Homology-modelling HEXA/3lut.pir,

From Bioinformatikpedia
Revision as of 15:30, 11 June 2011 by Link (talk | contribs) (Created page with " >P1;3LUT<br> structureX:/home/student/week4/3LUT.pdb: 36 :A:+326 :A:MOL_ID 1; MOLECULE VOLTAGE-GATED POTASSIUM<br> CHANNEL SUBUNIT BETA-2; CHAIN A; SYNONYM K(+) CHANNEL S…")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
>P1;3LUT
structureX:/home/student/week4/3LUT.pdb: 36 :A:+326 :A:MOL_ID 1; MOLECULE VOLTAGE-GATED POTASSIUM
CHANNEL SUBUNIT BETA-2; CHAIN A; SYNONYM K(+) CHANNEL SUBUNIT BETA-2, KV-BETA-2; ENGINEERED YES;
MOL_ID 2; MOLECULE POTASSIUM VOLTAGE-GATED CHANNEL SUBFAMILY A MEMBE CHAIN B; SYNONYM
VOLTAGE-GATED POTASSIUM CHANNEL SUBUNIT KV1.2, RBK RAK; ENGINEERED YES; MUTATION YES:MOL_ID 1;
ORGANISM_SCIENTIFIC RATTUS NORVEGICUS; ORGANISM_COMMON RAT; ORGANISM_TAXID 10116; GENE KCNAB2,
CKBETA2, KCNB3; EXPRESSION_SYSTEM PICHIA PASTORIS; EXPRESSION_SYSTEM_TAXID 4922; MOL_ID 2;
ORGANISM_SCIENTIFIC RATTUS NORVEGICUS; ORGANISM_COMMON RAT; ORGANISM_TAXID 10116; GENE KCNA2;
EXPRESSION_SYSTEM PICHIA PASTORIS; EXPRESSION_SYSTEM_TAXID 4922: 2.90: 0.21
L----QFYRNLGKSGLRVSCLGLGTW-----------------------VTFGGQ----ITDEMAEHLMTLAYDN
GI--NLFDTAEVYAAGKAEVVLGNIIK-------KKGWRRSSLVIT-------TKIFWG---G---------K-A
E-------TE---------RGL----SRKHI-IEGLKASLERLQLEYVDVVFANR-PDPNTPME----------E
TVRAMTHVINQ-------------G---MA--------MYWG-----------------------------TSRW
SSMEIMEAYSVARQFNL------IPPICEQAEYHM--FQREK--------VEV----QLPELFHKIGVGAMTWSP
LACGIVSGKYDS-------GIPP-Y-SRASL--K-GYQWLKDKILSEEGRRQQAKLKELQAIAERLG--CTLPQL
AIAW----CLRNEGVSSVLLGAS---NAEQLMENIGAIQVLPKLS---SSIVHEIDSILG----NKPY-------
----S*

>P1;hexa
sequence:reference:  : :  : :::-1.00:-1.00
MTSSRLWFSLLLAAAFAGRATALWPWPQNFQTSDQRYVLYPNNFQFQYDVSSAAQPGCSVLDEAFQRYRDLLFGS
GSWPRPYLTGKRHTLEKNVLVVSVVTPGCNQLPTLESVENYTLTINDDQCLLLSETVWGALRGLETFSQLVWKSA
EGTFFINKTEIEDFPRFPHRGLLLDTSRHYLPLSSILDTLDVMAYNKLNVFHWHLVDDPSFPYESFTFPELMRKG
SYNPVTHIYTAQDVKEVIEYARLRGIRVLAEFDTPGHTLSWGPGIPGLLTPCYSGSEPSGTFGPVNPSLNNTYEF
MSTFFLEVSSVFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGKGYVVWQE
VFDNKVKIQPDTIIQVWREDIPVNYMKELELVTKAGFRALLSAPWYLNRISYGPDWKDF-YIVEPLAFEGTPEQK
ALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLWSNKLTSDLTFAYERLSHFRCELLRRGVQAQPLNVGFCEQ
EFEQT*


Back to [Homology Modelling]