Difference between revisions of "Fabry:Sequence alignments (sequence searches and multiple alignments)/Journal"
From Bioinformatikpedia
Rackersederj (talk | contribs) m (→HHblits / HHsearch) |
Rackersederj (talk | contribs) (→Blast) |
||
Line 17: | Line 17: | ||
We searched the "big80" database with Blast with the following command: |
We searched the "big80" database with Blast with the following command: |
||
− | + | blastall -p blastp -d /mnt/project/pracstrucfunc12/data/big/big_80 -i P06280.fasta -m 0 -o blastsearch_default.out -v 700 -b 700 |
|
The run took about 2 minutes (see section [[Sequence_alignments_(sequence_searches_and_multiple_alignments)#Time | Time]]) |
The run took about 2 minutes (see section [[Sequence_alignments_(sequence_searches_and_multiple_alignments)#Time | Time]]) |
Revision as of 14:45, 4 May 2012
Please see Task 2 Results for our results on this topic.
Contents
Reference sequence
The reference sequence of α-Galactosidase A that will be used in the following tasks was obtained from Swissprot P06280.
>gi|4504009|ref|NP_000160.1| alpha-galactosidase A precursor [Homo sapiens] MQLRNPELHLGCALALRFLALVSWDIPGARALDNGLARTPTMGWLHWERFMCNLDCQEEPDSCISEKLFM EMAELMVSEGWKDAGYEYLCIDDCWMAPQRDSEGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVGNK TCAGFPGSFGYYDIDAQTFADWGVDLLKFDGCYCDSLENLADGYKHMSLALNRTGRSIVYSCEWPLYMWP FQKPNYTEIRQYCNHWRNFADIDDSWKSIKSILDWTSFNQERIVDVAGPGGWNDPDMLVIGNFGLSWNQQ VTQMALWAIMAAPLFMSNDLRHISPQAKALLQDKDVIAINQDPLGKQGYQLRQGDNFEVWERPLSGLAWA VAMINRQEIGGPRSYTIAVASLGKGVACNPACFITQLLPVKRKLGFYEWTSRLRSHINPTGTVLLQLENT MQMSLKDLL
Sequence searches
Blast
We searched the "big80" database with Blast with the following command:
blastall -p blastp -d /mnt/project/pracstrucfunc12/data/big/big_80 -i P06280.fasta -m 0 -o blastsearch_default.out -v 700 -b 700
The run took about 2 minutes (see section Time)
Psi-Blast
Iterations: 2 Evalue: 0.002 real 3m30.256s user 2m58.070s sys 0m13.360s Iterations: 2 Evalue: 0.000000001 real 3m8.507s user 3m5.180s sys 0m2.400s Iterations: 2 Evalue: 0.0000000001 real 3m10.271s user 3m7.620s sys 0m2.190s Iterations: 10 Evalue: 0.002 real 15m29.218s user 15m8.910s sys 0m12.730s Iterations: 10 Evalue: 0.000000001 real 16m33.748s user 16m12.500s sys 0m13.080s Iterations: 10 Evalue: 0.0000000001 real 16m20.137s user 15m55.910s sys 0m13.190s
HHblits / HHsearch
We searched the "big80" database with HHblits using the default settings and also with the maximum number of possible iterations (8) with the following commands:
time hhblits -i ../P06280.fasta -d /mnt/project/pracstrucfunc12/data/hhblits/uniprot20_current -e 0.003 -o hhblits_default.out -E 0.003 -z 700 ./extract_ids_hhblits.sh hhblits_default.out perl ../download-annotation.pl hhblits_default_ids.txt perl ../compare_GO_terms.pl P06280 hhblits_default_ids_GOterms.tsv perl parse_hhblits.pl hhblits_default.out time hhblits -i ../P06280.fasta -d /mnt/project/pracstrucfunc12/data/hhblits/uniprot20_current -e 0.003 -o hhblits_n8_neu.out -E 0.003 -n 8 -z 800 -b 800 ./extract_ids_hhblits.sh hhblits_n8_neu.out perl ../download-annotation.pl hhblits_n8_neu_ids.txt perl ../compare_GO_terms.pl P06280 hhblits_n8_neu_ids_GOterms.tsv perl parse_hhblits.pl hhblits_n8_neu.out R CMD BATCH hist_hhblits.R
The first HHblits run took about 2.5 minutes, the second one about 16 minutes (see section Time).
Time
We evaluated the time the programs ran with the command "time"
Method | Parameter | Time |
---|---|---|
Blast v = 700 | b = 700, v = 700 | 1m53.944s |
HHBlits | default | 2m19.519s |
HHBlits | n = 8 | 16m7.754s |