Difference between revisions of "Homology Based Structure Predictions Hemochromatosis Alignments"

From Bioinformatikpedia
(1zs8A)
(3dbxA)
 
(6 intermediate revisions by 2 users not shown)
Line 1: Line 1:
 
== Modeller ==
 
== Modeller ==
  +
=== 1K5NA ===
  +
==== simple modeller alignment ====
  +
  +
>P1;1K5N
  +
structureX:1K5N: 1 :A:+276 :A:MOL_ID 1; MOLECULE MAJOR HISTOCOMPATIBILITY COMPLEX MOLECULE HLA-B*2 CHAIN A; FRAGMENT HLA-B*2709 HEAVY CHAIN, EXTRACELLULAR DOMAIN; SYNONYM LYMPHOCYTE ANTIGEN HLA-B27; ENGINEERED YES; MOL_ID 2; MOLECULE BETA-2-MICROGLOBULIN, LIGHT CHAIN; CHAIN B; ENGINEERED YES; MOL_ID 3; MOLECULE NONAMERIC MODEL PEPTIDE M9; CHAIN C; ENGINEERED YES:MOL_ID 1; ORGANISM_SCIENTIFIC HOMO SAPIENS; ORGANISM_COMMON HUMAN; ORGANISM_TAXID 9606; GENE HLA-B OR HLAB; EXPRESSION_SYSTEM ESCHERICHIA COLI; EXPRESSION_SYSTEM_TAXID 562; MOL_ID 2; ORGANISM_SCIENTIFIC HOMO SAPIENS; ORGANISM_COMMON HUMAN; ORGANISM_TAXID 9606; GENE B2M; EXPRESSION_SYSTEM ESCHERICHIA COLI; EXPRESSION_SYSTEM_TAXID 562; MOL_ID 3; SYNTHETIC YES; OTHER_DETAILS THIS PEPTIDE WAS CHEMICALLY SYNTHESISED.: 1.09: 0.12
  +
-------------------------GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAP
  +
WIEQE-GPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQHAYDGKDYI
  +
ALNEDLSSWTAADTAAQITQRKWEAARV-AEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
  +
ATLRCWALGFYPAEITLTWQRDGED-QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTL
  +
RWEP-------------------------------------------------*
  +
>P1;Q30201
  +
sequence:Q30201: : : : ::: 0.00: 0.00
  +
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHE--SRRVEPRTP
  +
WVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKE-SHTLQVILGCEMQEDNST-EGYWKYGYDGQDHL
  +
EFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHH-VTSSV
  +
TTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIV
  +
IWEPSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*
  +
  +
  +
==== 2d modeller alignment ====
  +
  +
>P1;1K5N
  +
structureX:1K5N: 1 :A:+276 :A:MOL_ID 1; MOLECULE MAJOR HISTOCOMPATIBILITY COMPLEX MOLECULE HLA-B*2 CHAIN A; FRAGMENT HLA-B*2709 HEAVY CHAIN, EXTRACELLULAR DOMAIN; SYNONYM LYMPHOCYTE ANTIGEN HLA-B27; ENGINEERED YES; MOL_ID 2; MOLECULE BETA-2-MICROGLOBULIN, LIGHT CHAIN; CHAIN B; ENGINEERED YES; MOL_ID 3; MOLECULE NONAMERIC MODEL PEPTIDE M9; CHAIN C; ENGINEERED YES:MOL_ID 1; ORGANISM_SCIENTIFIC HOMO SAPIENS; ORGANISM_COMMON HUMAN; ORGANISM_TAXID 9606; GENE HLA-B OR HLAB; EXPRESSION_SYSTEM ESCHERICHIA COLI; EXPRESSION_SYSTEM_TAXID 562; MOL_ID 2; ORGANISM_SCIENTIFIC HOMO SAPIENS; ORGANISM_COMMON HUMAN; ORGANISM_TAXID 9606; GENE B2M; EXPRESSION_SYSTEM ESCHERICHIA COLI; EXPRESSION_SYSTEM_TAXID 562; MOL_ID 3; SYNTHETIC YES; OTHER_DETAILS THIS PEPTIDE WAS CHEMICALLY SYNTHESISED.: 1.09: 0.12
  +
-G------------------------SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAP
  +
WIE-QEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQHAYDGKDYI
  +
ALNEDLSSWTAADTAAQITQRKWEAARV-AEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
  +
ATLRCWALGFYPAEITLTWQRDGEDQT-QDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTL
  +
RWEP-------------------------------------------------*
  +
>P1;Q30201
  +
sequence:Q30201: : : : ::: 0.00: 0.00
  +
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYD--HESRRVEPRTP
  +
WVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSK-ESHTLQVILGCEMQEDNS-TEGYWKYGYDGQDHL
  +
EFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSS-V
  +
TTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIV
  +
IWEPSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*
  +
  +
=== 1ZS8A ===
  +
==== simple modeller alignment ====
  +
  +
>P1;1ZS8
  +
structureX:1ZS8: 1 :A:+261 :A:MOL_ID 1; MOLECULE HISTOCOMPATIBILITY 2, M REGION LOCUS 10.5; CHAIN A, C, E, G, I; ENGINEERED YES; MOL_ID 2; MOLECULE BETA-2-MICROGLOBULIN; CHAIN B, D, F, H, J; ENGINEERED YES:MOL_ID 1; ORGANISM_SCIENTIFIC MUS MUSCULUS; ORGANISM_COMMON HOUSE MOUSE; ORGANISM_TAXID 10090; GENE M10.5; EXPRESSION_SYSTEM TRICHOPLUSIA NI; EXPRESSION_SYSTEM_COMMON CABBAGE LOOPER; EXPRESSION_SYSTEM_TAXID 7111; EXPRESSION_SYSTEM_STRAIN TN5; EXPRESSION_SYSTEM_VECTOR_TYPE BACULOVIRUS; EXPRESSION_SYSTEM_PLASMID PACUW31; MOL_ID 2; ORGANISM_SCIENTIFIC HOMO SAPIENS; ORGANISM_COMMON HUMAN; ORGANISM_TAXID 9606; GENE B2M; EXPRESSION_SYSTEM TRICHOPLUSIA NI; EXPRESSION_SYSTEM_COMMON CABBAGE LOOPER; EXPRESSION_SYSTEM_TAXID 7111; EXPRESSION_SYSTEM_STRAIN TN5; EXPRESSION_SYSTEM_VECTOR_TYPE BACULOVIRUS; EXPRESSION_SYSTEM_PLASMID PACUW31: 3.00: 0.31
  +
--------------------------SHWLKTFRIVIMEPGILEPRFIQVSYVDSIQYQGFDSRSG-MQPRAAWM
  +
KQEPPEYWKNETEHAMGASLLARRTLIYMVTENNNKKNDYHTLQEVFGCNVAHDGSFLGGHYGLTYYGYDYIILN
  +
EDLNSWTTEGKVG-------GKFNSVTEGWRTYLKGECTERFLRCLDLGKETLLRSDAPRTHVTHKVT---VTLR
  +
CWALGFYPADITLTWKRDGKN-HTQDMELPDTRPAGDGTFQKWAAVVVPFGEELRYTCHVHHEGLPGPLTLKWG-
  +
-------------------------------------------------*
  +
>P1;Q30201
  +
sequence:Q30201: : : : ::: 0.00: 0.00
  +
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWV
  +
SSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNS-TEGYWKYGYDGQDHLEFC
  +
PDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLR
  +
CRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEP
  +
SPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*
  +
  +
  +
==== 2d modeller alignment ====
  +
  +
>P1;1ZS8
  +
structureX:1ZS8: 1 :A:+261 :A:MOL_ID 1; MOLECULE HISTOCOMPATIBILITY 2, M REGION LOCUS 10.5; CHAIN A, C, E, G, I; ENGINEERED YES; MOL_ID 2; MOLECULE BETA-2-MICROGLOBULIN; CHAIN B, D, F, H, J; ENGINEERED YES:MOL_ID 1; ORGANISM_SCIENTIFIC MUS MUSCULUS; ORGANISM_COMMON HOUSE MOUSE; ORGANISM_TAXID 10090; GENE M10.5; EXPRESSION_SYSTEM TRICHOPLUSIA NI; EXPRESSION_SYSTEM_COMMON CABBAGE LOOPER; EXPRESSION_SYSTEM_TAXID 7111; EXPRESSION_SYSTEM_STRAIN TN5; EXPRESSION_SYSTEM_VECTOR_TYPE BACULOVIRUS; EXPRESSION_SYSTEM_PLASMID PACUW31; MOL_ID 2; ORGANISM_SCIENTIFIC HOMO SAPIENS; ORGANISM_COMMON HUMAN; ORGANISM_TAXID 9606; GENE B2M; EXPRESSION_SYSTEM TRICHOPLUSIA NI; EXPRESSION_SYSTEM_COMMON CABBAGE LOOPER; EXPRESSION_SYSTEM_TAXID 7111; EXPRESSION_SYSTEM_STRAIN TN5; EXPRESSION_SYSTEM_VECTOR_TYPE BACULOVIRUS; EXPRESSION_SYSTEM_PLASMID PACUW31: 3.00: 0.31
  +
--------SHWLKTFRIVIMEPGIL-------------E-----PRFIQVSYVDSIQYQGFDSRS-GMQPRAAWM
  +
KQE-PPEYWKNETEHAMGASLLARRTLIYMVTENNNKKNDYHTLQEVFGCNVAHDGSFLGGHYGLTYYGYDYIIL
  +
NEDLNSWTTEG------KVG-GKFNSVTEGWRTYLKGECTERFLRCLDLGKETLLRSDAPRTHVTHKVT---VTL
  +
RCWALGFYPADITLTWKRDGKN-HTQDMELPDTRPAGDGTFQKWAAVVVPFGEELRYTCHVHHEGLPGPL-----
  +
-----TLKWG----------------------------------------*
  +
>P1;Q30201
  +
sequence:Q30201: : : : ::: 0.00: 0.00
  +
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWV
  +
SSRISSQMWLQLSQSLKGWDHMFTVDF-WTIMENHNHSKESHTLQVILGCEMQEDNS-TEGYWKYGYDGQDHLEF
  +
CPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTL
  +
RCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWE
  +
PSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*
  +
  +
  +
=== 2IADB ===
  +
==== simple modeller alignment ====
  +
  +
>P1;2IAD
  +
structureX:2IAD: 2S:B:+201 :B:MOL_ID 1; MOLECULE MHC CLASS II I-AD; CHAIN A; FRAGMENT RESIDUES 126P - 138P OF CHAIN B ARE COVALENTLY LI INFLUENZA HEMAGGLUTININ PEPTIDE; ENGINEERED YES; MOL_ID 2; MOLECULE MHC CLASS II I-AD; CHAIN B; FRAGMENT RESIDUES 126P - 138P OF CHAIN B ARE COVALENTLY LI INFLUENZA HEMAGGLUTININ PEPTIDE; ENGINEERED YES:MOL_ID 1; FRAGMENT RESIDUES 126P - 138P OF CHAIN B; ORGANISM_SCIENTIFIC MUS MUSCULUS; ORGANISM_COMMON HOUSE MOUSE; ORGANISM_TAXID 10090; STRAIN BALB-C; CELL_LINE S2; ORGAN TAIL; EXPRESSION_SYSTEM DROSOPHILA MELANOGASTER; EXPRESSION_SYSTEM_COMMON FRUIT FLY; EXPRESSION_SYSTEM_TAXID 7227; EXPRESSION_SYSTEM_CELL_LINE S2; MOL_ID 2; FRAGMENT RESIDUES 126P - 138P OF CHAIN B; ORGANISM_SCIENTIFIC MUS MUSCULUS; ORGANISM_COMMON HOUSE MOUSE; ORGANISM_TAXID 10090; STRAIN BALB/C; CELL_LINE S2; ORGAN TAIL; EXPRESSION_SYSTEM DROSOPHILA MELANOGASTER; EXPRESSION_SYSTEM_COMMON FRUIT FLY; EXPRESSION_SYSTEM_TAXID 7227; EXPRESSION_SYSTEM_CELL_LINE S2: 2.40: 0.25
  +
---------------GHATQGVTAASSHERHFVVQFKGE-------------------CYYTNGTQRIRLVT---
  +
-------------------------------------------------------------RYIYNREEYVRYDS
  +
DVGEYRAVTELGRPDAEYWNSQPEILERTRAEVDTACRHNYEGPETSTSLRRLEQPNVAISLSRTEALNHHNTLV
  +
CSVTDFYPAKIKVRWFRNGQE-ETVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSLKSPITVEWSS
  +
-------------------------------------------------*
  +
>P1;Q30201
  +
sequence:Q30201: : : : ::: 0.00: 0.00
  +
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWV
  +
SSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCP
  +
DTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQL-LELGRGVLDQQVPPLVKVTHHVTSSVTTLR
  +
CRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEP
  +
SPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*
  +
  +
==== 2d modeller alignment ====
  +
  +
>P1;2IAD
  +
structureX:2IAD: 2S:B:+201 :B:MOL_ID 1; MOLECULE MHC CLASS II I-AD; CHAIN A; FRAGMENT RESIDUES 126P - 138P OF CHAIN B ARE COVALENTLY LI INFLUENZA HEMAGGLUTININ PEPTIDE; ENGINEERED YES; MOL_ID 2; MOLECULE MHC CLASS II I-AD; CHAIN B; FRAGMENT RESIDUES 126P - 138P OF CHAIN B ARE COVALENTLY LI INFLUENZA HEMAGGLUTININ PEPTIDE; ENGINEERED YES:MOL_ID 1; FRAGMENT RESIDUES 126P - 138P OF CHAIN B; ORGANISM_SCIENTIFIC MUS MUSCULUS; ORGANISM_COMMON HOUSE MOUSE; ORGANISM_TAXID 10090; STRAIN BALB-C; CELL_LINE S2; ORGAN TAIL; EXPRESSION_SYSTEM DROSOPHILA MELANOGASTER; EXPRESSION_SYSTEM_COMMON FRUIT FLY; EXPRESSION_SYSTEM_TAXID 7227; EXPRESSION_SYSTEM_CELL_LINE S2; MOL_ID 2; FRAGMENT RESIDUES 126P - 138P OF CHAIN B; ORGANISM_SCIENTIFIC MUS MUSCULUS; ORGANISM_COMMON HOUSE MOUSE; ORGANISM_TAXID 10090; STRAIN BALB/C; CELL_LINE S2; ORGAN TAIL; EXPRESSION_SYSTEM DROSOPHILA MELANOGASTER; EXPRESSION_SYSTEM_COMMON FRUIT FLY; EXPRESSION_SYSTEM_TAXID 7227; EXPRESSION_SYSTEM_CELL_LINE S2: 2.40: 0.25
  +
-G-HATQGV-------TAA------SSHERH--F---------VVQFKGECYYTN--------GTQRIRLVTRYI
  +
YNR---EEYVRYDSDV-G-------EYRAVTE--------------LG------RPDAEYWNSQ----------P
  +
EILERTRAEVD---T---ACRHNYEGPETSTSLRR--LEQPNVAISLSR------TEAL---NHH-----NTLVC
  +
SVTDFYPAKIKVRWFRNGQE-ETVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSLKSPITVEW--S
  +
-S----------------------------------------------*
  +
  +
>P1;Q30201
  +
sequence:Q30201: : : : ::: 0.00: 0.00
  +
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWV
  +
SSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCP
  +
DTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRC
  +
RALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPS
  +
PSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*
  +
  +
=== 3DBXA ===
  +
==== simple modeller alignment ====
  +
  +
>P1;3DBX
  +
structureX:3DBX: 7 :A:+279 :A:MOL_ID 1; MOLECULE CD1-2 ANTIGEN; CHAIN A; FRAGMENT ECTODOMAIN OF CHICKEN CD1-2, UNP RESIDUES 20-302; ENGINEERED YES; MOL_ID 2; MOLECULE BETA-2-MICROGLOBULIN; CHAIN B; SYNONYM BETA-2-MICROGLOBULIN FORM PI 5.3; ENGINEERED YES:MOL_ID 1; ORGANISM_SCIENTIFIC GALLUS GALLUS; ORGANISM_COMMON CHICKEN; ORGANISM_TAXID 9031; GENE CD1-2; EXPRESSION_SYSTEM SPODOPTERA FRUGIPERDA; EXPRESSION_SYSTEM_TAXID 7108; EXPRESSION_SYSTEM_STRAIN SF9; EXPRESSION_SYSTEM_VECTOR_TYPE BACULOVIRUS SHUTTLE VECTOR; EXPRESSION_SYSTEM_PLASMID PBACPHP10; MOL_ID 2; ORGANISM_SCIENTIFIC HOMO SAPIENS; ORGANISM_COMMON HUMAN; ORGANISM_TAXID 9606; GENE B2M, CDABP0092, HDCMA22P; EXPRESSION_SYSTEM SPODOPTERA FRUGIPERDA; EXPRESSION_SYSTEM_TAXID 7108; EXPRESSION_SYSTEM_STRAIN SF9; EXPRESSION_SYSTEM_VECTOR_TYPE BACULOVIRUS SHUTTLE VECTOR; EXPRESSION_SYSTEM_PLASMID PBACPHP10: 2.00: 0.22
  +
PEESQFFQLFYTLLLGNV------------------SSTELTGMAL------LADVPIMVLDPHTWNLNICRPWV
  +
QE-ITAETEVKKILSFSMVGIRNTIRFMHEMTAKAGLDYPRVFQIHTGCKLYTNGTRWSFVNIGEGGRDLVTYEL
  +
SRERWVPQRSTLLAKVMSNTLTDLRAVSGFLEHIFSSSFPNYILMLHEEGRTDLERRVPPMAVVFARTAGQVQLL
  +
LVCRVTSFYPRPIAVTWLRDGREVPPSPALSTGTVLPNADLTYQLRSTLLVSPQDGHGYACRVQHCSLGDRSLLV
  +
PW-------------------------------------------------HH*
  +
>P1;Q30201
  +
sequence:Q30201: : : : ::: 0.00: 0.00
  +
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWV
  +
SSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCP
  +
DTLDWRAAEPRAWPTKLEWERHKIRARQN--RAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTL
  +
R-CRALNYYPQNITMKWLKDKQPMDAK-EFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGL-DQPLIV
  +
IWEPSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*
  +
  +
==== 2d modeller alignment ====
  +
  +
>P1;3DBX
  +
structureX:3DBX: 7 :A:+279 :A:MOL_ID 1; MOLECULE CD1-2 ANTIGEN; CHAIN A; FRAGMENT ECTODOMAIN OF CHICKEN CD1-2, UNP RESIDUES 20-302; ENGINEERED YES; MOL_ID 2; MOLECULE BETA-2-MICROGLOBULIN; CHAIN B; SYNONYM BETA-2-MICROGLOBULIN FORM PI 5.3; ENGINEERED YES:MOL_ID 1; ORGANISM_SCIENTIFIC GALLUS GALLUS; ORGANISM_COMMON CHICKEN; ORGANISM_TAXID 9031; GENE CD1-2; EXPRESSION_SYSTEM SPODOPTERA FRUGIPERDA; EXPRESSION_SYSTEM_TAXID 7108; EXPRESSION_SYSTEM_STRAIN SF9; EXPRESSION_SYSTEM_VECTOR_TYPE BACULOVIRUS SHUTTLE VECTOR; EXPRESSION_SYSTEM_PLASMID PBACPHP10; MOL_ID 2; ORGANISM_SCIENTIFIC HOMO SAPIENS; ORGANISM_COMMON HUMAN; ORGANISM_TAXID 9606; GENE B2M, CDABP0092, HDCMA22P; EXPRESSION_SYSTEM SPODOPTERA FRUGIPERDA; EXPRESSION_SYSTEM_TAXID 7108; EXPRESSION_SYSTEM_STRAIN SF9; EXPRESSION_SYSTEM_VECTOR_TYPE BACULOVIRUS SHUTTLE VECTOR; EXPRESSION_SYSTEM_PLASMID PBACPHP10: 2.00: 0.22
  +
------PEESQFFQLFYTLLLGNV--S----------STELTGMALLA-----DVPIMVLDPH-TWNLNICRPWV
  +
Q-EITAETEVKKILSFSMVGIRNTIRFMHEMTAKAGLDYPRVFQIHTGCKLYTNGTRWSFVNIGEGGRDLVTYEL
  +
SRERWVPQRSTLLAKVMSNTLTDLRAVSGFLEHIFSSSFPNYILMLHEEGRTDLERRVPPMAVVFARTAGQVQLL
  +
LVCRVTSFYPRPIAVTWLRDGREVPPSPALSTGTVLPNADLTYQLRSTLLVSPQDGHGYACRVQHCSLGDRSLLV
  +
PWH------------------------------------------H-------
  +
>P1;Q30201
  +
sequence:Q30201: : : : ::: 0.00: 0.00
  +
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWV
  +
SSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCP
  +
DTLDWRAAEPRAWPTKLEWERHKIRARQN--RAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSV-TT
  +
LRCRALNYYPQNITMKWLKDKQPMD-AKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGL-DQPLIV
  +
IWEPSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*
  +
  +
=== MSA1 ===
  +
  +
>P1;1K5NA
  +
structureX:1K5N:1 :A:+276 :A:MOL_ID 1; MOLECULE MAJOR HISTOCOMPATIBILITY COMPLEX MOLECULE HLA-B*2 CHAIN A; FRAGMENT HLA-B*2709 HEAVY CHAIN, EXTRACELLULAR DOMAIN; SYNONYM LYMPHOCYTE ANTIGEN HLA-B27; ENGINEERED YES; MOL_ID 2; MOLECULE BETA-2-MICROGLOBULIN, LIGHT CHAIN; CHAIN B; ENGINEERED YES; MOL_ID 3; MOLECULE NONAMERIC MODEL PEPTIDE M9; CHAIN C; ENGINEERED YES:MOL_ID 1; ORGANISM_SCIENTIFIC HOMO SAPIENS; ORGANISM_COMMON HUMAN; ORGANISM_TAXID 9606; GENE HLA-B OR HLAB; EXPRESSION_SYSTEM ESCHERICHIA COLI; EXPRESSION_SYSTEM_TAXID 562; MOL_ID 2; ORGANISM_SCIENTIFIC HOMO SAPIENS; ORGANISM_COMMON HUMAN; ORGANISM_TAXID 9606; GENE B2M; EXPRESSION_SYSTEM ESCHERICHIA COLI; EXPRESSION_SYSTEM_TAXID 562; MOL_ID 3; SYNTHETIC YES; OTHER_DETAILS THIS PEPTIDE WAS CHEMICALLY SYNTHESISED.: 1.09: 0.12
  +
GSHSMRYFHTSVSRPGRGE-----------------------PRFITVGYVDDTLFVRFDSDAASPREEPRAPWI
  +
EQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQHAYDGKDYIALN
  +
EDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLR
  +
CWALGFYPAEITLTWQRDGEDQ--TQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGL-PKPLT---
  +
---------------------------------------------LRWEP*
  +
>P1;1ZS8A
  +
structureX:1ZS8:1 :A:+261 :A:MOL_ID 1; MOLECULE HISTOCOMPATIBILITY 2, M REGION LOCUS 10.5; CHAIN A, C, E, G, I; ENGINEERED YES; MOL_ID 2; MOLECULE BETA-2-MICROGLOBULIN; CHAIN B, D, F, H, J; ENGINEERED YES:MOL_ID 1; ORGANISM_SCIENTIFIC MUS MUSCULUS; ORGANISM_COMMON HOUSE MOUSE; ORGANISM_TAXID 10090; GENE M10.5; EXPRESSION_SYSTEM TRICHOPLUSIA NI; EXPRESSION_SYSTEM_COMMON CABBAGE LOOPER; EXPRESSION_SYSTEM_TAXID 7111; EXPRESSION_SYSTEM_STRAIN TN5; EXPRESSION_SYSTEM_VECTOR_TYPE BACULOVIRUS; EXPRESSION_SYSTEM_PLASMID PACUW31; MOL_ID 2; ORGANISM_SCIENTIFIC HOMO SAPIENS; ORGANISM_COMMON HUMAN; ORGANISM_TAXID 9606; GENE B2M; EXPRESSION_SYSTEM TRICHOPLUSIA NI; EXPRESSION_SYSTEM_COMMON CABBAGE LOOPER; EXPRESSION_SYSTEM_TAXID 7111; EXPRESSION_SYSTEM_STRAIN TN5; EXPRESSION_SYSTEM_VECTOR_TYPE BACULOVIRUS; EXPRESSION_SYSTEM_PLASMID PACUW31: 3.00: 0.31
  +
-SHWLKTFRIVIMEPGILE-----------------------PRFIQVSYVDSIQYQGFDSRSGM---QPRAAWM
  +
KQEPPEYWKNETEHAMGASLLARRTLIYMVTENNNKKNDYHTLQEVFGCNVAHDGSFLGGHYGLTYYGYDYIILN
  +
EDLNSWTTEGKVGG------KFNSVTEGWRTYLKGECTERFLRCLDLGKETLLRSDAPRTHVTHKV----TVTLR
  +
CWALGFYPADITLTWKRDGKNH--TQDMELPDTRPAGDGTFQKWAAVVVPFGEELRYTCHVHHEGL-PGPLT---
  +
---------------------------------------------LKWG-*
  +
>P1;2IADB
  +
structureX:2IAD:2S :B:+201 :B:MOL_ID 1; MOLECULE MHC CLASS II I-AD; CHAIN A; FRAGMENT RESIDUES 126P - 138P OF CHAIN B ARE COVALENTLY LI INFLUENZA HEMAGGLUTININ PEPTIDE; ENGINEERED YES; MOL_ID 2; MOLECULE MHC CLASS II I-AD; CHAIN B; FRAGMENT RESIDUES 126P - 138P OF CHAIN B ARE COVALENTLY LI INFLUENZA HEMAGGLUTININ PEPTIDE; ENGINEERED YES:MOL_ID 1; FRAGMENT RESIDUES 126P - 138P OF CHAIN B; ORGANISM_SCIENTIFIC MUS MUSCULUS; ORGANISM_COMMON HOUSE MOUSE; ORGANISM_TAXID 10090; STRAIN BALB-C; CELL_LINE S2; ORGAN TAIL; EXPRESSION_SYSTEM DROSOPHILA MELANOGASTER; EXPRESSION_SYSTEM_COMMON FRUIT FLY; EXPRESSION_SYSTEM_TAXID 7227; EXPRESSION_SYSTEM_CELL_LINE S2; MOL_ID 2; FRAGMENT RESIDUES 126P - 138P OF CHAIN B; ORGANISM_SCIENTIFIC MUS MUSCULUS; ORGANISM_COMMON HOUSE MOUSE; ORGANISM_TAXID 10090; STRAIN BALB/C; CELL_LINE S2; ORGAN TAIL; EXPRESSION_SYSTEM DROSOPHILA MELANOGASTER; EXPRESSION_SYSTEM_COMMON FRUIT FLY; EXPRESSION_SYSTEM_TAXID 7227; EXPRESSION_SYSTEM_CELL_LINE S2: 2.40: 0.25
  +
GHATQGVTAASSHERHFVV-----------------------QFKGECYYTNGTQRIRLVTRYIY----------
  +
NREEYVRYDSDVGEYRAVTELGRPDAEYWNSQ-------------------------------------------
  +
----------------------PEILERTRAEVDTACRHNYEGPETSTSLRRLEQPNVAISLSRTEALNHHNTLV
  +
CSVTDFYPAKIKVRWFRNGQEE--TVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSL-KSPIT---
  +
---------------------------------------------VEWSS*
  +
>P1;3DBXA
  +
structureX:3DBX:7 :A:+279 :A:MOL_ID 1; MOLECULE CD1-2 ANTIGEN; CHAIN A; FRAGMENT ECTODOMAIN OF CHICKEN CD1-2, UNP RESIDUES 20-302; ENGINEERED YES; MOL_ID 2; MOLECULE BETA-2-MICROGLOBULIN; CHAIN B; SYNONYM BETA-2-MICROGLOBULIN FORM PI 5.3; ENGINEERED YES:MOL_ID 1; ORGANISM_SCIENTIFIC GALLUS GALLUS; ORGANISM_COMMON CHICKEN; ORGANISM_TAXID 9031; GENE CD1-2; EXPRESSION_SYSTEM SPODOPTERA FRUGIPERDA; EXPRESSION_SYSTEM_TAXID 7108; EXPRESSION_SYSTEM_STRAIN SF9; EXPRESSION_SYSTEM_VECTOR_TYPE BACULOVIRUS SHUTTLE VECTOR; EXPRESSION_SYSTEM_PLASMID PBACPHP10; MOL_ID 2; ORGANISM_SCIENTIFIC HOMO SAPIENS; ORGANISM_COMMON HUMAN; ORGANISM_TAXID 9606; GENE B2M, CDABP0092, HDCMA22P; EXPRESSION_SYSTEM SPODOPTERA FRUGIPERDA; EXPRESSION_SYSTEM_TAXID 7108; EXPRESSION_SYSTEM_STRAIN SF9; EXPRESSION_SYSTEM_VECTOR_TYPE BACULOVIRUS SHUTTLE VECTOR; EXPRESSION_SYSTEM_PLASMID PBACPHP10: 2.00: 0.22
  +
PEESQFFQLFYTLLLGNVS-----------------------STELTGMALLADVPIMVLDPHTWNLNICRPWVQ
  +
EITAETEVKKILSFSMVGIRNTIRFMHEMTAKAGLDYPRVFQIHTGCKLYTNGTRWSFVNIGEGGRDLVTYELSR
  +
ERWVPQRSTLLAKVMSNTLTDLRAVSGFLEHIFSSSFPNYILMLHEEGRTDLERRVPPMAVVFARTAGQVQLLLV
  +
CRVTSFYPRPIAVTWLRDGREVPPSPALSTGTVLPNADLTYQLRSTLLVSPQDGHGYACRVQHCSLGDRSLL---
  +
---------------------------------------------VPWHH*
  +
>P1;Q30201
  +
sequence:Q30201: : : : ::: 0.00: 0.00
  +
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWV
  +
SSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCP
  +
DTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVT-TLR
  +
CRALNYYPQNITMKWLKDKQPMD-AKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWE
  +
PSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*
  +
  +
=== MSA2 ===
  +
  +
>P1;1ZS8A
  +
structureX:1ZS8:1 :A:+261 :A:MOL_ID 1; MOLECULE HISTOCOMPATIBILITY 2, M REGION LOCUS 10.5; CHAIN A, C, E, G, I; ENGINEERED YES; MOL_ID 2; MOLECULE BETA-2-MICROGLOBULIN; CHAIN B, D, F, H, J; ENGINEERED YES:MOL_ID 1; ORGANISM_SCIENTIFIC MUS MUSCULUS; ORGANISM_COMMON HOUSE MOUSE; ORGANISM_TAXID 10090; GENE M10.5; EXPRESSION_SYSTEM TRICHOPLUSIA NI; EXPRESSION_SYSTEM_COMMON CABBAGE LOOPER; EXPRESSION_SYSTEM_TAXID 7111; EXPRESSION_SYSTEM_STRAIN TN5; EXPRESSION_SYSTEM_VECTOR_TYPE BACULOVIRUS; EXPRESSION_SYSTEM_PLASMID PACUW31; MOL_ID 2; ORGANISM_SCIENTIFIC HOMO SAPIENS; ORGANISM_COMMON HUMAN; ORGANISM_TAXID 9606; GENE B2M; EXPRESSION_SYSTEM TRICHOPLUSIA NI; EXPRESSION_SYSTEM_COMMON CABBAGE LOOPER; EXPRESSION_SYSTEM_TAXID 7111; EXPRESSION_SYSTEM_STRAIN TN5; EXPRESSION_SYSTEM_VECTOR_TYPE BACULOVIRUS; EXPRESSION_SYSTEM_PLASMID PACUW31: 3.00: 0.31
  +
SHWLKTFRI--VIMEPGILEPRFIQVSYVDSIQYQGFDSRSGMQPRAAWMK----QEPPEYWKNETEHAMGASLL
  +
ARRTLIYMVTENNNKKNDYHTLQEVFGCNVAHDGSFL-------------------------GGHYGLTYYGYDY
  +
IILNEDLNSWTTEGKVGGKFNSVTEGWRTYLKGECTERFLRCLDLGKETLLRSDAPRTHV-----THKVTVTLRC
  +
WALGFYPADITLTWKRDGKN--HTQDMELPDTRPAGDGTFQKWAAVVVPFGEELRYTCHVHHEGLPG-PLT----
  +
--------------------------------------------LKWG-*
  +
>P1;2IADB
  +
structureX:2IAD:2S :B:+201 :B:MOL_ID 1; MOLECULE MHC CLASS II I-AD; CHAIN A; FRAGMENT RESIDUES 126P - 138P OF CHAIN B ARE COVALENTLY LI INFLUENZA HEMAGGLUTININ PEPTIDE; ENGINEERED YES; MOL_ID 2; MOLECULE MHC CLASS II I-AD; CHAIN B; FRAGMENT RESIDUES 126P - 138P OF CHAIN B ARE COVALENTLY LI INFLUENZA HEMAGGLUTININ PEPTIDE; ENGINEERED YES:MOL_ID 1; FRAGMENT RESIDUES 126P - 138P OF CHAIN B; ORGANISM_SCIENTIFIC MUS MUSCULUS; ORGANISM_COMMON HOUSE MOUSE; ORGANISM_TAXID 10090; STRAIN BALB-C; CELL_LINE S2; ORGAN TAIL; EXPRESSION_SYSTEM DROSOPHILA MELANOGASTER; EXPRESSION_SYSTEM_COMMON FRUIT FLY; EXPRESSION_SYSTEM_TAXID 7227; EXPRESSION_SYSTEM_CELL_LINE S2; MOL_ID 2; FRAGMENT RESIDUES 126P - 138P OF CHAIN B; ORGANISM_SCIENTIFIC MUS MUSCULUS; ORGANISM_COMMON HOUSE MOUSE; ORGANISM_TAXID 10090; STRAIN BALB/C; CELL_LINE S2; ORGAN TAIL; EXPRESSION_SYSTEM DROSOPHILA MELANOGASTER; EXPRESSION_SYSTEM_COMMON FRUIT FLY; EXPRESSION_SYSTEM_TAXID 7227; EXPRESSION_SYSTEM_CELL_LINE S2: 2.40: 0.25
  +
GHATQG-------VTAASSHERHFVVQFKGECYYTNGTQRIRLVTRYIYNR----EEYVRYDSDVGEYRAVTEL-
  +
---------------------------------------------------------------GRPDAEYWNSQP
  +
EILERTRAEVDTACRHNYEGPETSTSLRRLEQPNVAISLSRTEALNHHN----------------------TLVC
  +
SVTDFYPAKIKVRWFRNGQE--ETVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSLKS-PIT----
  +
--------------------------------------------VEWSS*
  +
>P1;3DBXA
  +
structureX:3DBX:7 :A:+279 :A:MOL_ID 1; MOLECULE CD1-2 ANTIGEN; CHAIN A; FRAGMENT ECTODOMAIN OF CHICKEN CD1-2, UNP RESIDUES 20-302; ENGINEERED YES; MOL_ID 2; MOLECULE BETA-2-MICROGLOBULIN; CHAIN B; SYNONYM BETA-2-MICROGLOBULIN FORM PI 5.3; ENGINEERED YES:MOL_ID 1; ORGANISM_SCIENTIFIC GALLUS GALLUS; ORGANISM_COMMON CHICKEN; ORGANISM_TAXID 9031; GENE CD1-2; EXPRESSION_SYSTEM SPODOPTERA FRUGIPERDA; EXPRESSION_SYSTEM_TAXID 7108; EXPRESSION_SYSTEM_STRAIN SF9; EXPRESSION_SYSTEM_VECTOR_TYPE BACULOVIRUS SHUTTLE VECTOR; EXPRESSION_SYSTEM_PLASMID PBACPHP10; MOL_ID 2; ORGANISM_SCIENTIFIC HOMO SAPIENS; ORGANISM_COMMON HUMAN; ORGANISM_TAXID 9606; GENE B2M, CDABP0092, HDCMA22P; EXPRESSION_SYSTEM SPODOPTERA FRUGIPERDA; EXPRESSION_SYSTEM_TAXID 7108; EXPRESSION_SYSTEM_STRAIN SF9; EXPRESSION_SYSTEM_VECTOR_TYPE BACULOVIRUS SHUTTLE VECTOR; EXPRESSION_SYSTEM_PLASMID PBACPHP10: 2.00: 0.22
  +
PEESQFFQLFYTLLLGNVSSTELTGMALLADVPIMVLDPHTWNLNICRPWV----QEITAETEVKKILSFSMVGI
  +
RNTIRFMHEMTAKAGLDYPRVFQIHTGCKLYTNGTRW------------------SFVNIGEGGRDLVTYELSRE
  +
RWVPQRSTLLAKVMSNTLTDLRAVSGFLEHIFSSSFPNYILMLHEEGRTDLERRVPPMAVVFARTAGQVQLLLVC
  +
RVTSFYPRPIAVTWLRDGREVPPSPALSTGTVLPNADLTYQLRSTLLVSPQDGHGYACRVQHCSLGDRSLL----
  +
--------------------------------------------VPWHH*
  +
>P1;Q30201
  +
sequence:Q30201: : : : ::: 0.00: 0.00
  +
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWV
  +
SSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCP
  +
DTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRC
  +
RALNYYPQNITMKWLKDKQPM-DAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEP
  +
SPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*
  +
  +
=== MSA3 ===
  +
  +
>P1;2IADB
  +
structureX:2IAD:2S :B:+201 :B:MOL_ID 1; MOLECULE MHC CLASS II I-AD; CHAIN A; FRAGMENT RESIDUES 126P - 138P OF CHAIN B ARE COVALENTLY LI INFLUENZA HEMAGGLUTININ PEPTIDE; ENGINEERED YES; MOL_ID 2; MOLECULE MHC CLASS II I-AD; CHAIN B; FRAGMENT RESIDUES 126P - 138P OF CHAIN B ARE COVALENTLY LI INFLUENZA HEMAGGLUTININ PEPTIDE; ENGINEERED YES:MOL_ID 1; FRAGMENT RESIDUES 126P - 138P OF CHAIN B; ORGANISM_SCIENTIFIC MUS MUSCULUS; ORGANISM_COMMON HOUSE MOUSE; ORGANISM_TAXID 10090; STRAIN BALB-C; CELL_LINE S2; ORGAN TAIL; EXPRESSION_SYSTEM DROSOPHILA MELANOGASTER; EXPRESSION_SYSTEM_COMMON FRUIT FLY; EXPRESSION_SYSTEM_TAXID 7227; EXPRESSION_SYSTEM_CELL_LINE S2; MOL_ID 2; FRAGMENT RESIDUES 126P - 138P OF CHAIN B; ORGANISM_SCIENTIFIC MUS MUSCULUS; ORGANISM_COMMON HOUSE MOUSE; ORGANISM_TAXID 10090; STRAIN BALB/C; CELL_LINE S2; ORGAN TAIL; EXPRESSION_SYSTEM DROSOPHILA MELANOGASTER; EXPRESSION_SYSTEM_COMMON FRUIT FLY; EXPRESSION_SYSTEM_TAXID 7227; EXPRESSION_SYSTEM_CELL_LINE S2: 2.40: 0.25
  +
GHATQGVTAASSHERHFVV-------------QFKGECYYTNGTQRIRLVTRYIYNREEYVRYDSDVGEYRAVTE
  +
LGRPDAEYWN------------------------------------SQPEILERTRAEVDTACRHNYE-------
  +
--GPETSTSLRRLEQPNVAISLSRTEALNH---------------------------------------HNTLVC
  +
SVTDFYPAKIKVRWFRNGQE--ETVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSLKS-PITV---
  +
---------------------------------------------EWSS*
  +
>P1;3DBXA
  +
structureX:3DBX:7 :A:+279 :A:MOL_ID 1; MOLECULE CD1-2 ANTIGEN; CHAIN A; FRAGMENT ECTODOMAIN OF CHICKEN CD1-2, UNP RESIDUES 20-302; ENGINEERED YES; MOL_ID 2; MOLECULE BETA-2-MICROGLOBULIN; CHAIN B; SYNONYM BETA-2-MICROGLOBULIN FORM PI 5.3; ENGINEERED YES:MOL_ID 1; ORGANISM_SCIENTIFIC GALLUS GALLUS; ORGANISM_COMMON CHICKEN; ORGANISM_TAXID 9031; GENE CD1-2; EXPRESSION_SYSTEM SPODOPTERA FRUGIPERDA; EXPRESSION_SYSTEM_TAXID 7108; EXPRESSION_SYSTEM_STRAIN SF9; EXPRESSION_SYSTEM_VECTOR_TYPE BACULOVIRUS SHUTTLE VECTOR; EXPRESSION_SYSTEM_PLASMID PBACPHP10; MOL_ID 2; ORGANISM_SCIENTIFIC HOMO SAPIENS; ORGANISM_COMMON HUMAN; ORGANISM_TAXID 9606; GENE B2M, CDABP0092, HDCMA22P; EXPRESSION_SYSTEM SPODOPTERA FRUGIPERDA; EXPRESSION_SYSTEM_TAXID 7108; EXPRESSION_SYSTEM_STRAIN SF9; EXPRESSION_SYSTEM_VECTOR_TYPE BACULOVIRUS SHUTTLE VECTOR; EXPRESSION_SYSTEM_PLASMID PBACPHP10: 2.00: 0.22
  +
PEESQFFQLFYTLLLGNVS-------------STELTGMALLADVPIMVLDPHTWNLNICRPWVQEITAETEVKK
  +
ILSFSMVGIRNTIRFMHEMTAKAGLDYPRVFQIHTGCKLYTNGTRWSFVNIGEGGRDLVTYELSRERW-------
  +
--VPQRSTLLAKVMSNTLTDLRAVSGFLEHIFSSSFPNYILMLHEEGRTDLERRVPPMAVVFARTAGQVQLLLVC
  +
RVTSFYPRPIAVTWLRDGREVPPSPALSTGTVLPNADLTYQLRSTLLVSPQDGHGYACRVQHCSLGDRSLLV---
  +
---------------------------------------------PWHH*
  +
>P1;Q30201
  +
sequence:Q30201: : : : ::: 0.00: 0.00
  +
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWV
  +
SSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCP
  +
DTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRC
  +
RALNYYPQNITMKWLKDKQPM-DAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEP
  +
SPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*
   
 
<br style="clear:both;">
 
<br style="clear:both;">
Line 17: Line 253:
 
 
 
 
TARGET 47 TPWVSSRISS QMWLQLSQSL KGWDHMFTVD FWTIMENHNH S-KESHTLQV
+
TARGET 47 TPWVSSRISS QMWLQLSQSL KGWDHMFTVD FWTIMENH<font color=red>N</font>H S-KESHTLQV
 
1k5nA 49 apwie-qegp eywdretqic kakaqtdred lrtllryynq seagshtlqn
 
1k5nA 49 apwie-qegp eywdretqic kakaqtdred lrtllryynq seagshtlqn
 
 
Line 24: Line 260:
 
 
 
 
TARGET 96 ILGCEMQEDN S-TEGYWKYG YDGQDHLEFC PDTLDWRAAE PRAWPTKLEW
+
TARGET 96 ILG<font color=red>C</font>EMQED<font color=red>N</font> S-TEGYWKYG YDGQDHLEFC PDTLDWRAAE PRAWPTKLEW
 
1k5nA 98 mygcdvgpdg rllrgyhqha ydgkdyialn edlsswtaad taaqitqrkw
 
1k5nA 98 mygcdvgpdg rllrgyhqha ydgkdyialn edlsswtaad taaqitqrkw
 
 
Line 31: Line 267:
 
 
 
 
TARGET 145 ERHKIRARQN RAYLERDCPA QLQQLLELGR GVLDQQVPPL VKVTHHV-TS
+
TARGET 145 ERHKIRARQN RAYLERD<font color=red>C</font>PA QLQQLLELGR GVLDQQVPPL VKVTHHV-TS
 
1k5nA 148 eaar-vaeql raylegecve wlrrylengk etlqradppk thvthhpisd
 
1k5nA 148 eaar-vaeql raylegecve wlrrylengk etlqradppk thvthhpisd
 
 
Line 38: Line 274:
 
 
 
 
TARGET 194 SVTTLRCRAL NYYPQNITMK WLKDKQPMDA KEFEPKDVLP NGDGTYQGWI
+
TARGET 194 SVTTLR<font color=red>C</font>RAL NYYPQ<font color=red>N</font>ITMK WLKDKQPMDA KEFEPKDVLP NGDGTYQGWI
 
1k5nA 197 heatlrcwal gfypaeitlt wqrdgedqt- qdtelvetrp agdrtfqkwa
 
1k5nA 197 heatlrcwal gfypaeitlt wqrdgedqt- qdtelvetrp agdrtfqkwa
 
 
Line 45: Line 281:
 
 
 
 
TARGET 244 TLAVPPGEEQ RYTCQVEHPG LDQPLIVIWE P
+
TARGET 244 TLAVPPGEEQ RYT<font color=red>C</font>QVEHPG LDQPLIVIWE P
 
1k5nA 246 avvvpsgeeq rytchvqheg lpkpltlrwe p-
 
1k5nA 246 avvvpsgeeq rytchvqheg lpkpltlrwe p-
 
 
Line 63: Line 299:
 
 
 
 
TARGET 49 VSSRISSQMW LQLSQSLKGW DHMFTVDFWT I-MENHNHSK ESHTLQVILG
+
TARGET 49 VSSRISSQMW LQLSQSLKGW DHMFTVDFWT I-MENH<font color=red>N</font>HSK ESHTLQVILG
 
1zs8A 51 mkqe-ppeyw knetehamga sllarrtliy mvtennnkkn dyhtlqevfg
 
1zs8A 51 mkqe-ppeyw knetehamga sllarrtliy mvtennnkkn dyhtlqevfg
 
 
Line 70: Line 306:
 
 
 
 
TARGET 98 CEMQEDNST- EGYWKYGYDG QDHLEFCPDT LDWRAAEPRA WPTKLEWERH
+
TARGET 98 <font color=red>C</font>EMQED<font color=red>N</font>ST- EGYWKYGYDG QDHLEFCPDT LDWRAAEPRA WPTKLEWERH
 
1zs8A 100 cnvahdgsfl gghygltyyg ydyiilnedl nswttegkvg gkfnsvt---
 
1zs8A 100 cnvahdgsfl gghygltyyg ydyiilnedl nswttegkvg gkfnsvt---
 
 
Line 77: Line 313:
 
 
 
 
TARGET 147 KIRARQNRAY LERDCPAQLQ QLLELGRGVL DQQVPPLVKV THHVTSSVTT
+
TARGET 147 KIRARQNRAY LERD<font color=red>C</font>PAQLQ QLLELGRGVL DQQVPPLVKV THHVTSSVTT
 
1zs8A 153 ----egwrty lkgecterfl rcldlgketl lrsdaprthv thk---vtvt
 
1zs8A 153 ----egwrty lkgecterfl rcldlgketl lrsdaprthv thk---vtvt
 
 
Line 84: Line 320:
 
 
 
 
TARGET 197 LRCRALNYYP QNITMKWLKD KQPMDAKEFE PKDVLPNGDG TYQGWITLAV
+
TARGET 197 LR<font color=red>C</font>RALNYYP Q<font color=red>N</font>ITMKWLKD KQPMDAKEFE PKDVLPNGDG TYQGWITLAV
 
1zs8A 200 lrcwalgfyp aditltwkrd gknht-qdme lpdtrpagdg tfqkwaavvv
 
1zs8A 200 lrcwalgfyp aditltwkrd gknht-qdme lpdtrpagdg tfqkwaavvv
 
 
Line 91: Line 327:
 
 
 
 
TARGET 247 PPGEEQRYTC QVEHPGLDQP LIVIWE
+
TARGET 247 PPGEEQRYT<font color=red>C</font> QVEHPGLDQP LIVIWE
 
1zs8A 249 pfgeelrytc hvhheglpgp ltlkwg-
 
1zs8A 249 pfgeelrytc hvhheglpgp ltlkwg-
 
 
Line 100: Line 336:
   
 
=== 2iadB ===
 
=== 2iadB ===
  +
  +
  +
TARGET 1 HSKESHT LQVILG<font color=red>C</font>EMQ ED<font color=red>N</font>-STEGYW KYGYDGQDHL
  +
2iadB 2 ghatqgvtaa s--sherhfv vqfkgecyyt ngtqrirlvt ryiynreeyv
  +
  +
TARGET sssssssss ssssss ssss ssss
  +
2iadB s ssssssssss ssssss sssss ssss
  +
  +
  +
TARGET 37 EFCPDTLDWR AAEPRAWPTK LEWERHKIRA RQNRAYLERD <font color=red>C</font>PAQLQQLLE
  +
2iadB 39 rydsdvgeyr avtelgrpda eywnsqpeil ertraevdta crhnyegp--
  +
  +
TARGET ssss s ss hhhh hhhh hhh hhhhhhhhhh hhh
  +
2iadB ssss s ss hhh hhhh hhh hhhhhhhhhh hhhhhh
  +
  +
  +
TARGET 87 LGRGVLDQQV PPLVKVTHHV TSS---VTTL R<font color=red>C</font>RALNYYPQ <font color=red>N</font>ITMKWLKDK
  +
2iadB 87 etstslrrle qpnvaislsr tealnhhntl vcsvtdfypa kikvrwfrng
  +
  +
TARGET sssssss sss ssssss sssssss
  +
2iadB sssssss sss ssssss sssssss
  +
  +
  +
TARGET 134 QPMDAKEFEP KDVLPNGDGT YQGWITLAVP PGEEQRYT<font color=red>C</font>Q VEHPGLDQPL
  +
2iadB 136 qee-tvgvss tqlirngdwt fqvlvmlemt phqgevytch vehpslkspi
  +
  +
TARGET sss ssss s sss s sssssssss sssss ss s
  +
2iadB sss ssss s sss s sssssssss sssss ss s
  +
  +
  +
TARGET 184 IVIWEP
  +
2iadB 185 tvewss-
  +
  +
TARGET ssss
  +
2iadB ssss
   
 
<br style="clear:both;">
 
<br style="clear:both;">
   
 
=== 3dbxA ===
 
=== 3dbxA ===
  +
  +
  +
TARGET 1 LLRSHSLH YLFMGASEQD LGLSLFEALG YVDDQLFVFY DHESRRVEPR
  +
3dbxA 7 peesqffq lfytlll-gn vssteltgma lladvpimvl dphtwnlnic
  +
  +
TARGET ssss ssssssss ssssssss sss ssssss s sssss
  +
3dbxA ssss sssssss s ssssssss sss ssssss s sssss
  +
  +
  +
TARGET 49 TPWVSSRISS QMWLQLSQSL KGWDHMFTVD FWTIMENH<font color=red>N</font>H SKESHTLQVI
  +
3dbxA 54 rpwvqeitae tevkkilsfs mvgirntirf mhemt-akag ldyprvfqih
  +
  +
TARGET hh hhhh hhhhhhh hhhh ssssss
  +
3dbxA hh hhhhhh hhhhhhh hhhhh hh ssssss
  +
  +
  +
TARGET 99 LG<font color=red>C</font>EMQED<font color=red>N</font>S TEGYWKYGYD GQDHLEFCPD TLDWRAAEPR A--WPTKLEW
  +
3dbxA 103 tgcklytngt rwsfvnigeg grdlvtyels rerwvpqrst llakvmsntl
  +
  +
TARGET ssssss s ssssssssss ssssssss ssssss hhhhhh
  +
3dbxA ssssss s ssssssssss ssssssss ssssss hhhhhhhhhh
  +
  +
  +
TARGET 147 ERHKIRARQN RAYLERD<font color=red>C</font>PA QLQQLLELGR GVLDQQVPPL VKVTHHVTS-
  +
3dbxA 153 tdlravsgfl ehifsssfpn yilmlheegr tdlerrvppm avvfartagq
  +
  +
TARGET h hhhhhh hhhh hhh hhhhhhh hhh s ssssss
  +
3dbxA h hhhhhh hhhh hhh hhhhhhh hhh s ssssssss
  +
  +
  +
TARGET 196 SVTTLR<font color=red>C</font>RAL NYYPQ<font color=red>N</font>ITMK WLKDKQPMD- AKEFEPKDVL PNGDGTYQGW
  +
3dbxA 203 vqlllvcrvt sfyprpiavt wlrdgrevpp spalstgtvl pnadltyqlr
  +
  +
TARGET ssssssss s sss ssss sss sssss s ss sssss
  +
3dbxA sssssssss s sss ssss sss sssss s ss sssss
  +
  +
  +
TARGET 245 ITLAVPPGEE QRYT<font color=red>C</font>QVEHP GLD-QPLIVI WE
  +
3dbxA 253 stllvspqdg hgyacrvqhc slgdrsllvp whh
  +
  +
TARGET sssss sssssss ssss s
  +
3dbxA sssss sssssss ssss s
   
 
<br style="clear:both;">
 
<br style="clear:both;">

Latest revision as of 15:52, 4 June 2012

Modeller

1K5NA

simple modeller alignment

>P1;1K5N
structureX:1K5N:   1 :A:+276 :A:MOL_ID  1; MOLECULE  MAJOR HISTOCOMPATIBILITY COMPLEX MOLECULE HLA-B*2 CHAIN  A; FRAGMENT  HLA-B*2709 HEAVY CHAIN, EXTRACELLULAR DOMAIN; SYNONYM  LYMPHOCYTE ANTIGEN HLA-B27; ENGINEERED  YES; MOL_ID  2; MOLECULE  BETA-2-MICROGLOBULIN, LIGHT CHAIN; CHAIN  B; ENGINEERED  YES; MOL_ID  3; MOLECULE  NONAMERIC MODEL PEPTIDE M9; CHAIN  C; ENGINEERED  YES:MOL_ID  1; ORGANISM_SCIENTIFIC  HOMO SAPIENS; ORGANISM_COMMON  HUMAN; ORGANISM_TAXID  9606; GENE  HLA-B OR HLAB; EXPRESSION_SYSTEM  ESCHERICHIA COLI; EXPRESSION_SYSTEM_TAXID  562; MOL_ID  2; ORGANISM_SCIENTIFIC  HOMO SAPIENS; ORGANISM_COMMON  HUMAN; ORGANISM_TAXID  9606; GENE  B2M; EXPRESSION_SYSTEM  ESCHERICHIA COLI; EXPRESSION_SYSTEM_TAXID  562; MOL_ID  3; SYNTHETIC  YES; OTHER_DETAILS  THIS PEPTIDE WAS CHEMICALLY SYNTHESISED.: 1.09: 0.12
-------------------------GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAP
WIEQE-GPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQHAYDGKDYI
ALNEDLSSWTAADTAAQITQRKWEAARV-AEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
ATLRCWALGFYPAEITLTWQRDGED-QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTL
RWEP-------------------------------------------------*
>P1;Q30201
sequence:Q30201:     : :     : ::: 0.00: 0.00
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHE--SRRVEPRTP
WVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKE-SHTLQVILGCEMQEDNST-EGYWKYGYDGQDHL
EFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHH-VTSSV
TTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIV
IWEPSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*


2d modeller alignment

>P1;1K5N
structureX:1K5N:   1 :A:+276 :A:MOL_ID  1; MOLECULE  MAJOR HISTOCOMPATIBILITY COMPLEX MOLECULE HLA-B*2 CHAIN  A; FRAGMENT  HLA-B*2709 HEAVY CHAIN, EXTRACELLULAR DOMAIN; SYNONYM  LYMPHOCYTE ANTIGEN HLA-B27; ENGINEERED  YES; MOL_ID  2; MOLECULE  BETA-2-MICROGLOBULIN, LIGHT CHAIN; CHAIN  B; ENGINEERED  YES; MOL_ID  3; MOLECULE  NONAMERIC MODEL PEPTIDE M9; CHAIN  C; ENGINEERED  YES:MOL_ID  1; ORGANISM_SCIENTIFIC  HOMO SAPIENS; ORGANISM_COMMON  HUMAN; ORGANISM_TAXID  9606; GENE  HLA-B OR HLAB; EXPRESSION_SYSTEM  ESCHERICHIA COLI; EXPRESSION_SYSTEM_TAXID  562; MOL_ID  2; ORGANISM_SCIENTIFIC  HOMO SAPIENS; ORGANISM_COMMON  HUMAN; ORGANISM_TAXID  9606; GENE  B2M; EXPRESSION_SYSTEM  ESCHERICHIA COLI; EXPRESSION_SYSTEM_TAXID  562; MOL_ID  3; SYNTHETIC  YES; OTHER_DETAILS  THIS PEPTIDE WAS CHEMICALLY SYNTHESISED.: 1.09: 0.12
-G------------------------SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAP
WIE-QEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQHAYDGKDYI
ALNEDLSSWTAADTAAQITQRKWEAARV-AEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
ATLRCWALGFYPAEITLTWQRDGEDQT-QDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTL
RWEP-------------------------------------------------*
>P1;Q30201
sequence:Q30201:     : :     : ::: 0.00: 0.00
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYD--HESRRVEPRTP
WVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSK-ESHTLQVILGCEMQEDNS-TEGYWKYGYDGQDHL
EFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSS-V
TTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIV
IWEPSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*

1ZS8A

simple modeller alignment

>P1;1ZS8
structureX:1ZS8:   1 :A:+261 :A:MOL_ID  1; MOLECULE  HISTOCOMPATIBILITY 2, M REGION LOCUS 10.5; CHAIN  A, C, E, G, I; ENGINEERED  YES; MOL_ID  2; MOLECULE  BETA-2-MICROGLOBULIN; CHAIN  B, D, F, H, J; ENGINEERED  YES:MOL_ID  1; ORGANISM_SCIENTIFIC  MUS MUSCULUS; ORGANISM_COMMON  HOUSE MOUSE; ORGANISM_TAXID  10090; GENE  M10.5; EXPRESSION_SYSTEM  TRICHOPLUSIA NI; EXPRESSION_SYSTEM_COMMON  CABBAGE LOOPER; EXPRESSION_SYSTEM_TAXID  7111; EXPRESSION_SYSTEM_STRAIN  TN5; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS; EXPRESSION_SYSTEM_PLASMID  PACUW31; MOL_ID  2; ORGANISM_SCIENTIFIC  HOMO SAPIENS; ORGANISM_COMMON  HUMAN; ORGANISM_TAXID  9606; GENE  B2M; EXPRESSION_SYSTEM  TRICHOPLUSIA NI; EXPRESSION_SYSTEM_COMMON  CABBAGE LOOPER; EXPRESSION_SYSTEM_TAXID  7111; EXPRESSION_SYSTEM_STRAIN  TN5; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS; EXPRESSION_SYSTEM_PLASMID  PACUW31: 3.00: 0.31
--------------------------SHWLKTFRIVIMEPGILEPRFIQVSYVDSIQYQGFDSRSG-MQPRAAWM
KQEPPEYWKNETEHAMGASLLARRTLIYMVTENNNKKNDYHTLQEVFGCNVAHDGSFLGGHYGLTYYGYDYIILN
EDLNSWTTEGKVG-------GKFNSVTEGWRTYLKGECTERFLRCLDLGKETLLRSDAPRTHVTHKVT---VTLR
CWALGFYPADITLTWKRDGKN-HTQDMELPDTRPAGDGTFQKWAAVVVPFGEELRYTCHVHHEGLPGPLTLKWG-
-------------------------------------------------*
>P1;Q30201
sequence:Q30201:     : :     : ::: 0.00: 0.00
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWV
SSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNS-TEGYWKYGYDGQDHLEFC
PDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLR
CRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEP
SPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*


2d modeller alignment

>P1;1ZS8
structureX:1ZS8:   1 :A:+261 :A:MOL_ID  1; MOLECULE  HISTOCOMPATIBILITY 2, M REGION LOCUS 10.5; CHAIN  A, C, E, G, I; ENGINEERED  YES; MOL_ID  2; MOLECULE  BETA-2-MICROGLOBULIN; CHAIN  B, D, F, H, J; ENGINEERED  YES:MOL_ID  1; ORGANISM_SCIENTIFIC  MUS MUSCULUS; ORGANISM_COMMON  HOUSE MOUSE; ORGANISM_TAXID  10090; GENE  M10.5; EXPRESSION_SYSTEM  TRICHOPLUSIA NI; EXPRESSION_SYSTEM_COMMON  CABBAGE LOOPER; EXPRESSION_SYSTEM_TAXID  7111; EXPRESSION_SYSTEM_STRAIN  TN5; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS; EXPRESSION_SYSTEM_PLASMID  PACUW31; MOL_ID  2; ORGANISM_SCIENTIFIC  HOMO SAPIENS; ORGANISM_COMMON  HUMAN; ORGANISM_TAXID  9606; GENE  B2M; EXPRESSION_SYSTEM  TRICHOPLUSIA NI; EXPRESSION_SYSTEM_COMMON  CABBAGE LOOPER; EXPRESSION_SYSTEM_TAXID  7111; EXPRESSION_SYSTEM_STRAIN  TN5; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS; EXPRESSION_SYSTEM_PLASMID  PACUW31: 3.00: 0.31
--------SHWLKTFRIVIMEPGIL-------------E-----PRFIQVSYVDSIQYQGFDSRS-GMQPRAAWM
KQE-PPEYWKNETEHAMGASLLARRTLIYMVTENNNKKNDYHTLQEVFGCNVAHDGSFLGGHYGLTYYGYDYIIL
NEDLNSWTTEG------KVG-GKFNSVTEGWRTYLKGECTERFLRCLDLGKETLLRSDAPRTHVTHKVT---VTL
RCWALGFYPADITLTWKRDGKN-HTQDMELPDTRPAGDGTFQKWAAVVVPFGEELRYTCHVHHEGLPGPL-----
-----TLKWG----------------------------------------*
>P1;Q30201
sequence:Q30201:     : :     : ::: 0.00: 0.00
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWV
SSRISSQMWLQLSQSLKGWDHMFTVDF-WTIMENHNHSKESHTLQVILGCEMQEDNS-TEGYWKYGYDGQDHLEF
CPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTL
RCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWE
PSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*


2IADB

simple modeller alignment

>P1;2IAD
structureX:2IAD:   2S:B:+201 :B:MOL_ID  1; MOLECULE  MHC CLASS II I-AD; CHAIN  A; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B ARE COVALENTLY LI INFLUENZA HEMAGGLUTININ PEPTIDE; ENGINEERED  YES; MOL_ID  2; MOLECULE  MHC CLASS II I-AD; CHAIN  B; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B ARE COVALENTLY LI INFLUENZA HEMAGGLUTININ PEPTIDE; ENGINEERED  YES:MOL_ID  1; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B; ORGANISM_SCIENTIFIC  MUS MUSCULUS; ORGANISM_COMMON  HOUSE MOUSE; ORGANISM_TAXID  10090; STRAIN  BALB-C; CELL_LINE  S2; ORGAN  TAIL; EXPRESSION_SYSTEM  DROSOPHILA MELANOGASTER; EXPRESSION_SYSTEM_COMMON  FRUIT FLY; EXPRESSION_SYSTEM_TAXID  7227; EXPRESSION_SYSTEM_CELL_LINE  S2; MOL_ID  2; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B; ORGANISM_SCIENTIFIC  MUS MUSCULUS; ORGANISM_COMMON  HOUSE MOUSE; ORGANISM_TAXID  10090; STRAIN  BALB/C; CELL_LINE  S2; ORGAN  TAIL; EXPRESSION_SYSTEM  DROSOPHILA MELANOGASTER; EXPRESSION_SYSTEM_COMMON  FRUIT FLY; EXPRESSION_SYSTEM_TAXID  7227; EXPRESSION_SYSTEM_CELL_LINE  S2: 2.40: 0.25
---------------GHATQGVTAASSHERHFVVQFKGE-------------------CYYTNGTQRIRLVT---
-------------------------------------------------------------RYIYNREEYVRYDS
DVGEYRAVTELGRPDAEYWNSQPEILERTRAEVDTACRHNYEGPETSTSLRRLEQPNVAISLSRTEALNHHNTLV
CSVTDFYPAKIKVRWFRNGQE-ETVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSLKSPITVEWSS
-------------------------------------------------*
>P1;Q30201
sequence:Q30201:     : :     : ::: 0.00: 0.00
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWV
SSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCP
DTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQL-LELGRGVLDQQVPPLVKVTHHVTSSVTTLR
CRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEP
SPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*

2d modeller alignment

>P1;2IAD
structureX:2IAD:   2S:B:+201 :B:MOL_ID  1; MOLECULE  MHC CLASS II I-AD; CHAIN  A; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B ARE COVALENTLY LI INFLUENZA HEMAGGLUTININ PEPTIDE; ENGINEERED  YES; MOL_ID  2; MOLECULE  MHC CLASS II I-AD; CHAIN  B; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B ARE COVALENTLY LI INFLUENZA HEMAGGLUTININ PEPTIDE; ENGINEERED  YES:MOL_ID  1; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B; ORGANISM_SCIENTIFIC  MUS MUSCULUS; ORGANISM_COMMON  HOUSE MOUSE; ORGANISM_TAXID  10090; STRAIN  BALB-C; CELL_LINE  S2; ORGAN  TAIL; EXPRESSION_SYSTEM  DROSOPHILA MELANOGASTER; EXPRESSION_SYSTEM_COMMON  FRUIT FLY; EXPRESSION_SYSTEM_TAXID  7227; EXPRESSION_SYSTEM_CELL_LINE  S2; MOL_ID  2; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B; ORGANISM_SCIENTIFIC  MUS MUSCULUS; ORGANISM_COMMON  HOUSE MOUSE; ORGANISM_TAXID  10090; STRAIN  BALB/C; CELL_LINE  S2; ORGAN  TAIL; EXPRESSION_SYSTEM  DROSOPHILA MELANOGASTER; EXPRESSION_SYSTEM_COMMON  FRUIT FLY; EXPRESSION_SYSTEM_TAXID  7227; EXPRESSION_SYSTEM_CELL_LINE  S2: 2.40: 0.25
-G-HATQGV-------TAA------SSHERH--F---------VVQFKGECYYTN--------GTQRIRLVTRYI
YNR---EEYVRYDSDV-G-------EYRAVTE--------------LG------RPDAEYWNSQ----------P
EILERTRAEVD---T---ACRHNYEGPETSTSLRR--LEQPNVAISLSR------TEAL---NHH-----NTLVC
SVTDFYPAKIKVRWFRNGQE-ETVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSLKSPITVEW--S
-S----------------------------------------------*
>P1;Q30201
sequence:Q30201:     : :     : ::: 0.00: 0.00
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWV
SSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCP
DTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRC
RALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPS
PSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*

3DBXA

simple modeller alignment

>P1;3DBX
structureX:3DBX:   7 :A:+279 :A:MOL_ID  1; MOLECULE  CD1-2 ANTIGEN; CHAIN  A; FRAGMENT  ECTODOMAIN OF CHICKEN CD1-2, UNP RESIDUES 20-302; ENGINEERED  YES; MOL_ID  2; MOLECULE  BETA-2-MICROGLOBULIN; CHAIN  B; SYNONYM  BETA-2-MICROGLOBULIN FORM PI 5.3; ENGINEERED  YES:MOL_ID  1; ORGANISM_SCIENTIFIC  GALLUS GALLUS; ORGANISM_COMMON  CHICKEN; ORGANISM_TAXID  9031; GENE  CD1-2; EXPRESSION_SYSTEM  SPODOPTERA FRUGIPERDA; EXPRESSION_SYSTEM_TAXID  7108; EXPRESSION_SYSTEM_STRAIN  SF9; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS SHUTTLE VECTOR; EXPRESSION_SYSTEM_PLASMID  PBACPHP10; MOL_ID  2; ORGANISM_SCIENTIFIC  HOMO SAPIENS; ORGANISM_COMMON  HUMAN; ORGANISM_TAXID  9606; GENE  B2M, CDABP0092, HDCMA22P; EXPRESSION_SYSTEM  SPODOPTERA FRUGIPERDA; EXPRESSION_SYSTEM_TAXID  7108; EXPRESSION_SYSTEM_STRAIN  SF9; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS SHUTTLE VECTOR; EXPRESSION_SYSTEM_PLASMID  PBACPHP10: 2.00: 0.22
PEESQFFQLFYTLLLGNV------------------SSTELTGMAL------LADVPIMVLDPHTWNLNICRPWV
QE-ITAETEVKKILSFSMVGIRNTIRFMHEMTAKAGLDYPRVFQIHTGCKLYTNGTRWSFVNIGEGGRDLVTYEL
SRERWVPQRSTLLAKVMSNTLTDLRAVSGFLEHIFSSSFPNYILMLHEEGRTDLERRVPPMAVVFARTAGQVQLL
LVCRVTSFYPRPIAVTWLRDGREVPPSPALSTGTVLPNADLTYQLRSTLLVSPQDGHGYACRVQHCSLGDRSLLV
PW-------------------------------------------------HH*
>P1;Q30201
sequence:Q30201:     : :     : ::: 0.00: 0.00
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWV
SSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCP
DTLDWRAAEPRAWPTKLEWERHKIRARQN--RAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTL
R-CRALNYYPQNITMKWLKDKQPMDAK-EFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGL-DQPLIV
IWEPSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*

2d modeller alignment

>P1;3DBX
structureX:3DBX:   7 :A:+279 :A:MOL_ID  1; MOLECULE  CD1-2 ANTIGEN; CHAIN  A; FRAGMENT  ECTODOMAIN OF CHICKEN CD1-2, UNP RESIDUES 20-302; ENGINEERED  YES; MOL_ID  2; MOLECULE  BETA-2-MICROGLOBULIN; CHAIN  B; SYNONYM  BETA-2-MICROGLOBULIN FORM PI 5.3; ENGINEERED  YES:MOL_ID  1; ORGANISM_SCIENTIFIC  GALLUS GALLUS; ORGANISM_COMMON  CHICKEN; ORGANISM_TAXID  9031; GENE  CD1-2; EXPRESSION_SYSTEM  SPODOPTERA FRUGIPERDA; EXPRESSION_SYSTEM_TAXID  7108; EXPRESSION_SYSTEM_STRAIN  SF9; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS SHUTTLE VECTOR; EXPRESSION_SYSTEM_PLASMID  PBACPHP10; MOL_ID  2; ORGANISM_SCIENTIFIC  HOMO SAPIENS; ORGANISM_COMMON  HUMAN; ORGANISM_TAXID  9606; GENE  B2M, CDABP0092, HDCMA22P; EXPRESSION_SYSTEM  SPODOPTERA FRUGIPERDA; EXPRESSION_SYSTEM_TAXID  7108; EXPRESSION_SYSTEM_STRAIN  SF9; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS SHUTTLE VECTOR; EXPRESSION_SYSTEM_PLASMID  PBACPHP10: 2.00: 0.22
------PEESQFFQLFYTLLLGNV--S----------STELTGMALLA-----DVPIMVLDPH-TWNLNICRPWV
Q-EITAETEVKKILSFSMVGIRNTIRFMHEMTAKAGLDYPRVFQIHTGCKLYTNGTRWSFVNIGEGGRDLVTYEL
SRERWVPQRSTLLAKVMSNTLTDLRAVSGFLEHIFSSSFPNYILMLHEEGRTDLERRVPPMAVVFARTAGQVQLL
LVCRVTSFYPRPIAVTWLRDGREVPPSPALSTGTVLPNADLTYQLRSTLLVSPQDGHGYACRVQHCSLGDRSLLV
PWH------------------------------------------H-------
>P1;Q30201
sequence:Q30201:     : :     : ::: 0.00: 0.00
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWV
SSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCP
DTLDWRAAEPRAWPTKLEWERHKIRARQN--RAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSV-TT
LRCRALNYYPQNITMKWLKDKQPMD-AKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGL-DQPLIV
IWEPSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*

MSA1

>P1;1K5NA
structureX:1K5N:1    :A:+276 :A:MOL_ID  1; MOLECULE  MAJOR HISTOCOMPATIBILITY COMPLEX MOLECULE HLA-B*2 CHAIN  A; FRAGMENT  HLA-B*2709 HEAVY CHAIN, EXTRACELLULAR DOMAIN; SYNONYM  LYMPHOCYTE ANTIGEN HLA-B27; ENGINEERED  YES; MOL_ID  2; MOLECULE  BETA-2-MICROGLOBULIN, LIGHT CHAIN; CHAIN  B; ENGINEERED  YES; MOL_ID  3; MOLECULE  NONAMERIC MODEL PEPTIDE M9; CHAIN  C; ENGINEERED  YES:MOL_ID  1; ORGANISM_SCIENTIFIC  HOMO SAPIENS; ORGANISM_COMMON  HUMAN; ORGANISM_TAXID  9606; GENE  HLA-B OR HLAB; EXPRESSION_SYSTEM  ESCHERICHIA COLI; EXPRESSION_SYSTEM_TAXID  562; MOL_ID  2; ORGANISM_SCIENTIFIC  HOMO SAPIENS; ORGANISM_COMMON  HUMAN; ORGANISM_TAXID  9606; GENE  B2M; EXPRESSION_SYSTEM  ESCHERICHIA COLI; EXPRESSION_SYSTEM_TAXID  562; MOL_ID  3; SYNTHETIC  YES; OTHER_DETAILS  THIS PEPTIDE WAS CHEMICALLY SYNTHESISED.: 1.09: 0.12
GSHSMRYFHTSVSRPGRGE-----------------------PRFITVGYVDDTLFVRFDSDAASPREEPRAPWI
EQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQHAYDGKDYIALN
EDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLR
CWALGFYPAEITLTWQRDGEDQ--TQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGL-PKPLT---
---------------------------------------------LRWEP*
>P1;1ZS8A
structureX:1ZS8:1    :A:+261 :A:MOL_ID  1; MOLECULE  HISTOCOMPATIBILITY 2, M REGION LOCUS 10.5; CHAIN  A, C, E, G, I; ENGINEERED  YES; MOL_ID  2; MOLECULE  BETA-2-MICROGLOBULIN; CHAIN  B, D, F, H, J; ENGINEERED  YES:MOL_ID  1; ORGANISM_SCIENTIFIC  MUS MUSCULUS; ORGANISM_COMMON  HOUSE MOUSE; ORGANISM_TAXID  10090; GENE  M10.5; EXPRESSION_SYSTEM  TRICHOPLUSIA NI; EXPRESSION_SYSTEM_COMMON  CABBAGE LOOPER; EXPRESSION_SYSTEM_TAXID  7111; EXPRESSION_SYSTEM_STRAIN  TN5; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS; EXPRESSION_SYSTEM_PLASMID  PACUW31; MOL_ID  2; ORGANISM_SCIENTIFIC  HOMO SAPIENS; ORGANISM_COMMON  HUMAN; ORGANISM_TAXID  9606; GENE  B2M; EXPRESSION_SYSTEM  TRICHOPLUSIA NI; EXPRESSION_SYSTEM_COMMON  CABBAGE LOOPER; EXPRESSION_SYSTEM_TAXID  7111; EXPRESSION_SYSTEM_STRAIN  TN5; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS; EXPRESSION_SYSTEM_PLASMID  PACUW31: 3.00: 0.31
-SHWLKTFRIVIMEPGILE-----------------------PRFIQVSYVDSIQYQGFDSRSGM---QPRAAWM
KQEPPEYWKNETEHAMGASLLARRTLIYMVTENNNKKNDYHTLQEVFGCNVAHDGSFLGGHYGLTYYGYDYIILN
EDLNSWTTEGKVGG------KFNSVTEGWRTYLKGECTERFLRCLDLGKETLLRSDAPRTHVTHKV----TVTLR
CWALGFYPADITLTWKRDGKNH--TQDMELPDTRPAGDGTFQKWAAVVVPFGEELRYTCHVHHEGL-PGPLT---
---------------------------------------------LKWG-*
>P1;2IADB
structureX:2IAD:2S   :B:+201 :B:MOL_ID  1; MOLECULE  MHC CLASS II I-AD; CHAIN  A; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B ARE COVALENTLY LI INFLUENZA HEMAGGLUTININ PEPTIDE; ENGINEERED  YES; MOL_ID  2; MOLECULE  MHC CLASS II I-AD; CHAIN  B; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B ARE COVALENTLY LI INFLUENZA HEMAGGLUTININ PEPTIDE; ENGINEERED  YES:MOL_ID  1; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B; ORGANISM_SCIENTIFIC  MUS MUSCULUS; ORGANISM_COMMON  HOUSE MOUSE; ORGANISM_TAXID  10090; STRAIN  BALB-C; CELL_LINE  S2; ORGAN  TAIL; EXPRESSION_SYSTEM  DROSOPHILA MELANOGASTER; EXPRESSION_SYSTEM_COMMON  FRUIT FLY; EXPRESSION_SYSTEM_TAXID  7227; EXPRESSION_SYSTEM_CELL_LINE  S2; MOL_ID  2; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B; ORGANISM_SCIENTIFIC  MUS MUSCULUS; ORGANISM_COMMON  HOUSE MOUSE; ORGANISM_TAXID  10090; STRAIN  BALB/C; CELL_LINE  S2; ORGAN  TAIL; EXPRESSION_SYSTEM  DROSOPHILA MELANOGASTER; EXPRESSION_SYSTEM_COMMON  FRUIT FLY; EXPRESSION_SYSTEM_TAXID  7227; EXPRESSION_SYSTEM_CELL_LINE  S2: 2.40: 0.25
GHATQGVTAASSHERHFVV-----------------------QFKGECYYTNGTQRIRLVTRYIY----------
NREEYVRYDSDVGEYRAVTELGRPDAEYWNSQ-------------------------------------------
----------------------PEILERTRAEVDTACRHNYEGPETSTSLRRLEQPNVAISLSRTEALNHHNTLV
CSVTDFYPAKIKVRWFRNGQEE--TVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSL-KSPIT---
---------------------------------------------VEWSS*
>P1;3DBXA
structureX:3DBX:7    :A:+279 :A:MOL_ID  1; MOLECULE  CD1-2 ANTIGEN; CHAIN  A; FRAGMENT  ECTODOMAIN OF CHICKEN CD1-2, UNP RESIDUES 20-302; ENGINEERED  YES; MOL_ID  2; MOLECULE  BETA-2-MICROGLOBULIN; CHAIN  B; SYNONYM  BETA-2-MICROGLOBULIN FORM PI 5.3; ENGINEERED  YES:MOL_ID  1; ORGANISM_SCIENTIFIC  GALLUS GALLUS; ORGANISM_COMMON  CHICKEN; ORGANISM_TAXID  9031; GENE  CD1-2; EXPRESSION_SYSTEM  SPODOPTERA FRUGIPERDA; EXPRESSION_SYSTEM_TAXID  7108; EXPRESSION_SYSTEM_STRAIN  SF9; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS SHUTTLE VECTOR; EXPRESSION_SYSTEM_PLASMID  PBACPHP10; MOL_ID  2; ORGANISM_SCIENTIFIC  HOMO SAPIENS; ORGANISM_COMMON  HUMAN; ORGANISM_TAXID  9606; GENE  B2M, CDABP0092, HDCMA22P; EXPRESSION_SYSTEM  SPODOPTERA FRUGIPERDA; EXPRESSION_SYSTEM_TAXID  7108; EXPRESSION_SYSTEM_STRAIN  SF9; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS SHUTTLE VECTOR; EXPRESSION_SYSTEM_PLASMID  PBACPHP10: 2.00: 0.22
PEESQFFQLFYTLLLGNVS-----------------------STELTGMALLADVPIMVLDPHTWNLNICRPWVQ
EITAETEVKKILSFSMVGIRNTIRFMHEMTAKAGLDYPRVFQIHTGCKLYTNGTRWSFVNIGEGGRDLVTYELSR
ERWVPQRSTLLAKVMSNTLTDLRAVSGFLEHIFSSSFPNYILMLHEEGRTDLERRVPPMAVVFARTAGQVQLLLV
CRVTSFYPRPIAVTWLRDGREVPPSPALSTGTVLPNADLTYQLRSTLLVSPQDGHGYACRVQHCSLGDRSLL---
---------------------------------------------VPWHH* 
>P1;Q30201
sequence:Q30201:     : :     : ::: 0.00: 0.00
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWV
SSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCP
DTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVT-TLR
CRALNYYPQNITMKWLKDKQPMD-AKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWE
PSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*

MSA2

>P1;1ZS8A
structureX:1ZS8:1    :A:+261 :A:MOL_ID  1; MOLECULE  HISTOCOMPATIBILITY 2, M REGION LOCUS 10.5; CHAIN  A, C, E, G, I; ENGINEERED  YES; MOL_ID  2; MOLECULE  BETA-2-MICROGLOBULIN; CHAIN  B, D, F, H, J; ENGINEERED  YES:MOL_ID  1; ORGANISM_SCIENTIFIC  MUS MUSCULUS; ORGANISM_COMMON  HOUSE MOUSE; ORGANISM_TAXID  10090; GENE  M10.5; EXPRESSION_SYSTEM  TRICHOPLUSIA NI; EXPRESSION_SYSTEM_COMMON  CABBAGE LOOPER; EXPRESSION_SYSTEM_TAXID  7111; EXPRESSION_SYSTEM_STRAIN  TN5; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS; EXPRESSION_SYSTEM_PLASMID  PACUW31; MOL_ID  2; ORGANISM_SCIENTIFIC  HOMO SAPIENS; ORGANISM_COMMON  HUMAN; ORGANISM_TAXID  9606; GENE  B2M; EXPRESSION_SYSTEM  TRICHOPLUSIA NI; EXPRESSION_SYSTEM_COMMON  CABBAGE LOOPER; EXPRESSION_SYSTEM_TAXID  7111; EXPRESSION_SYSTEM_STRAIN  TN5; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS; EXPRESSION_SYSTEM_PLASMID  PACUW31: 3.00: 0.31
SHWLKTFRI--VIMEPGILEPRFIQVSYVDSIQYQGFDSRSGMQPRAAWMK----QEPPEYWKNETEHAMGASLL
ARRTLIYMVTENNNKKNDYHTLQEVFGCNVAHDGSFL-------------------------GGHYGLTYYGYDY
IILNEDLNSWTTEGKVGGKFNSVTEGWRTYLKGECTERFLRCLDLGKETLLRSDAPRTHV-----THKVTVTLRC
WALGFYPADITLTWKRDGKN--HTQDMELPDTRPAGDGTFQKWAAVVVPFGEELRYTCHVHHEGLPG-PLT----
--------------------------------------------LKWG-*
>P1;2IADB
structureX:2IAD:2S   :B:+201 :B:MOL_ID  1; MOLECULE  MHC CLASS II I-AD; CHAIN  A; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B ARE COVALENTLY LI INFLUENZA HEMAGGLUTININ PEPTIDE; ENGINEERED  YES; MOL_ID  2; MOLECULE  MHC CLASS II I-AD; CHAIN  B; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B ARE COVALENTLY LI INFLUENZA HEMAGGLUTININ PEPTIDE; ENGINEERED  YES:MOL_ID  1; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B; ORGANISM_SCIENTIFIC  MUS MUSCULUS; ORGANISM_COMMON  HOUSE MOUSE; ORGANISM_TAXID  10090; STRAIN  BALB-C; CELL_LINE  S2; ORGAN  TAIL; EXPRESSION_SYSTEM  DROSOPHILA MELANOGASTER; EXPRESSION_SYSTEM_COMMON  FRUIT FLY; EXPRESSION_SYSTEM_TAXID  7227; EXPRESSION_SYSTEM_CELL_LINE  S2; MOL_ID  2; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B; ORGANISM_SCIENTIFIC  MUS MUSCULUS; ORGANISM_COMMON  HOUSE MOUSE; ORGANISM_TAXID  10090; STRAIN  BALB/C; CELL_LINE  S2; ORGAN  TAIL; EXPRESSION_SYSTEM  DROSOPHILA MELANOGASTER; EXPRESSION_SYSTEM_COMMON  FRUIT FLY; EXPRESSION_SYSTEM_TAXID  7227; EXPRESSION_SYSTEM_CELL_LINE  S2: 2.40: 0.25
GHATQG-------VTAASSHERHFVVQFKGECYYTNGTQRIRLVTRYIYNR----EEYVRYDSDVGEYRAVTEL-
---------------------------------------------------------------GRPDAEYWNSQP
EILERTRAEVDTACRHNYEGPETSTSLRRLEQPNVAISLSRTEALNHHN----------------------TLVC
SVTDFYPAKIKVRWFRNGQE--ETVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSLKS-PIT----
--------------------------------------------VEWSS*
>P1;3DBXA
structureX:3DBX:7    :A:+279 :A:MOL_ID  1; MOLECULE  CD1-2 ANTIGEN; CHAIN  A; FRAGMENT  ECTODOMAIN OF CHICKEN CD1-2, UNP RESIDUES 20-302; ENGINEERED  YES; MOL_ID  2; MOLECULE  BETA-2-MICROGLOBULIN; CHAIN  B; SYNONYM  BETA-2-MICROGLOBULIN FORM PI 5.3; ENGINEERED  YES:MOL_ID  1; ORGANISM_SCIENTIFIC  GALLUS GALLUS; ORGANISM_COMMON  CHICKEN; ORGANISM_TAXID  9031; GENE  CD1-2; EXPRESSION_SYSTEM  SPODOPTERA FRUGIPERDA; EXPRESSION_SYSTEM_TAXID  7108; EXPRESSION_SYSTEM_STRAIN  SF9; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS SHUTTLE VECTOR; EXPRESSION_SYSTEM_PLASMID  PBACPHP10; MOL_ID  2; ORGANISM_SCIENTIFIC  HOMO SAPIENS; ORGANISM_COMMON  HUMAN; ORGANISM_TAXID  9606; GENE  B2M, CDABP0092, HDCMA22P; EXPRESSION_SYSTEM  SPODOPTERA FRUGIPERDA; EXPRESSION_SYSTEM_TAXID  7108; EXPRESSION_SYSTEM_STRAIN  SF9; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS SHUTTLE VECTOR; EXPRESSION_SYSTEM_PLASMID  PBACPHP10: 2.00: 0.22
PEESQFFQLFYTLLLGNVSSTELTGMALLADVPIMVLDPHTWNLNICRPWV----QEITAETEVKKILSFSMVGI
RNTIRFMHEMTAKAGLDYPRVFQIHTGCKLYTNGTRW------------------SFVNIGEGGRDLVTYELSRE
RWVPQRSTLLAKVMSNTLTDLRAVSGFLEHIFSSSFPNYILMLHEEGRTDLERRVPPMAVVFARTAGQVQLLLVC
RVTSFYPRPIAVTWLRDGREVPPSPALSTGTVLPNADLTYQLRSTLLVSPQDGHGYACRVQHCSLGDRSLL----
--------------------------------------------VPWHH*
>P1;Q30201
sequence:Q30201:     : :     : ::: 0.00: 0.00
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWV
SSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCP
DTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRC
RALNYYPQNITMKWLKDKQPM-DAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEP
SPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*

MSA3

>P1;2IADB
structureX:2IAD:2S   :B:+201 :B:MOL_ID  1; MOLECULE  MHC CLASS II I-AD; CHAIN  A; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B ARE COVALENTLY LI INFLUENZA HEMAGGLUTININ PEPTIDE; ENGINEERED  YES; MOL_ID  2; MOLECULE  MHC CLASS II I-AD; CHAIN  B; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B ARE COVALENTLY LI INFLUENZA HEMAGGLUTININ PEPTIDE; ENGINEERED  YES:MOL_ID  1; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B; ORGANISM_SCIENTIFIC  MUS MUSCULUS; ORGANISM_COMMON  HOUSE MOUSE; ORGANISM_TAXID  10090; STRAIN  BALB-C; CELL_LINE  S2; ORGAN  TAIL; EXPRESSION_SYSTEM  DROSOPHILA MELANOGASTER; EXPRESSION_SYSTEM_COMMON  FRUIT FLY; EXPRESSION_SYSTEM_TAXID  7227; EXPRESSION_SYSTEM_CELL_LINE  S2; MOL_ID  2; FRAGMENT  RESIDUES 126P - 138P OF CHAIN B; ORGANISM_SCIENTIFIC  MUS MUSCULUS; ORGANISM_COMMON  HOUSE MOUSE; ORGANISM_TAXID  10090; STRAIN  BALB/C; CELL_LINE  S2; ORGAN  TAIL; EXPRESSION_SYSTEM  DROSOPHILA MELANOGASTER; EXPRESSION_SYSTEM_COMMON  FRUIT FLY; EXPRESSION_SYSTEM_TAXID  7227; EXPRESSION_SYSTEM_CELL_LINE  S2: 2.40: 0.25
GHATQGVTAASSHERHFVV-------------QFKGECYYTNGTQRIRLVTRYIYNREEYVRYDSDVGEYRAVTE
LGRPDAEYWN------------------------------------SQPEILERTRAEVDTACRHNYE-------
--GPETSTSLRRLEQPNVAISLSRTEALNH---------------------------------------HNTLVC
SVTDFYPAKIKVRWFRNGQE--ETVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSLKS-PITV---
---------------------------------------------EWSS*
>P1;3DBXA
structureX:3DBX:7    :A:+279 :A:MOL_ID  1; MOLECULE  CD1-2 ANTIGEN; CHAIN  A; FRAGMENT  ECTODOMAIN OF CHICKEN CD1-2, UNP RESIDUES 20-302; ENGINEERED  YES; MOL_ID  2; MOLECULE  BETA-2-MICROGLOBULIN; CHAIN  B; SYNONYM  BETA-2-MICROGLOBULIN FORM PI 5.3; ENGINEERED  YES:MOL_ID  1; ORGANISM_SCIENTIFIC  GALLUS GALLUS; ORGANISM_COMMON  CHICKEN; ORGANISM_TAXID  9031; GENE  CD1-2; EXPRESSION_SYSTEM  SPODOPTERA FRUGIPERDA; EXPRESSION_SYSTEM_TAXID  7108; EXPRESSION_SYSTEM_STRAIN  SF9; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS SHUTTLE VECTOR; EXPRESSION_SYSTEM_PLASMID  PBACPHP10; MOL_ID  2; ORGANISM_SCIENTIFIC  HOMO SAPIENS; ORGANISM_COMMON  HUMAN; ORGANISM_TAXID  9606; GENE  B2M, CDABP0092, HDCMA22P; EXPRESSION_SYSTEM  SPODOPTERA FRUGIPERDA; EXPRESSION_SYSTEM_TAXID  7108; EXPRESSION_SYSTEM_STRAIN  SF9; EXPRESSION_SYSTEM_VECTOR_TYPE  BACULOVIRUS SHUTTLE VECTOR; EXPRESSION_SYSTEM_PLASMID  PBACPHP10: 2.00: 0.22
PEESQFFQLFYTLLLGNVS-------------STELTGMALLADVPIMVLDPHTWNLNICRPWVQEITAETEVKK
ILSFSMVGIRNTIRFMHEMTAKAGLDYPRVFQIHTGCKLYTNGTRWSFVNIGEGGRDLVTYELSRERW-------
--VPQRSTLLAKVMSNTLTDLRAVSGFLEHIFSSSFPNYILMLHEEGRTDLERRVPPMAVVFARTAGQVQLLLVC
RVTSFYPRPIAVTWLRDGREVPPSPALSTGTVLPNADLTYQLRSTLLVSPQDGHGYACRVQHCSLGDRSLLV---
---------------------------------------------PWHH*
>P1;Q30201
sequence:Q30201:     : :     : ::: 0.00: 0.00
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWV
SSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCP
DTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRC
RALNYYPQNITMKWLKDKQPM-DAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEP
SPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE*


SwissModel


1k5nA

TARGET    1       RSHSLHYL FMGASEQDLG LSLFEALGYV DDQLFVFYDH ES--RRVEPR
1k5nA     1       gshsmryf htsvsrpgrg eprfitvgyv ddtlfvrfds daaspreepr
                                                                      
TARGET              ssssss sssss        ssssssss s ssssssss        sss
1k5nA               ssssss sssss        ssssssss s ssssssss        sss


TARGET    47    TPWVSSRISS QMWLQLSQSL KGWDHMFTVD FWTIMENHNH S-KESHTLQV
1k5nA     49    apwie-qegp eywdretqic kakaqtdred lrtllryynq seagshtlqn
                                                                      
TARGET            hhh      hhhhhhhhhh hhhhhhhhhh hhhhhhhh        sssss
1k5nA             hhh      hhhhhhhhhh hhhhhhhhhh hhhhhhhh        sssss


TARGET    96    ILGCEMQEDN S-TEGYWKYG YDGQDHLEFC PDTLDWRAAE PRAWPTKLEW
1k5nA     98    mygcdvgpdg rllrgyhqha ydgkdyialn edlsswtaad taaqitqrkw
                                                                      
TARGET          sssssss  s s ssssssss ss sssssss     sssss  hhhhhhhhhh
1k5nA           ssssss        sssssss ss sssssss     sssss  hhhhhhhhhh


TARGET    145   ERHKIRARQN RAYLERDCPA QLQQLLELGR GVLDQQVPPL VKVTHHV-TS
1k5nA     148   eaar-vaeql raylegecve wlrrylengk etlqradppk thvthhpisd
                                                                      
TARGET          hh     hhh hhhhhhhhhh hhhhhhhh            s ssssss    
1k5nA           h    hhhhh hhhhhhhhhh hhhhhhhh            s ssssssss  


TARGET    194   SVTTLRCRAL NYYPQNITMK WLKDKQPMDA KEFEPKDVLP NGDGTYQGWI
1k5nA     197   heatlrcwal gfypaeitlt wqrdgedqt- qdtelvetrp agdrtfqkwa
                                                                      
TARGET            ssssssss s      sss ssss sss      sss  ss s   ssssss
1k5nA           ssssssssss s      sss ssss sss      sss  ss s   ssssss


TARGET    244   TLAVPPGEEQ RYTCQVEHPG LDQPLIVIWE P                    
1k5nA     246   avvvpsgeeq rytchvqheg lpkpltlrwe p-                   
                                                                      
TARGET          ssss    hh sssssss        sss                         
1k5nA           ssssss  hh sssssss        sss                         


1zs8A

TARGET    1       SHSLHYLF MGASEQDLGL SLFEALGYVD DQLFVFYDHE SRRVEPRTPW
1zs8A     1       shwlktfr ivimepgile prfiqvsyvd siqyqgfdsr sg-mqpraaw
                                                                      
TARGET             sssssss ssss        sssssssss  ssssssss      sss  h
1zs8A              sssssss ssss        sssssssss  ssssssss      sss  h


TARGET    49    VSSRISSQMW LQLSQSLKGW DHMFTVDFWT I-MENHNHSK ESHTLQVILG
1zs8A     51    mkqe-ppeyw knetehamga sllarrtliy mvtennnkkn dyhtlqevfg
                                                                      
TARGET          h      hhh hhhhhhhhhh hhhhhhhhhh              ssssssss
1zs8A           h      hhh hhhhhhhhhh hhhhhhhhhh hhhhh        ssssssss


TARGET    98    CEMQEDNST- EGYWKYGYDG QDHLEFCPDT LDWRAAEPRA WPTKLEWERH
1zs8A     100   cnvahdgsfl gghygltyyg ydyiilnedl nswttegkvg gkfnsvt---
                                                                      
TARGET          ssss  sss  sssssssss   ssssss     sssss               
1zs8A           ssss   sss sssssssss   ssssss     sssss          hh   


TARGET    147   KIRARQNRAY LERDCPAQLQ QLLELGRGVL DQQVPPLVKV THHVTSSVTT
1zs8A     153   ----egwrty lkgecterfl rcldlgketl lrsdaprthv thk---vtvt
                                                                      
TARGET               hhhhh hhhhhhhhhh hhhh   hhh       ssss sss     ss
1zs8A               hhhhhh h   hhhhhh hhh   hhhh       ssss sss     ss


TARGET    197   LRCRALNYYP QNITMKWLKD KQPMDAKEFE PKDVLPNGDG TYQGWITLAV
1zs8A     200   lrcwalgfyp aditltwkrd gknht-qdme lpdtrpagdg tfqkwaavvv
                                                                      
TARGET          sssssss       sssssss                sss    ssssssssss
1zs8A           sssssss       sssssss                sss    ssssssssss


TARGET    247   PPGEEQRYTC QVEHPGLDQP LIVIWE                          
1zs8A     249   pfgeelrytc hvhheglpgp ltlkwg-                         
                                                                      
TARGET                ssss sss        sss                             
1zs8A                 ssss sss        sss                             


2iadB

TARGET    1                   HSKESHT LQVILGCEMQ EDN-STEGYW KYGYDGQDHL
2iadB     2     ghatqgvtaa s--sherhfv vqfkgecyyt ngtqrirlvt ryiynreeyv
                                                                      
TARGET                                 sssssssss     ssssss ssss  ssss
2iadB                               s ssssssssss     ssssss sssss ssss


TARGET    37    EFCPDTLDWR AAEPRAWPTK LEWERHKIRA RQNRAYLERD CPAQLQQLLE
2iadB     39    rydsdvgeyr avtelgrpda eywnsqpeil ertraevdta crhnyegp--
                                                                      
TARGET          ssss     s ss    hhhh hhhh   hhh hhhhhhhhhh    hhh    
2iadB           ssss     s ss     hhh hhhh   hhh hhhhhhhhhh hhhhhh    


TARGET    87    LGRGVLDQQV PPLVKVTHHV TSS---VTTL RCRALNYYPQ NITMKWLKDK
2iadB     87    etstslrrle qpnvaislsr tealnhhntl vcsvtdfypa kikvrwfrng
                                                                      
TARGET                       sssssss         sss ssssss       sssssss 
2iadB                        sssssss         sss ssssss       sssssss 


TARGET    134   QPMDAKEFEP KDVLPNGDGT YQGWITLAVP PGEEQRYTCQ VEHPGLDQPL
2iadB     136   qee-tvgvss tqlirngdwt fqvlvmlemt phqgevytch vehpslkspi
                                                                      
TARGET          sss   ssss s  sss   s sssssssss       sssss ss       s
2iadB           sss   ssss s  sss   s sssssssss       sssss ss       s


TARGET    184   IVIWEP                                                
2iadB     185   tvewss-                                               
                                                                      
TARGET          ssss                                                  
2iadB           ssss                                                  


3dbxA

TARGET    1       LLRSHSLH YLFMGASEQD LGLSLFEALG YVDDQLFVFY DHESRRVEPR
3dbxA     7       peesqffq lfytlll-gn vssteltgma lladvpimvl dphtwnlnic
                                                                      
TARGET                ssss ssssssss     ssssssss sss ssssss s    sssss
3dbxA                 ssss sssssss s    ssssssss sss ssssss s    sssss


TARGET    49    TPWVSSRISS QMWLQLSQSL KGWDHMFTVD FWTIMENHNH SKESHTLQVI
3dbxA     54    rpwvqeitae tevkkilsfs mvgirntirf mhemt-akag ldyprvfqih
                                                                      
TARGET            hh         hhhh        hhhhhhh hhhh           ssssss
3dbxA             hh         hhhhhh      hhhhhhh hhhhh hh       ssssss


TARGET    99    LGCEMQEDNS TEGYWKYGYD GQDHLEFCPD TLDWRAAEPR A--WPTKLEW
3dbxA     103   tgcklytngt rwsfvnigeg grdlvtyels rerwvpqrst llakvmsntl
                                                                      
TARGET          ssssss   s ssssssssss  ssssssss   ssssss        hhhhhh
3dbxA           ssssss   s ssssssssss  ssssssss   ssssss    hhhhhhhhhh


TARGET    147   ERHKIRARQN RAYLERDCPA QLQQLLELGR GVLDQQVPPL VKVTHHVTS-
3dbxA     153   tdlravsgfl ehifsssfpn yilmlheegr tdlerrvppm avvfartagq
                                                                      
TARGET          h   hhhhhh hhhh   hhh hhhhhhh    hhh      s ssssss    
3dbxA           h   hhhhhh hhhh   hhh hhhhhhh    hhh      s ssssssss  


TARGET    196   SVTTLRCRAL NYYPQNITMK WLKDKQPMD- AKEFEPKDVL PNGDGTYQGW
3dbxA     203   vqlllvcrvt sfyprpiavt wlrdgrevpp spalstgtvl pnadltyqlr
                                                                      
TARGET            ssssssss s      sss ssss sss     sssss  s ss   sssss
3dbxA            sssssssss s      sss ssss sss     sssss  s ss   sssss


TARGET    245   ITLAVPPGEE QRYTCQVEHP GLD-QPLIVI WE                   
3dbxA     253   stllvspqdg hgyacrvqhc slgdrsllvp whh                  
                                                                      
TARGET          sssss       sssssss         ssss s                    
3dbxA           sssss       sssssss         ssss s