Homology-modelling HEXA/3cui.pir

From Bioinformatikpedia
Revision as of 15:28, 11 June 2011 by Link (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
>P1;3CUI
structureX:3CUI.pdb: 1 :A:+314 :A:MOL_ID 1; MOLECULE EXO-BETA-1,4-GLUCANASE; CHAIN A; FRAGMENT
SEQUENCE DATABASE RESIDUES 43-357; SYNONYM CELLULOMONAS FIMI FAMILY 10 XYLANASE/CELLULASE; BETA 1,4
ENDO-XYLANASE ; CEX ;CF XYN10A; EC 3.2.1.91; ENGINEERED YES:MOL_ID 1; ORGANISM_SCIENTIFIC
CELLULOMONAS FIMI; ORGANISM_TAXID 1708; GENE CEX; EXPRESSION_SYSTEM ESCHERICHIA COLI;
EXPRESSION_SYSTEM_TAXID 562; EXPRESSION_SYSTEM_VECTOR_TYPE PLASMID; EXPRESSION_SYSTEM_PLASMID
PUC12: 1.50: 0.14
AT------TLKEAADGAG--------------RDFGFALDPNRL-------SEAQYK-AIADSEF----NLVVAE
-----------------NAMKWDATEP---------SQNSFSFGAGDRVASYAADT--G--KELYGHT-LVWHS-
---------QLPDWAKNLN-GSAFE-SAMVNHVTKVADHFE----GK--VASWDVVN------EAFA------DG
GGRRQDSAFQQKLGNGYIETA-FRAARAAD----P--T----------AKLCINDYNVEG----INAKSNSLYDL
VKDFKARGVPLDCVGFQSHLIVGQV--------P-----------G-DFRQ----NLQRFADLG-----------
----VDVRITELDI----RMRTPS---DATKLATQAA---------------------DYKKVVQACMQVTRCQG
VTVWG--------ITDKYSWVPDVFP--GEGAALVW------DASYA-----------------KKPAYAAVMEA
-FG-A*

>P1;hexa
sequence:reference:  : :  : :::-1.00:-1.00
MTSSRLWFSLLLAAAFAGRATALWPWPQNFQTSDQRYVLYPNNFQFQYDVSSAAQPGCSVLDEAFQRYRDLLFGS
GSWPRPYLTGKRHTLEKNVLVVSVVTPGCNQLPTLESVENYTLTINDDQCLLLSETVWGALRGLETFSQLVWKSA
EGTFFINKTEIEDFPRFPHRGLLLDTSRHYLPLSSILDTLDVMAYNKLNVFHWHLVDDPSFPYESFTFPELMRKG
SYNPVTHIYTAQDVKEVIEYARLRGIRVLAEFDTPGHTLSWGPGIPGLLTPCYSGSEPSGTFGPVNPSLNNTYEF
MSTFFLE-VSSVFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGKGYVVWQ
EVFDNKVKIQPDTIIQVWREDIPVNYMKELELVTKAGFRALLSAPWYLNRISYGPDWKDFYIVEPLAFEGTPEQK
ALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLWSNKLTSDLTFAYERLSHFRCELLRRGVQAQPLNVGFCEQ
EFEQT*


Back to [Homology Modelling]