Difference between revisions of "Fabry:Sequence alignments (sequence searches and multiple alignments)/Journal"
Rackersederj (talk | contribs) (→Comparison) |
Staniewski (talk | contribs) m (moved Fabry:Sequence alignments (sequence searches and multiple alignments):Journal to Fabry:Sequence alignments (sequence searches and multiple alignments)/Journal) |
||
(40 intermediate revisions by 2 users not shown) | |||
Line 1: | Line 1: | ||
+ | [[Fabry Disease]] » [[Fabry:Sequence alignments (sequence searches and multiple alignments)|Sequence alignments]] » Journal |
||
− | Please see [[Fabry:Sequence_alignments_(sequence_searches_and_multiple_alignments):Results | Task 2 Results]] for our results on this topic. |
||
+ | <hr> |
||
− | == Reference sequence == |
||
− | The reference sequence of [[Alpha-galactosidase|α-Galactosidase A]] that will be used in the following tasks was obtained from Swissprot [http://www.uniprot.org/uniprot/P06280 P06280]. |
||
+ | Please see [[Fabry:Sequence_alignments_(sequence_searches_and_multiple_alignments):Scripts | Task 2 Scripts]] for the used scripts. |
||
− | >gi|4504009|ref|NP_000160.1| alpha-galactosidase A precursor [Homo sapiens] |
||
+ | |||
− | MQLRNPELHLGCALALRFLALVSWDIPGARALDNGLARTPTMGWLHWERFMCNLDCQEEPDSCISEKLFM |
||
− | EMAELMVSEGWKDAGYEYLCIDDCWMAPQRDSEGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVGNK |
||
− | TCAGFPGSFGYYDIDAQTFADWGVDLLKFDGCYCDSLENLADGYKHMSLALNRTGRSIVYSCEWPLYMWP |
||
− | FQKPNYTEIRQYCNHWRNFADIDDSWKSIKSILDWTSFNQERIVDVAGPGGWNDPDMLVIGNFGLSWNQQ |
||
− | VTQMALWAIMAAPLFMSNDLRHISPQAKALLQDKDVIAINQDPLGKQGYQLRQGDNFEVWERPLSGLAWA |
||
− | VAMINRQEIGGPRSYTIAVASLGKGVACNPACFITQLLPVKRKLGFYEWTSRLRSHINPTGTVLLQLENT |
||
− | MQMSLKDLL |
||
== Sequence searches == |
== Sequence searches == |
||
Line 18: | Line 11: | ||
blastall -p blastp -d /mnt/project/pracstrucfunc12/data/big/big_80 -i P06280.fasta -m 0 -o blastsearch_default.out -v 700 -b 700 |
blastall -p blastp -d /mnt/project/pracstrucfunc12/data/big/big_80 -i P06280.fasta -m 0 -o blastsearch_default.out -v 700 -b 700 |
||
− | ./extract_ids_blast. |
+ | perl <span class="plainlinks">[https://dl.dropbox.com/u/13796643/fabry/msa_scripts/extract_ids_blast.pl.html extract_ids_blast.pl]</span> blastsearch_default.out |
− | perl ../download-annotation.pl blastsearch_default_ids.txt |
+ | perl ../<span class="plainlinks">[https://dl.dropbox.com/u/13796643/fabry/msa_scripts/download-annotation.pl.html download-annotation.pl]</span> blastsearch_default_ids.txt |
− | perl ../compare_GO_terms.pl P06280 blastsearch_default_ids_GOterms.tsv |
+ | perl ../<span class="plainlinks">[https://dl.dropbox.com/u/13796643/fabry/msa_scripts/compare_GO_terms.pl.html compare_GO_terms.pl]</span> P06280 blastsearch_default_ids_GOterms.tsv |
− | perl parse_blast.pl blastsearch_default.out |
+ | perl <span class="plainlinks">[https://dl.dropbox.com/u/13796643/fabry/msa_scripts/parse_blast.pl.html parse_blast.pl]</span> blastsearch_default.out |
+ | |||
+ | R CMD BATCH <span class="plainlinks">[https://dl.dropbox.com/u/13796643/fabry/msa_scripts/hist_blast.R.html hist_blast.R]</span> |
||
+ | === Psi-Blast === |
||
+ | The following command was used to run Psi-Blast with AGAL as query sequence against big80. It was run with two and ten iterations configured and an e-value cut-off of 2e-3 and 1e-9, respectively. |
||
− | The run took about 2 minutes (see section [[Sequence_alignments_(sequence_searches_and_multiple_alignments)#Time | Time]]) |
||
+ | $ bash <span class="plainlinks">[https://dl.dropbox.com/u/13796643/fabry/msa_scripts/run_psi_blast.sh.html run_psi_blast.sh]</span> &> run_psi_blast.log |
||
− | === Psi-Blast === |
||
+ | The log file contains the runtimes of the different psi-blast runs: |
||
− | Iterations: 2 |
||
+ | |||
− | Evalue: 0.002 |
||
+ | {| style="border-spacing: 0em; text-align: center; margin: 2em 0px;" |
||
− | |||
+ | |- |
||
− | real 3m30.256s |
||
+ | ! scope="col" style="border-bottom: 2px solid #000; padding: 0px 1em;" | Iterations |
||
− | user 2m58.070s |
||
+ | ! scope="col" style="border-bottom: 2px solid #000; padding: 0px 1em; border-left: 2px solid #000;" | E-value cut-off |
||
− | sys 0m13.360s |
||
+ | ! scope="col" style="border-bottom: 2px solid #000; padding: 0px 2em; border-left: 2px solid #000;" | Runtime |
||
− | |||
+ | |- |
||
− | Iterations: 2 |
||
+ | | 2 |
||
− | Evalue: 0.000000001 |
||
+ | | style="border-left: 2px solid #000;" | 2e-3 |
||
− | |||
+ | | style="border-left: 2px solid #000;" | 3m0.814s |
||
− | real 3m8.507s |
||
+ | |- |
||
− | user 3m5.180s |
||
+ | | 2 |
||
− | sys 0m2.400s |
||
+ | | style="border-left: 2px solid #000;" | 1e-9 |
||
− | |||
+ | | style="border-left: 2px solid #000;" | 3m9.422s |
||
− | Iterations: 2 |
||
+ | |- |
||
− | Evalue: 0.0000000001 |
||
+ | | 10 |
||
− | |||
+ | | style="border-left: 2px solid #000;" | 2e-3 |
||
− | real 3m10.271s |
||
+ | | style="border-left: 2px solid #000;" | 14m29.179s |
||
− | user 3m7.620s |
||
+ | |- |
||
− | sys 0m2.190s |
||
+ | | 10 |
||
− | |||
+ | | style="border-left: 2px solid #000;" | 1e-9 |
||
− | Iterations: 10 |
||
+ | | style="border-left: 2px solid #000;" | 15m39.251s |
||
− | Evalue: 0.002 |
||
+ | |- |
||
− | |||
+ | |} |
||
− | real 15m29.218s |
||
+ | |||
− | user 15m8.910s |
||
+ | Afterwards, the psi-blast output was parsed to collect the all the information about all the hits of the last iteration, which include the e-value, the sequence identity, the coverage in the longer sequence of the pairwise alignment and the length of the alignment. When there were more than one alignment per hit, we used the first one which was also listed in the short result output. |
||
− | sys 0m12.730s |
||
+ | |||
− | |||
+ | $ for i in psi_results_*.txt; do |
||
− | Iterations: 10 |
||
+ | perl <span class="plainlinks">[https://dl.dropbox.com/u/13796643/fabry/msa_scripts/parse_psiblast.pl.html parse_psiblast.pl]</span> "$i" > "${i%.*}.stats" |
||
− | Evalue: 0.000000001 |
||
+ | done |
||
− | |||
+ | |||
− | real 16m33.748s |
||
+ | The histograms were generated with the [https://dl.dropbox.com/u/13796643/fabry/msa_scripts/generate_histograms.sh.html generate_histograms.sh] script: |
||
− | user 16m12.500s |
||
+ | $ bash <span class="plainlinks">[https://dl.dropbox.com/u/13796643/fabry/msa_scripts/generate_histograms.sh.html generate_histograms.sh]</span> *.stats |
||
− | sys 0m13.080s |
||
+ | |||
− | |||
+ | GO term comparison |
||
− | Iterations: 10 |
||
+ | |||
− | Evalue: 0.0000000001 |
||
+ | $ perl ../<span class="plainlinks">[https://dl.dropbox.com/u/13796643/fabry/msa_scripts/download-annotation.pl.html download-annotation.pl]</span> ids_psiblast_10its_eVal_1e-9.txt |
||
− | |||
+ | $ perl ../<span class="plainlinks">[https://dl.dropbox.com/u/13796643/fabry/msa_scripts/compare_GO_terms.pl.html compare_GO_terms.pl]</span> P06280 ids_psiblast_10its_eVal_1e-9_GOterms.tsv |
||
− | real 16m20.137s |
||
+ | $ bash <span class="plainlinks">[https://dl.dropbox.com/u/13796643/fabry/msa_scripts/hist_psiblast.sh.html hist_psiblast.sh]</span> ids_psiblast_10its_eVal_1e-9_GOterms_comparison.txt |
||
− | user 15m55.910s |
||
− | sys 0m13.190s |
||
=== HHblits / HHsearch === |
=== HHblits / HHsearch === |
||
Line 74: | Line 69: | ||
time hhblits -i ../P06280.fasta -d /mnt/project/pracstrucfunc12/data/hhblits/uniprot20_current -e 0.003 -o hhblits_default.out -E 0.003 -z 700 |
time hhblits -i ../P06280.fasta -d /mnt/project/pracstrucfunc12/data/hhblits/uniprot20_current -e 0.003 -o hhblits_default.out -E 0.003 -z 700 |
||
− | ./extract_ids_hhblits.sh hhblits_default.out |
+ | ./<span class="plainlinks">[https://dl.dropbox.com/u/13796643/fabry/msa_scripts/extract_ids_hhblits.sh.html extract_ids_hhblits.sh]</span> hhblits_default.out |
+ | perl <span class="plainlinks">[https://dl.dropbox.com/u/13796643/fabry/msa_scripts/parse_hhblits.pl.html parse_hhblits.pl]</span> hhblits_default.out |
||
− | perl ../download-annotation.pl hhblits_default_ids.txt |
||
+ | perl ../<span class="plainlinks">[https://dl.dropbox.com/u/13796643/fabry/msa_scripts/download-annotation.pl.html download-annotation.pl]</span> hhblits_default.out_cluster_ids_only.tsv |
||
− | perl ../compare_GO_terms.pl P06280 hhblits_default_ids_GOterms.tsv |
||
+ | perl ../<span class="plainlinks">[https://dl.dropbox.com/u/13796643/fabry/msa_scripts/compare_GO_terms.pl.html compare_GO_terms.pl]</span> P06280 hhblits_default.out_cluster_ids_only_GOterms.tsv |
||
− | perl parse_hhblits.pl hhblits_default.out |
||
time hhblits -i ../P06280.fasta -d /mnt/project/pracstrucfunc12/data/hhblits/uniprot20_current -e 0.003 -o hhblits_n8_neu.out -E 0.003 -n 8 -z 800 -b 800 |
time hhblits -i ../P06280.fasta -d /mnt/project/pracstrucfunc12/data/hhblits/uniprot20_current -e 0.003 -o hhblits_n8_neu.out -E 0.003 -n 8 -z 800 -b 800 |
||
− | ./extract_ids_hhblits.sh hhblits_n8_neu.out |
+ | ./<span class="plainlinks">[https://dl.dropbox.com/u/13796643/fabry/msa_scripts/extract_ids_hhblits.sh.html extract_ids_hhblits.sh]</span> hhblits_n8_neu.out |
+ | perl <span class="plainlinks">[https://dl.dropbox.com/u/13796643/fabry/msa_scripts/parse_hhblits.pl.html parse_hhblits.pl]</span> hhblits_n8_neu.out |
||
− | perl ../download-annotation.pl hhblits_n8_neu_ids.txt |
||
+ | perl ../<span class="plainlinks">[https://dl.dropbox.com/u/13796643/fabry/msa_scripts/download-annotation.pl.html download-annotation.pl]</span> hhblits_n8_neu.out_cluster_ids_only.tsv |
||
− | perl ../compare_GO_terms.pl P06280 hhblits_n8_neu_ids_GOterms.tsv |
||
+ | perl ../<span class="plainlinks">[https://dl.dropbox.com/u/13796643/fabry/msa_scripts/compare_GO_terms.pl.html compare_GO_terms.pl]</span> P06280 hhblits_n8_neu.out_cluster_ids_only_GOterms.tsv |
||
− | perl parse_hhblits.pl hhblits_n8_neu.out |
||
− | R CMD BATCH hist_hhblits.R |
+ | R CMD BATCH <span class="plainlinks">[https://dl.dropbox.com/u/13796643/fabry/msa_scripts/hist_hhblits.R.html hist_hhblits.R]</span> |
+ | == Comparison == |
||
− | The first HHblits run took about 2.5 minutes, the second one about 16 minutes (see section [[Sequence_alignments_(sequence_searches_and_multiple_alignments)#Time | Time]]). |
||
+ | Venn diagrams created with [http://bioinfogp.cnb.csic.es/tools/venny/index.html Oliveros, J.C. (2007) VENNY. An interactive tool for comparing lists with Venn Diagrams.] |
||
− | == Time == |
||
− | We evaluated the time the programs ran with the command "time" |
||
+ | >R CMD BATCH <span class="plainlinks">[https://dl.dropbox.com/u/13796643/fabry/msa_scripts/all_Evalues.R.html all_Evalues.R]</span> |
||
+ | == Multiple sequence alignments == |
||
− | {|style="border-collapse: separate; border-spacing: 0; border-width: 1px; border-style: solid; border-color: #000; padding: 0; align: center; " width="85%" |
||
+ | |||
− | ! style="border-style: solid; border-width: 0 1px 1px 0"| Method |
||
+ | The following commands were used in our bash script [https://dl.dropbox.com/u/13796643/fabry/msa_scripts/calculate_msas.sh.html calculate_msas.sh] to generate the multiple sequence alignments. The pictures were obtained by using [http://www.jalview.org/ jalview]. |
||
− | ! style="border-style: solid; border-width: 0 1px 1px 0"| Parameter |
||
+ | |||
− | ! style="border-style: solid; border-width: 0 1px 1px 0"| Time |
||
+ | $ clustalw -infile="<filename>.fasta" -outfile="msa/clustalw_<filename>.msa" & |
||
− | |- |
||
+ | |||
− | | style="border-style: solid; border-width: 0 1px 1px 0"| Blast v = 700 |
||
+ | $ muscle -in "<filename>.fasta" -out "msa/muscle_<filename>.msa" & |
||
− | | style="border-style: solid; border-width: 0 1px 1px 0"| b = 700, v = 700 |
||
+ | |||
− | | style="border-style: solid; border-width: 0 1px 1px 0"| 1m53.944s |
||
+ | $ /mnt/opt/T-Coffee/bin/t_coffee -seq "<filename>.fasta" -outfile "msa/tcoffe_<filename>.msa" & |
||
− | |- |
||
+ | |||
− | | style="border-style: solid; border-width: 0 1px 1px 0"| HHBlits |
||
+ | $ /mnt/opt/T-Coffee/bin/t_coffee -seq "<filename>.fasta" -method sap_pair -template_file "<filename>.pdb" \ |
||
− | | style="border-style: solid; border-width: 0 1px 1px 0"| default |
||
+ | -outfile "msa/3Dcoffee_<filename>.msa" & |
||
− | | style="border-style: solid; border-width: 0 1px 1px 0"| 2m19.519s |
||
+ | |||
− | |- |
||
+ | We counted the number of gaps and conserved columns with the perl script [https://dl.dropbox.com/u/13796643/fabry/msa_scripts/countGaps.pl.html countGaps.pl]. There is also a small wrapper script - [https://dl.dropbox.com/u/13796643/fabry/msa_scripts/countAllGaps.sh.html countAllGaps.sh] which runs countGaps.pl on all .msa files in a specific folder: |
||
− | | style="border-style: solid; border-width: 0 1px 1px 0"| HHBlits |
||
+ | |||
− | | style="border-style: solid; border-width: 0 1px 1px 0"| n = 8 |
||
+ | #!/bin/bash |
||
− | | style="border-style: solid; border-width: 0 1px 1px 0"| 16m7.754s |
||
+ | |||
− | |} |
||
+ | for file in msa/*.msa; do |
||
+ | perl <span class="plainlinks">[https://dl.dropbox.com/u/13796643/fabry/msa_scripts/countGaps.pl.html countGaps.pl]</span> "$file" > "${file%.*}.counts" |
||
+ | done |
||
+ | [[Category: Fabry Disease 2012]] |
||
− | === Comparison === |
||
− | >R script all_Evalues.R |
||
− | #This R Script is based on Andrea's Rscript psiBlast.evalueHist.Rscript |
||
− | # Thank you Andrea :) ... Julia |
||
− | |||
− | |||
− | library("animation") |
||
− | |||
− | |||
− | |||
− | cols3 <- hcl(h = seq(30, by=300 / 3, length = 3), l = 65, alpha = 0.5) |
||
− | br <- seq(-180,15,1.25) |
||
− | Blast <- read.table("Blast/blastsearch_default_v700.out_ident_cov.tsv", header = T) |
||
− | Psi <- read.table("Blast/psi_results_10its_eVal_0.000000001.txt_ident_cov.tsv", header = T) |
||
− | HHBlits <- read.table("HHBlits/hhblits_n8_neu.out_ident_cov.tsv", header = T) |
||
− | |||
− | |||
− | saveMovie({ |
||
− | for (i in 1:4) { |
||
− | if(i == 1){ |
||
− | data <- Blast$Evalue |
||
− | } |
||
− | if(i == 2){ |
||
− | data <- Psi$Evalue |
||
− | } |
||
− | if(i == 3){ |
||
− | data <- HHBlits$Evalue |
||
− | } |
||
− | if(i < 4) { |
||
− | hist(data ,border=cols3[i],col=cols3[i],breaks=br,main='E-values',panel.first = grid(),xlab='log_10(E- |
||
− | value)',axes=TRUE,xlim=range(-200,1),ylim=range(0,200)) |
||
− | legend(-200,200,c("BLAST","Psi-BLAST","HHBlits"),col=cols3, pch = c("_","_","_"), lwd = 3) |
||
− | } |
||
− | if(i == 4) { |
||
− | hist(Blast$Evalue,border=cols3[1],col=cols3[1],breaks=br,main='E-values',panel.first = grid(),xlab='log_10(E- |
||
− | value)',axes=TRUE,xlim=range(-200,1),ylim=range(0,200)) |
||
− | hist(Psi$Evalue,border=cols3[2],col=cols3[2],breaks=br,xlim=range(-200,1),ylim=range(0,200),add=TRUE) |
||
− | hist(HHBlits$Evalue,border=cols3[3],col=cols3[3],breaks=br,xlim=range(-200,1),ylim=range(0,200),add=TRUE) |
||
− | legend(-200,200,c("BLAST","Psi-BLAST","HHBlits"),col=cols3, pch = c("_","_","_"), lwd = 3) |
||
− | Sys.sleep(5) |
||
− | } |
||
− | } |
||
− | }, interval = 5, outdir = getwd()) |
Latest revision as of 17:06, 9 May 2012
Fabry Disease » Sequence alignments » Journal
Please see Task 2 Scripts for the used scripts.
Contents
Sequence searches
Blast
We searched the "big80" database with Blast with the following command:
blastall -p blastp -d /mnt/project/pracstrucfunc12/data/big/big_80 -i P06280.fasta -m 0 -o blastsearch_default.out -v 700 -b 700 perl extract_ids_blast.pl blastsearch_default.out perl ../download-annotation.pl blastsearch_default_ids.txt perl ../compare_GO_terms.pl P06280 blastsearch_default_ids_GOterms.tsv perl parse_blast.pl blastsearch_default.out R CMD BATCH hist_blast.R
Psi-Blast
The following command was used to run Psi-Blast with AGAL as query sequence against big80. It was run with two and ten iterations configured and an e-value cut-off of 2e-3 and 1e-9, respectively.
$ bash run_psi_blast.sh &> run_psi_blast.log
The log file contains the runtimes of the different psi-blast runs:
Iterations | E-value cut-off | Runtime |
---|---|---|
2 | 2e-3 | 3m0.814s |
2 | 1e-9 | 3m9.422s |
10 | 2e-3 | 14m29.179s |
10 | 1e-9 | 15m39.251s |
Afterwards, the psi-blast output was parsed to collect the all the information about all the hits of the last iteration, which include the e-value, the sequence identity, the coverage in the longer sequence of the pairwise alignment and the length of the alignment. When there were more than one alignment per hit, we used the first one which was also listed in the short result output.
$ for i in psi_results_*.txt; do
perl parse_psiblast.pl "$i" > "${i%.*}.stats"
done
The histograms were generated with the generate_histograms.sh script:
$ bash generate_histograms.sh *.stats
GO term comparison
$ perl ../download-annotation.pl ids_psiblast_10its_eVal_1e-9.txt $ perl ../compare_GO_terms.pl P06280 ids_psiblast_10its_eVal_1e-9_GOterms.tsv $ bash hist_psiblast.sh ids_psiblast_10its_eVal_1e-9_GOterms_comparison.txt
HHblits / HHsearch
We searched the "big80" database with HHblits using the default settings and also with the maximum number of possible iterations (8) with the following commands:
time hhblits -i ../P06280.fasta -d /mnt/project/pracstrucfunc12/data/hhblits/uniprot20_current -e 0.003 -o hhblits_default.out -E 0.003 -z 700 ./extract_ids_hhblits.sh hhblits_default.out perl parse_hhblits.pl hhblits_default.out perl ../download-annotation.pl hhblits_default.out_cluster_ids_only.tsv perl ../compare_GO_terms.pl P06280 hhblits_default.out_cluster_ids_only_GOterms.tsv time hhblits -i ../P06280.fasta -d /mnt/project/pracstrucfunc12/data/hhblits/uniprot20_current -e 0.003 -o hhblits_n8_neu.out -E 0.003 -n 8 -z 800 -b 800 ./extract_ids_hhblits.sh hhblits_n8_neu.out perl parse_hhblits.pl hhblits_n8_neu.out perl ../download-annotation.pl hhblits_n8_neu.out_cluster_ids_only.tsv perl ../compare_GO_terms.pl P06280 hhblits_n8_neu.out_cluster_ids_only_GOterms.tsv R CMD BATCH hist_hhblits.R
Comparison
Venn diagrams created with Oliveros, J.C. (2007) VENNY. An interactive tool for comparing lists with Venn Diagrams.
>R CMD BATCH all_Evalues.R
Multiple sequence alignments
The following commands were used in our bash script calculate_msas.sh to generate the multiple sequence alignments. The pictures were obtained by using jalview.
$ clustalw -infile="<filename>.fasta" -outfile="msa/clustalw_<filename>.msa" & $ muscle -in "<filename>.fasta" -out "msa/muscle_<filename>.msa" & $ /mnt/opt/T-Coffee/bin/t_coffee -seq "<filename>.fasta" -outfile "msa/tcoffe_<filename>.msa" & $ /mnt/opt/T-Coffee/bin/t_coffee -seq "<filename>.fasta" -method sap_pair -template_file "<filename>.pdb" \ -outfile "msa/3Dcoffee_<filename>.msa" &
We counted the number of gaps and conserved columns with the perl script countGaps.pl. There is also a small wrapper script - countAllGaps.sh which runs countGaps.pl on all .msa files in a specific folder:
#!/bin/bash
for file in msa/*.msa; do
perl countGaps.pl "$file" > "${file%.*}.counts"
done