Homology-modelling HEXA/3bc9.pir

From Bioinformatikpedia
Revision as of 15:27, 11 June 2011 by Link (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
>P1;3BC9
structureX:3BC9.pdb: 15 :A:+585 :A:MOL_ID 1; MOLECULE ALPHA AMYLASE, CATALYTIC REGION; CHAIN A;
SYNONYM AMYB; EC 3.2.1.1; ENGINEERED YES:MOL_ID 1; ORGANISM_SCIENTIFIC HALOTHERMOTHRIX ORENII H
168; ORGANISM_TAXID 373903; STRAIN H 168; GENE AMYB; EXPRESSION_SYSTEM ESCHERICHIA COLI BL21(DE3);
EXPRESSION_SYSTEM_TAXID 469008; EXPRESSION_SYSTEM_STRAIN BL21(DE3); EXPRESSION_SYSTEM_VECTOR_TYPE
PLASMID; EXPRESSION_SYSTEM_PLASMID PET-19B: 1.35: 0.15
SLFLIESEPSTGASVSKNLTEIILIFSNDINKVSQLALTDLITDSDIQGIDYNIEGNKVIINNFSLEPTCNYRLS
YEVIDIYDNHLQGYIEFLVNQSNYPQIPDQEVNHTILQAFYWEMNTGEYATEHPEEANLWNLLAERAPELAEAGF
TAVWLPPANKGMAGIHDVGYGTYDLWDLGEFDQKGTVRTKYGTKGELENAIDALHNNDIKVYFDAVLNHRMGADY
AETVLLDENSRDKPGQYIKAWTGFNFPGRNGEYSNFTWNGQCFDGTDWDDYSKESGKYLFDE-KSWDWTYNWDED
YLMGADVDYENEAVQNDVIDWGQWIINNIDFDGFRLDAVKHIDYRFIDKWMSAVQNSSNRDVFFVGEAWVEDVDD
LKGFLDTVGNPDLRVFDFPLRSFFVDMLNGAYMADLRNAGLVNSPGYENRAVTFVDNHDTDRDEGSYTVSIYSRK
YQAYAYILTRAEGVPTVYWKDYYIWEMKEGLD-KLLTARRYYAYGPGYEVDNNDADIYSYVRSGFPDVAGDGLVL
MISDGTSGNVAGK-WINSRQPDTEF-YDLTGHIKEHVTTDSEGYGNFKVIKSEDKGWSIWVPVE*

>P1;hexa
sequence:reference:  : :  : :::-1.00:-1.00
------------------MTSSRLWFSLLLAAAFAGRATALWP-WP-QNFQTSDQRYVLYPNNFQFQYDVSSAAQ
PGCSVL-DEAFQRYRDLLFGSGSWPR-PYLTGKRHTLEKNVLVVSV---VT--PGCNQLPTLESVENYTLTINDD
QCLLLSETVWG--ALRGLETFSQLVWKSAE-GTFFINKTEIEDFPRFPHRGLLLDTSRHYLPLSSILDTLDVMAY
NKLNVFHWHLVDDPSFPYESFTFPEL-MRKGSYNPVTHIYTAQDVKEVIEYARLRGIRVLAEFDTPGHTLSW-GP
GIPGLLTPCYSGSEPSGTFGPVNPSLNN-TY-EFMSTFFLEVSSVFPDFYLHLGG-----DEVDFT-CW-KSNPE
IQDFMRKKGF--GEDF-KQLESFYIQTL-LDIVSSYGKGYVVWQEVFDN-KVKIQP----DTIIQVWREDI-PVN
YMKELELVTKA-GFRALLSAPWYLNRISYGPDWKDFYIVEPLAFEGTPEQKALVIGGEACMWGEY--VDNTNLVP
RLWPR-AGAVAERLWSNKLTSDLTFAYERLSHFRCELLRRGVQAQPLNVGFCEQEFEQT-----*



Back to [Homology Modelling]