE MOUSE; ORGANISM_TAXID  10090; STRAIN  BALB-C; CELL_LINE  S2; ORGAN  TAIL; EXPRESSION_SYSTEM  DROSOPHILA MELANOGASTER; EXPRESSION_SYSTEM_COMMON  FRUIT FLY; EXPRESSION_SYSTEM_TAXID  7227; EXPRESSION_SYSTEM_CELL_LINE  S2; MOL_ID  2; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B; ORGANISM_SCIENTIFIC  MUS MUSCULUS; ORGANISM_COMMON  HOUSE MOUSE; ORGANISM_TAXID  10090; STRAIN  BALB/C; CELL_LINE  S2; ORGAN  TAIL; EXPRESSION_SYSTEM  DROSOPHILA MELANOGASTER; EXPRESSION_SYSTEM_COMMON  FRUIT FLY; EXPRESSION_SYSTEM_TAXID  7227; EXPRESSION_SYSTEM_CELL_LINE  S2: 2.40: 0.25
GHATQG-------VTAASSHERHFVVQFKGECYYTNGTQRIRLVTRYIYNR----EEYVRYDSDVGEYRAVTEL-
---------------------------------------------------------------GRPDAEYWNSQP
EILERTRAEVDTACRHNYEGPETSTSLRRLEQPNVAISLSRTEALNHHN----------------------TLVC
SVTDFYPAKIKVRWFRNGQE--ETVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSLKS-PIT----
--------------------------------------------VEWSS*
>P1;3DBXA
structureX:3DBX:7    :A:+279 :A:MOL_ID  1; MOLECULE  CD1-2 ANTIGEN; CHAIN  A; FRAGMENT  ECTODOMAIN OF CHICKEN CD1-2, UNP RESIDUES 20-302; ENGINEERED  YES; MOL_ID  2; MOLECULE  BETA-2-MICROGLOBULIN; CHAIN  B; SYNONYM  BETA-2-MICROGLOBULIN FORM PI 5.3; ENGINEERED  YES:MOL_ID  1; ORGANISM_SCIENTIFIC  GALLUS GALLUS; ORGANISM_COMMON  CHICKEN; ORGANISM_TAXID  9031; GENE  CD1-2; EXPRESSION_SYSTEM  SPODOPTERA FRUGIPERDA; EXPRESSION_SYSTEM_TAXID  7108; EXPRESSION_SYSTEM_STRAIN  SF9; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS SHUTTLE VECTOR; EXPRESSION_SYSTEM_PLASMID  PBACPHP10; MOL_ID  2; ORGANISM_SCIENTIFIC  HOMO SAPIENS; ORGANISM_COMMON  HUMAN; ORGANISM_TAXID  9606; GENE  B2M, CDABP0092, HDCMA22P; EXPRESSION_SYSTEM  SPODOPTERA FRUGIPERDA; EXPRESSION_SYSTEM_TAXID  7108; EXPRESSION_SYSTEM_STRAIN  SF9; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS SHUTTLE VECTOR; EXPRESSION_SYSTEM_PLASMID  PBACPHP10: 2.00: 0.22
PEESQFFQLFYTLLLGNVSSTELTGMALLADVPIMVLDPHTWNLNICRPWV----QEITAETEVKKILSFSMVGI
RNTIRFMHEMTAKAGLDYPRVFQIHTGCKLYTNGTRW------------------SFVNIGEGGRDLVTYELSRE
RWVPQRSTLLAKVMSNTLTDLRAVSGFLEHIFSSSFPNYILMLHEEGRTDLERRVPPMAVVFARTAGQVQLLLVC
RVTSFYPRPIAVTWLRDGREVPPSPALSTGTVLPNADLTYQLRSTLLVSPQDGHGYACRVQHCSLGDRSLL----
--------------------------------------------VPWHH*
>P1;Q30201
sequence:Q30201:     : :     : ::: 0.00: 0.00
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWV
SSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCP
DTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRC
RALNYYPQNITMKWLKDKQPM-DAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEP
SPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*

MSA3

>P1;2IADB
structureX:2IAD:2S   :B:+201 :B:MOL_ID  1; MOLECULE  MHC CLASS II I-AD; CHAIN  A; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B ARE COVALENTLY LI INFLUENZA HEMAGGLUTININ PEPTIDE; ENGINEERED  YES; MOL_ID  2; MOLECULE  MHC CLASS II I-AD; CHAIN  B; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B ARE COVALENTLY LI INFLUENZA HEMAGGLUTININ PEPTIDE; ENGINEERED  YES:MOL_ID  1; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B; ORGANISM_SCIENTIFIC  MUS MUSCULUS; ORGANISM_COMMON  HOUSE MOUSE; ORGANISM_TAXID  10090; STRAIN  BALB-C; CELL_LINE  S2; ORGAN  TAIL; EXPRESSION_SYSTEM  DROSOPHILA MELANOGASTER; EXPRESSION_SYSTEM_COMMON  FRUIT FLY; EXPRESSION_SYSTEM_TAXID  7227; EXPRESSION_SYSTEM_CELL_LINE  S2; MOL_ID  2; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B; ORGANISM_SCIENTIFIC  MUS MUSCULUS; ORGANISM_COMMON  HOUSE MOUSE; ORGANISM_TAXID  10090; STRAIN  BALB/C; CELL_LINE  S2; ORGAN  TAIL; EXPRESSION_SYSTEM  DROSOPHILA MELANOGASTER; EXPRESSION_SYSTEM_COMMON  FRUIT FLY; EXPRESSION_SYSTEM_TAXID  7227; EXPRESSION_SYSTEM_CELL_LINE  S2: 2.40: 0.25
GHATQGVTAASSHERHFVV-------------QFKGECYYTNGTQRIRLVTRYIYNREEYVRYDSDVGEYRAVTE
LGRPDAEYWN------------------------------------SQPEILERTRAEVDTACRHNYE-------
--GPETSTSLRRLEQPNVAISLSRTEALNH---------------------------------------HNTLVC
SVTDFYPAKIKVRWFRNGQE--ETVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSLKS-PITV---
---------------------------------------------EWSS*
>P1;3DBXA
structureX:3DBX:7    :A:+279 :A:MOL_ID  1; MOLECULE  CD1-2 ANTIGEN; CHAIN  A; FRAGMENT  ECTODOMAIN OF CHICKEN CD1-2, UNP RESIDUES 20-302; ENGINEERED  YES; MOL_ID  2; MOLECULE  BETA-2-MICROGLOBULIN; CHAIN  B; SYNONYM  BETA-2-MICROGLOBULIN FORM PI 5.3; ENGINEERED  YES:MOL_ID  1; ORGANISM_SCIENTIFIC  GALLUS GALLUS; ORGANISM_COMMON  CHICKEN; ORGANISM_TAXID  9031; GENE  CD1-2; EXPRESSION_SYSTEM  SPODOPTERA FRUGIPERDA; EXPRESSION_SYSTEM_TAXID  7108; EXPRESSION_SYSTEM_STRAIN  SF9; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS SHUTTLE VECTOR; EXPRESSION_SYSTEM_PLASMID  PBACPHP10; MOL_ID  2; ORGANISM_SCIENTIFIC  HOMO SAPIENS; ORGANISM_COMMON  HUMAN; ORGANISM_TAXID  9606; GENE  B2M, CDABP0092, HDCMA22P; EXPRESSION_SYSTEM  SPODOPTERA FRUGIPERDA; EXPRESSION_SYSTEM_TAXID  7108; EXPRESSION_SYSTEM_STRAIN  SF9; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS SHUTTLE VECTOR; EXPRESSION_SYSTEM_PLASMID  PBACPHP10: 2.00: 0.22
PEESQFFQLFYTLLLGNVS-------------STELTGMALLADVPIMVLDPHTWNLNICRPWVQEITAETEVKK
ILSFSMVGIRNTIRFMHEMTAKAGLDYPRVFQIHTGCKLYTNGTRWSFVNIGEGGRDLVTYELSRERW-------
--VPQRSTLLAKVMSNTLTDLRAVSGFLEHIFSSSFPNYILMLHEEGRTDLERRVPPMAVVFARTAGQVQLLLVC
RVTSFYPRPIAVTWLRDGREVPPSPALSTGTVLPNADLTYQLRSTLLVSPQDGHGYACRVQHCSLGDRSLLV---
---------------------------------------------PWHH*
>P1;Q30201
sequence:Q30201:     : :     : ::: 0.00: 0.00
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWV
SSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCP
DTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRC
RALNYYPQNITMKWLKDKQPM-DAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEP
SPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*


SwissModel


1k5nA

TARGET    1       RSHSLHYL FMGASEQDLG LSLFEALGYV DDQLFVFYDH ES--RRVEPR
1k5nA     1       gshsmryf htsvsrpgrg eprfitvgyv ddtlfvrfds daaspreepr
                                                                      
TARGET              ssssss sssss        ssssssss s ssssssss        sss
1k5nA               ssssss sssss        ssssssss s ssssssss        sss


TARGET    47    TPWVSSRISS QMWLQLSQSL KGWDHMFTVD FWTIMENHNH S-KESHTLQV
1k5nA     49    apwie-qegp eywdretqic kakaqtdred lrtllryynq seagshtlqn
                                                                      
TARGET            hhh      hhhhhhhhhh hhhhhhhhhh hhhhhhhh        sssss
1k5nA             hhh      hhhhhhhhhh hhhhhhhhhh hhhhhhhh        sssss


TARGET    96    ILGCEMQEDN S-TEGYWKYG YDGQDHLEFC PDTLDWRAAE PRAWPTKLEW
1k5nA     98    mygcdvgpdg rllrgyhqha ydgkdyialn edlsswtaad taaqitqrkw
                                                                      
TARGET          sssssss  s s ssssssss ss sssssss     sssss  hhhhhhhhhh
1k5nA           ssssss        sssssss ss sssssss     sssss  hhhhhhhhhh


TARGET    145   ERHKIRARQN RAYLERDCPA QLQQLLELGR GVLDQQVPPL VKVTHHV-TS
1k5nA     148   eaar-vaeql raylegecve wlrrylengk etlqradppk thvthhpisd
                                                                      
TARGET          hh     hhh hhhhhhhhhh hhhhhhhh            s ssssss    
1k5nA           h    hhhhh hhhhhhhhhh hhhhhhhh            s ssssssss  


TARGET    194   SVTTLRCRAL NYYPQNITMK WLKDKQPMDA KEFEPKDVLP NGDGTYQGWI
1k5nA     197   heatlrcwal gfypaeitlt wqrdgedqt- qdtelvetrp agdrtfqkwa
                                                                      
TARGET            ssssssss s      sss ssss sss      sss  ss s   ssssss
1k5nA           ssssssssss s      sss ssss sss      sss  ss s   ssssss


TARGET    244   TLAVPPGEEQ RYTCQVEHPG LDQPLIVIWE P                    
1k5nA     246   avvvpsgeeq rytchvqheg lpkpltlrwe p-                   
                                                                      
TARGET          ssss    hh sssssss        sss                         
1k5nA           ssssss  hh sssssss        sss                         


1zs8A

TARGET    1       SHSLHYLF MGASEQDLGL SLFEALGYVD DQLFVFYDHE SRRVEPRTPW
1zs8A     1       shwlktfr ivimepgile prfiqvsyvd siqyqgfdsr sg-mqpraaw
                                                                      
TARGET             sssssss ssss        sssssssss  ssssssss      sss  h
1zs8A              sssssss ssss        sssssssss  ssssssss      sss  h


TARGET    49    VSSRISSQMW LQLSQSLKGW DHMFTVDFWT I-MENHNHSK ESHTLQVILG
1zs8A     51    mkqe-ppeyw knetehamga sllarrtliy mvtennnkkn dyhtlqevfg
                                                                      
TARGET          h      hhh hhhhhhhhhh hhhhhhhhhh              ssssssss
1zs8A           h      hhh hhhhhhhhhh hhhhhhhhhh hhhhh        ssssssss


TARGET    98    CEMQEDNST- EGYWKYGYDG QDHLEFCPDT LDWRAAEPRA WPTKLEWERH
1zs8A     100   cnvahdgsfl gghygltyyg ydyiilnedl nswttegkvg gkfnsvt---
                                                                      
TARGET          ssss  sss  sssssssss   ssssss     sssss               
1zs8A           ssss   sss sssssssss   ssssss     sssss          hh   


TARGET    147   KIRARQNRAY LERDCPAQLQ QLLELGRGVL DQQVPPLVKV THHVTSSVTT
1zs8A     153   ----egwrty lkgecterfl rcldlgketl lrsdaprthv thk---vtvt
                                                                      
TARGET               hhhhh hhhhhhhhhh hhhh   hhh       ssss sss     ss
1zs8A               hhhhhh h   hhhhhh hhh   hhhh       ssss sss     ss


TARGET    197   LRCRALNYYP QNITMKWLKD KQPMDAKEFE PKDVLPNGDG TYQGWITLAV
1zs8A     200   lrcwalgfyp aditltwkrd gknht-qdme lpdtrpagdg tfqkwaavvv
                                                                      
TARGET          sssssss       sssssss                sss    ssssssssss
1zs8A           sssssss       sssssss                sss    ssssssssss


TARGET    247   PPGEEQRYTC QVEHPGLDQP LIVIWE                          
1zs8A     249   pfgeelrytc hvhheglpgp ltlkwg-                         
                                                                      
TARGET                ssss sss        sss                             
1zs8A                 ssss sss        sss                             


2iadB

TARGET    1                   HSKESHT LQVILGCEMQ EDN-STEGYW KYGYDGQDHL
2iadB     2     ghatqgvtaa s--sherhfv vqfkgecyyt ngtqrirlvt ryiynreeyv
                                                                      
TARGET                                 sssssssss     ssssss ssss  ssss
2iadB                               s ssssssssss     ssssss sssss ssss


TARGET    37    EFCPDTLDWR AAEPRAWPTK LEWERHKIRA RQNRAYLERD CPAQLQQLLE
2iadB     39    rydsdvgeyr avtelgrpda eywnsqpeil ertraevdta crhnyegp--
                                                                      
TARGET          ssss     s ss    hhhh hhhh   hhh hhhhhhhhhh    hhh    
2iadB           ssss     s ss     hhh hhhh   hhh hhhhhhhhhh hhhhhh    


TARGET    87    LGRGVLDQQV PPLVKVTHHV TSS---VTTL RCRALNYYPQ NITMKWLKDK
2iadB     87    etstslrrle qpnvaislsr tealnhhntl vcsvtdfypa kikvrwfrng
                                                                      
TARGET                       sssssss         sss ssssss       sssssss 
2iadB                        sssssss         sss ssssss       sssssss 


TARGET    134   QPMDAKEFEP KDVLPNGDGT YQGWITLAVP PGEEQRYTCQ VEHPGLDQPL
2iadB     136   qee-tvgvss tqlirngdwt fqvlvmlemt phqgevytch vehpslkspi
                                                                      
TARGET          sss   ssss s  sss   s sssssssss       sssss ss       s
2iadB           sss   ssss s  sss   s sssssssss       sssss ss       s


TARGET    184   IVIWEP                                                
2iadB     185   tvewss-                                               
                                                                      
TARGET          ssss                                                  
2iadB           ssss                                                  


3dbxA

TARGET    1       LLRSHSLH YLFMGASEQD LGLSLFEALG YVDDQLFVFY DHESRRVEPR
3dbxA     7       peesqffq lfytlll-gn vssteltgma lladvpimvl dphtwnlnic
                                                                      
TARGET                ssss ssssssss     ssssssss sss ssssss s    sssss
3dbxA                 ssss sssssss s    ssssssss sss ssssss s    sssss


TARGET    49    TPWVSSRISS QMWLQLSQSL KGWDHMFTVD FWTIMENHNH SKESHTLQVI
3dbxA     54    rpwvqeitae tevkkilsfs mvgirntirf mhemt-akag ldyprvfqih
                                                                      
TARGET            hh         hhhh        hhhhhhh hhhh           ssssss
3dbxA             hh         hhhhhh      hhhhhhh hhhhh hh       ssssss


TARGET    99    LGCEMQEDNS TEGYWKYGYD GQDHLEFCPD TLDWRAAEPR A--WPTKLEW
3dbxA     103   tgcklytngt rwsfvnigeg grdlvtyels rerwvpqrst llakvmsntl
                                                                      
TARGET          ssssss   s ssssssssss  ssssssss   ssssss        hhhhhh
3dbxA           ssssss   s ssssssssss  ssssssss   ssssss    hhhhhhhhhh


TARGET    147   ERHKIRARQN RAYLERDCPA QLQQLLELGR GVLDQQVPPL VKVTHHVTS-
3dbxA     153   tdlravsgfl ehifsssfpn yilmlheegr tdlerrvppm avvfartagq
                                                                      
TARGET          h   hhhhhh hhhh   hhh hhhhhhh    hhh      s ssssss    
3dbxA           h   hhhhhh hhhh   hhh hhhhhhh    hhh      s ssssssss  


TARGET    196   SVTTLRCRAL NYYPQNITMK WLKDKQPMD- AKEFEPKDVL PNGDGTYQGW
3dbxA     203   vqlllvcrvt sfyprpiavt wlrdgrevpp spalstgtvl pnadltyqlr
                                                                      
TARGET            ssssssss s      sss ssss sss     sssss  s ss   sssss
3dbxA            sssssssss s      sss ssss sss     sssss  s ss   sssss


TARGET    245   ITLAVPPGEE QRYTCQVEHP GLD-QPLIVI WE                   
3dbxA     253   stllvspqdg hgyacrvqhc slgdrsllvp whh                  
                                                                      
TARGET          sssss       sssssss         ssss s                    
3dbxA           sssss       sssssss         ssss s