CD task6 protocol

From Bioinformatikpedia
Revision as of 12:42, 20 June 2012 by Vorbergs (talk | contribs) (PAM1)

Blosum62

#  Matrix made by matblas from blosum62.iij
#  * column uses minimum score
#  BLOSUM Clustered Scoring Matrix in 1/2 Bit Units
#  Blocks Database = /data/blocks_5.0/blocks.dat
#  Cluster Percentage: >= 62
#  Entropy =   0.6979, Expected =  -0.5209
   A  R  N  D  C  Q  E  G  H  I  L  K  M  F  P  S  T  W  Y  V  B  Z  X  *
A  4 -1 -2 -2  0 -1 -1  0 -2 -1 -1 -1 -1 -2 -1  1  0 -3 -2  0 -2 -1  0 -4 
R -1  5  0 -2 -3  1  0 -2  0 -3 -2  2 -1 -3 -2 -1 -1 -3 -2 -3 -1  0 -1 -4 
N -2  0  6  1 -3  0  0  0  1 -3 -3  0 -2 -3 -2  1  0 -4 -2 -3  3  0 -1 -4 
D -2 -2  1  6 -3  0  2 -1 -1 -3 -4 -1 -3 -3 -1  0 -1 -4 -3 -3  4  1 -1 -4 
C  0 -3 -3 -3  9 -3 -4 -3 -3 -1 -1 -3 -1 -2 -3 -1 -1 -2 -2 -1 -3 -3 -2 -4 
Q -1  1  0  0 -3  5  2 -2  0 -3 -2  1  0 -3 -1  0 -1 -2 -1 -2  0  3 -1 -4 
E -1  0  0  2 -4  2  5 -2  0 -3 -3  1 -2 -3 -1  0 -1 -3 -2 -2  1  4 -1 -4 
G  0 -2  0 -1 -3 -2 -2  6 -2 -4 -4 -2 -3 -3 -2  0 -2 -2 -3 -3 -1 -2 -1 -4 
H -2  0  1 -1 -3  0  0 -2  8 -3 -3 -1 -2 -1 -2 -1 -2 -2  2 -3  0  0 -1 -4 
I -1 -3 -3 -3 -1 -3 -3 -4 -3  4  2 -3  1  0 -3 -2 -1 -3 -1  3 -3 -3 -1 -4 
L -1 -2 -3 -4 -1 -2 -3 -4 -3  2  4 -2  2  0 -3 -2 -1 -2 -1  1 -4 -3 -1 -4 
K -1  2  0 -1 -3  1  1 -2 -1 -3 -2  5 -1 -3 -1  0 -1 -3 -2 -2  0  1 -1 -4 
M -1 -1 -2 -3 -1  0 -2 -3 -2  1  2 -1  5  0 -2 -1 -1 -1 -1  1 -3 -1 -1 -4 
F -2 -3 -3 -3 -2 -3 -3 -3 -1  0  0 -3  0  6 -4 -2 -2  1  3 -1 -3 -3 -1 -4 
P -1 -2 -2 -1 -3 -1 -1 -2 -2 -3 -3 -1 -2 -4  7 -1 -1 -4 -3 -2 -2 -1 -2 -4 
S  1 -1  1  0 -1  0  0  0 -1 -2 -2  0 -1 -2 -1  4  1 -3 -2 -2  0  0  0 -4 
T  0 -1  0 -1 -1 -1 -1 -2 -2 -1 -1 -1 -1 -2 -1  1  5 -2 -2  0 -1 -1  0 -4 
W -3 -3 -4 -4 -2 -2 -3 -2 -2 -3 -2 -3 -1  1 -4 -3 -2 11  2 -3 -4 -3 -2 -4 
Y -2 -2 -2 -3 -2 -1 -2 -3  2 -1 -1 -2 -1  3 -3 -2 -2  2  7 -1 -3 -2 -1 -4 
V  0 -3 -3 -3 -1 -2 -2 -3 -3  3  1 -2  1 -1 -2 -2  0 -3 -1  4 -3 -2 -1 -4 
B -2 -1  3  4 -3  0  1 -1  0 -3 -4  0 -3 -3 -2  0 -1 -4 -3 -3  4  1 -1 -4 
Z -1  0  0  1 -3  3  4 -2  0 -3 -3  1 -1 -3 -1  0 -1 -3 -2 -2  1  4 -1 -4 
X  0 -1 -1 -1 -2 -1 -1 -1 -1 -1 -1 -1 -1 -1 -2  0  0 -2 -1 -1 -1 -1 -1 -4 
* -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4  1

PAM1

1 PAM evolutionary distance

Mutation probability matrix for the evolutionary distance of 1 PAM. An elementofthis matrix, Mij, gives the probability that the amino acid column in j will be replaced by the amino acid in row i after a given evolutionary interval. In this case 1 accepted point mutation per 100 amino acids. Thus, there is a 0.56% probability that Asp will be replaced by Glu. To simplify the appearance, the elements shown are multiplied by 10,00.


         Ala  Arg  Asn  Asp  Cys  Gln  Glu  Gly  His  Ile  Leu  Lys  Met  Phe  Pro  Ser  Thr  Trp  Tyr  Val
           A    R    N    D    C    Q    E    G    H    I    L    K    M    F    P    S    T    W    Y    V
Ala A  9867     2    9   10    3    8   17   21    2    6    4    2    6    2   22   35   32    0    2   18
Arg R     1  9913    1    0    1   10    0    0   10    3    1   19    4    1    4    6    1    8    0    1
Asn N     4     1 9822   36    0    4    6    6   21    3    1   13    0    1    2   20    9    1    4    1
Asp D     6     0   42 9859    0    6   53    6    4    1    0    3    0    0    1    5    3    0    0    1
Cys C     1     1    0    0 9973    0    0    0    1    1    0    0    0    0    1    5    1    0    3    2
Gln Q     3     9    4    5    0 9876   27    1   23    1    3    6    4    0    6    2    2    0    0    1
Glu E    10     0    7   56    0   35 9865    4    2    3    1    4    1    0    3    4    2    0    1    2
Gly G    21     1   12   11    1    3    7 9935    1    0    1    2    1    1    3   21    3    0    0    5
His H     1     8   18    3    1   20    1    0 9912    0    1    1    0    2    3    1    1    1    4    1
Ile I     2     2    3    1    2    1    2    0    0 9872    9    2   12    7    0    1    7    0    1   33
Leu L     3     1    3    0    0    6    1    1    4   22 9947    2   45   13    3    1    3    4    2   15
Lys K     2    37   25    6    0   12    7    2    2    4    1 9926   20    0    3    8   11    0    1    1
Met M     1     1    0    0    0    2    0    0    0    5    8    4 9874    1    0    1    2    0    0    4
Phe F     1     1    1    0    0    0    0    1    2    8    6    0    4 9946    0    2    1    3   28    0
Pro P    13     5    2    1    1    8    3    2    5    1    2    2    1    1 9926   12    4    0    0    2
Ser S    28    11   34    7   11    4    6   16    2    2    1    7    4    3   17 9840   38    5    2    2
Thr T    22     2   13    4    1    3    2    2    1   11    2    8    6    1    5   32 9871    0    2    9
Trp W     0     2    0    0    0    0    0    0    0    0    0    0    0    1    0    1    0 9976    1    0
Tyr Y     1     0    3    0    3    0    1    0    4    1    1    0    0   21    0    1    1    2 9945    1
Val V    13     2    1    1    3    2    2    3    3   57   11    1   17    1    3    2   10    0    2 9901

PAM250

250 PAM evolutionary distance

                     ORIGINAL AMINO ACID

        Ala  Arg  Asn  Asp  Cys  Gln  Glu  Gly  His  Ile  Leu  Lys  Met  Phe  Pro  Ser  Thr  Trp  Tyr  Val
         A    R    N    D    C    Q    E    G    H    I    L    K    M    F    P    S    T    W    Y    V
Ala A    13    6    9    9    5    8    9   12    6    8    6    7    7    4   11   11   11    2    4    9
Arg R     3   17    4    3    2    5    3    2    6    3    2    9    4    1    4    4    3    7    2    2
Asn N     4    4    6    7    2    5    6    4    6    3    2    5    3    2    4    5    4    2    3    3
Asp D     5    4    8   11    1    7   10    5    6    3    2    5    3    1    4    5    5    1    2    3
Cys C     2    1    1    1   52    1    1    2    2    2    1    1    1    1    2    3    2    1    4    2
Gln Q     3    5    5    6    1   10    7    3    7    2    3    5    3    1    4    3    3    1    2    3
Glu E     5    4    7   11    1    9   12    5    6    3    2    5    3    1    4    5    5    1    2    3
Gly G    12    5   10   10    4    7    9   27    5    5    4    6    5    3    8   11    9    2    3    7
His H     2    5    5    4    2    7    4    2   15    2    2    3    2    2    3    3    2    2    3    2
Ile I     3    2    2    2    2    2    2    2    2   10    6    2    6    5    2    3    4    1    3    9
Leu L     6    4    4    3    2    6    4    3    5   15   34    4   20   13    5    4    6    6    7   13
Lys K     6   18   10    8    2   10    8    5    8    5    4   24    9    2    6    8    8    4    3    5
Met M     1    1    1    1    0    1    1    1    1    2    3    2    6    2    1    1    1    1    1    2
Phe F     2    1    2    1    1    1    1    1    3    5    6    1    4   32    1    2    2    4   20    3
Pro P     7    5    5    4    3    5    4    5    5    3    3    4    3    2   20    6    5    1    2    4
Ser S     9    6    8    7    7    6    7    9    6    5    4    7    5    3    9   10    9    4    4    6
Thr T     8    5    6    6    4    5    5    6    4    6    4    6    5    3    6    8   11    2    3    6
Trp W     0    2    0    0    0    0    0    0    1    0    1    0    0    1    0    1    0   55    1    0
Tyr Y     1    1    2    1    3    1    1    1    3    2    2    1    2   15    1    2    2    3   31    2
Val V     7    4    4    4    4    4    4    4    5    4   15   10    4   10    5    5    5   72    4   17

Create position specific substitution matrix

blastpgp -d /mnt/project/pracstrucfunc12/data/big/big_80 -i p45381_wt.fa -o psiblast_it2_p45381_wt_big80.out -j 5 -Q pssm.out

Multiple Sequence Alignment

We searched UniProt_mammals with a simple Blast Search and extracted non redundant sequences by hand. Thus we found 29 homologues. Then we used T-Coffee Expresso for the generation of the MSA.

sp|P45381|ACY2_HUMAN    MTSCHIA-----EE----------H-IQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRY 64
tr|H2QBW4|H2QBW4_PANTR  MTSCHIA-----EE----------H-IQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRY 64
tr|G3QQC1|G3QQC1_GORGO  MTSCHIA-----EE----------H-IQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRY 64
sp|Q5R9E0|ACY2_PONAB    MTSCHIA-----EE----------P-IQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRY 64
tr|G1S5Z4|G1S5Z4_NOMLE  MTSCHIA-----EE----------H-IQKVAIFGGTHGNELTGVFLVKYWLENGAEIQRTGLEVKPFITNPRAVKKCTRY 64
tr|G7PT66|G7PT66_MACFA  MTSCHIA-----EE----------P-IKKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRY 64
tr|F7DR53|F7DR53_MACMU  MTSCHIA-----EE----------P-IKKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRY 64
tr|F6WMI4|F6WMI4_HORSE  ------M-----TS-CH----NAEDPIKKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVTPFITNPRAVKKCTRY 64
sp|B1PK17|ACY2_PIG      -MTSCQV-----AE----------DPIKKVAIFGGTHGNELTGVFLVKHWLENNTEIQRTGLEVKPFITNPRAVEKCTRY 64
tr|G3TAV8|G3TAV8_LOXAF  MTSCHVA-----EE----------P-IKKVAIFGGTHGNELTGVFLVKHWLEDGAEIQRAGLEVKPFITNPRAVKKCSRY 64
sp|P46446|ACY2_BOVIN    ------M-----TS-----CHVAEDPIKKVAIFGGTHGNELTGVFLVKHWLENSTEIQRTGLEVKPFITNPRAVKKCTRY 64
tr|G1SPT6|G1SPT6_RABIT  ------------MSSCH---VAEAP-IKKIAIFGGTHGNELTGVFLVKHWLQNGAEIQRTGLEVRPFITNPRAVEKCTRY 64
tr|H0WW85|H0WW85_OTOGA  MTSCHIA-----EE----------P-IKKVAIFGGTHGNELTGVFLVKHWLQNGAEIQRTGLEIKPLITNPKAVKKCTRY 64
tr|G1P679|G1P679_MYOLU  -------------MTYH----VVEDPIKKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRY 63
tr|E2R8M6|E2R8M6_CANFA  -------------M--TSYHVTEDP-IKKVAIFGGTHGNELTGVFLVKHWLENDTEIQRTGLEVKPFITNPRAVKKCTRY 64
tr|G5B939|G5B939_HETGA  ------M-----TE----------KPIKKIAIFGGTHGNELTGVFLVKHWLQDGAEIQRTGLEVKPFISNPRAVKKCLRY 59
sp|Q9R1T5|ACY2_RAT      -MTSCVA-----EE----------P-IKKIAIFGGTHGNELTGVFLVTHWLKNGAEVHRAGLEVKPFITNPRAVEKCTRY 63
tr|B2KFD4|B2KFD4_MOUSE  -MTSCVA-----KE----------P-IKKIAIFGGTHGNELTGVFLVTHWLRNGTEVHRAGLDVKPFITNPRAVEKCTRY 63
tr|F6ZFN3|F6ZFN3_ORNAN  MTSGQVV-----CE--T--------PVRRIAIFGGTHGNELSGVFLVKHWQENGTEIQRTGLEVNPFITNPRAVEKCTRY 65
tr|H9H8M1|H9H8M1_MONDO  MAAPRGA-----RT--P---------LTRVAIFGGTHGNELSGVLLARHWQEDGAEVQRPGLRVTPFISNPRAVHRGVRY 64
tr|G3VQ32|G3VQ32_SARHA  ----MCS-----TAS------MGHR-LNRVAVMGGTHGNELSGVYLVKHWLQDPSELQRRTFTVTPFLANPKATKRCMRY 64
sp|Q5M876|ACY3_RAT      MCSLPGS-----RKP------L-----LRVAVTGGTHGNEMCGVYLARYWLQNPGELQRPSFSAMPVLANPAATAACRRY 64
tr|H0WH68|H0WH68_OTOGA  ----MCS-RPVPREP------L-----HRVAVTGGTHGNEMSGICLVRHWLQAPGELQRPSFSAVPVLANLAAIAACRRY 64
tr|H0UYR8|H0UYR8_CAVPO  ----MCS-LPVPQEP------L-----RRVAVTGGTHGNEMSGVYLVRQWLRTPVDLQRPSFSAVPVLANPAATAVCRRY 64
tr|G1R3Y2|G1R3Y2_NOMLE  ----MCS-LPVPREP------L-----RRVAVTGGTHGNEMSGIYLARHWLRAPAELQRPSFSAVPVLANPAATAGCRRY 64
tr|F7A210|F7A210_MACMU  ----MCS-LPVPREP------L-----RRVAVTGGTHGNEMSGVYLARHWLQAPAELQRLSFSAVPVLANPAATAACRRY 64
tr|G7PP64|G7PP64_MACFA  ----MCS-LPVPREP------L-----RRVAVTGGTHGNEMSGVYLARHWLQAPAELERLSFSAVPVLANPAATAACRRY 64
tr|G3I3Y2|G3I3Y2_CRIGR  -----MSSLPVPREP------L-----RRVAVTGGTHGNEMCGIHLIRHWLQAPGELQRPSFSAMPVLANPAATAACRRY 64
tr|G1PIL7|G1PIL7_MYOLU  ----MCS-RPAPREP------L-----RRVAVIGGTHGNEMSGVHLARHWLRALGELQRPSFSAVPVLANPAATAACRRY 64
                                                    ::*: *******: *: *   * .   ::.*  :   *.::*  *     ** 

sp|P45381|ACY2_HUMAN    IDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILED--SRNN--FLIQMF 140
tr|H2QBW4|H2QBW4_PANTR  IDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILED--SRNN--FLIQMF 140
tr|G3QQC1|G3QQC1_GORGO  IDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILED--SRNN--FLIQMF 140
sp|Q5R9E0|ACY2_PONAB    IDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILED--SRNN--FLIQMF 140
tr|G1S5Z4|G1S5Z4_NOMLE  IDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILED--SRNN--FLIQMF 140
tr|G7PT66|G7PT66_MACFA  IDCDLNRIFDLENLGKKMSEDLPYEVRRAQEIYHLFGPKDGEDSYDIIFDLHNTTSNMGCTLILED--SRNN--FLIQMF 140
tr|F7DR53|F7DR53_MACMU  IDCDLNRIFDLENLGKKMSEDLPYEVRRAQEIYHLFGPKDGEDSYDIIFDLHNTTSNMGCTLILED--SRNN--FLIQMF 140
tr|F6WMI4|F6WMI4_HORSE  IDCDLNRVFDLENLGKKMSEDLPYEVRRAQEINHLFGPKNSEDSYDIIFDLHNTTSNMGCTLILED--SRND--FLIQMF 140
sp|B1PK17|ACY2_PIG      IDCDLNRVFDPENLGKRMSEDLPYEVRRAQEISRLFGPKDSEDSYDIIFDLHNTTSNMGCTLILED--SRND--FLIQMF 140
tr|G3TAV8|G3TAV8_LOXAF  IDCDLNRVFDLENLGKNRSEDLPYEVIRAQEINHLFGPKESEDSYDIIFDLHNTTSNMGCTLILED--SKND--FLIQMF 140
sp|P46446|ACY2_BOVIN    IDCDLNRVFDPENLGKKKSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILED--SRND--FLIQMF 140
tr|G1SPT6|G1SPT6_RABIT  IDCDLNRIFDLENLSKEVSEDLPYEVRRAQEINRLFGPKDSEDSYDIIFDLHNTTSNMGCTLILED--SRND--FLIQMF 140
tr|H0WW85|H0WW85_OTOGA  IDCDLNRVFDSENLGKEISEDLPYEVRRAQEINLLFGPKHSEDSYDIIFDLHNTTSNMGCTLILED--SRNN--LLIQMF 140
tr|G1P679|G1P679_MYOLU  IDCDLNRVFDHGNLGKKLSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILED--SRND--FLIQMF 139
tr|E2R8M6|E2R8M6_CANFA  IDCDLNRVFDPENLGKKVSKDLPYEVRRAQEINHLFGPKDNEDSYDIIFDLHNTTSNMGCTLILED--SRND--LLIQMF 140
tr|G5B939|G5B939_HETGA  IDCDLNRVFDLENLGKKMSEDLPYEVRRAQEINHLFGQKNSEDSYDIIFDLHNTTSNMGCTLILED--SKND--FLIQMF 135
sp|Q9R1T5|ACY2_RAT      IDCDLNRVFDLENLSKEMSEDLPYEVRRAQEINHLFGPKNSDDAYDVVFDLHNTTSNMGCTLILED--SRND--FLIQMF 139
tr|B2KFD4|B2KFD4_MOUSE  IDCDLNRVFDLENLSKEMSEDLPYEVRRAQEINHLFGPKNSDDAYDIVFDLHNTTSNMGCTLILED--SRND--FLIQMF 139
tr|F6ZFN3|F6ZFN3_ORNAN  IDCDLNRVFDLENLCKKETENLPYEIRRAQEINHLFGPKGSEDAYDLIFDLHNTTSNTGCTIILEN--SKND--FIIQMV 141
tr|H9H8M1|H9H8M1_MONDO  VDRDLNRVFDPAHLGPEPPEDQPYEVEQAREIHRLFG------AYDVILDLHNTTSNMGCTLILES--SRDD--VLIQMF 134
tr|G3VQ32|G3VQ32_SARHA  ISQDLNRSFTKAFLLSKGTKDDLYEVSRAQEINQLFGPRGSADAFDFIFDLHNTTSNMAACLISDSEKN-V---FTMHMC 140
sp|Q5M876|ACY3_RAT      IDRDLNRTFTLTFLGSTATPDDPYEVKRAQELNQLLGPKGTCQAFDFILDLHNTTANTGACLISEV-SQ-NP--FNLHLC 140
tr|H0WH68|H0WH68_OTOGA  VGCDLNRTFISTFLTAKASPDDPYEVTRARELNQLLGPKASSQAFDFVLDLHNTTANVGTCLIIDT--N-QD-VFAMHLC 140
tr|H0UYR8|H0UYR8_CAVPO  IGRDLNRTFTSTFLTSKATPDELYEVTRARELNHLLGPKNSSQAFDFILDLHNTTANMGTCFIL----N-VTDTFAMHLC 139
tr|G1R3Y2|G1R3Y2_NOMLE  VDHDLNRTFTSSFLNSRPTPDDPYEVTRARELNQLLGPKASGRAFDFVLDLHNTTANVGTCLIAKS--S-HE-VFAMHLC 140
tr|F7A210|F7A210_MACMU  VDHDLNRAFTSSFLNSRPTPDDPYEVTRARELNQLLGPKASGRAFDFVLDLHNTTANMGTCLIAKS--S-HE-VFAMHLC 140
tr|G7PP64|G7PP64_MACFA  VDHDLNRAFTSSFLNSRPTPDDPYEVTRARELNQLLGPKASGRAFDFVLDLHNTTANMGTCLIAKS--S-HE-VFAMHLC 140
tr|G3I3Y2|G3I3Y2_CRIGR  MDRDLNRTFTFTFLSSTATPNDPYEVTRAQELNQLLGPKGTDQAFDFILDLHNTTANTGVCLISE--AS-HS-PFNLHLC 140
tr|G1PIL7|G1PIL7_MYOLU  VDCDLNRAFTGAFLTARAHPDDPYEVTRARELNQLLGPKASGQAFDFVLDLHNTTASMGTCLIESS-HN-V---FAMHLC 139
                        :. **** *    *      :  **: :*:*:  *:*      ::*.::******:. .  :*     .     . ::: 
sp|P45381|ACY2_HUMAN    HYIKTSLA-PLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCA 219
tr|H2QBW4|H2QBW4_PANTR  HYIKTSLA-PLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCA 219
tr|G3QQC1|G3QQC1_GORGO  HYIKTSLA-PLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCA 219
sp|Q5R9E0|ACY2_PONAB    HYIKTSLA-PLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCA 219
tr|G1S5Z4|G1S5Z4_NOMLE  HYIKTSLA-PLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCA 219
tr|G7PT66|G7PT66_MACFA  HYIKTSLA-PLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCA 219
tr|F7DR53|F7DR53_MACMU  HYIKTSLA-PLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCA 219
tr|F6WMI4|F6WMI4_HORSE  HYIKTSLA-PLPCYVYLIEHPSLKYATTRSVAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHNFNEGKEFPPCA 219
sp|B1PK17|ACY2_PIG      HYIKTSLA-PLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHNFNEGKEFPPCA 219
tr|G3TAV8|G3TAV8_LOXAF  HYIKTSLA-PSPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPSCA 219
sp|P46446|ACY2_BOVIN    HYIKTSLA-PLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIQHALDFIHNFNEGKEFPPCA 219
tr|G1SPT6|G1SPT6_RABIT  HYIKTSLA-PLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKIIKHALDFVHHFNKGKEFPPCA 219
tr|H0WW85|H0WW85_OTOGA  HYIKTSLA-PLPCYVYLIEHPTFKYATTRSVAKYPVGIEVGPQPHGVLRADILNQMRKMIKHALDFIHDFNEGKEFPPCA 219
tr|G1P679|G1P679_MYOLU  HYIKTSLA-PLPCYIYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKYALDFIHNFNEGKEFPPCA 218
tr|E2R8M6|E2R8M6_CANFA  HYIKNSLA-PLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKYALDFIHNFNEGKEFPPCA 219
tr|G5B939|G5B939_HETGA  HYIKTSLA-PLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHQFNQGKEFPPCA 214
sp|Q9R1T5|ACY2_RAT      HYIKTCMA-PLPCSVYLIEHPSLKYATTRSIAKYPVGIEVGPQPHGVLRADILDQMRRMLKHALDFIQRFNEGKEFPPCA 218
tr|B2KFD4|B2KFD4_MOUSE  HYIKTCMA-PLPCSVYLIEHPSLKYATTRSIAKYPVGIEVGPQPHGVLRADILDQMRKMIKHALDFIQHFNEGKEFPPCS 218
tr|F6ZFN3|F6ZFN3_ORNAN  HYIQNSLA-PLPCYVYLIEHPTLKYSTTRSIAKYPVGIEVGPQPQGVLRADILDQMRKIIKHALDFVQHFNEGREFPPCT 220
tr|H9H8M1|H9H8M1_MONDO  RYIQVPPGRPAPPYVDSSQEPPLQEADLPPWASLPFGRGVGVDFQGLAKVEVKTWARVFFRVSCLF-----PGREFPACS 209
tr|G3VQ32|G3VQ32_SARHA  HYIQVKHT-QTPCPIYLYGLPGQENYSLMSVAKNSLGLELGPQPHGVLRADVSAHMRALLACGLDFIDLFNQGTSFPAFD 219
sp|Q5M876|ACY3_RAT      HYLQLQNP-GLPCRLFQFEPPGTESYSMDSVSKNGISLELGPQPQGVLRAELFSQMRAMVASILDFIELFNQGMEFPAFE 219
tr|H0WH68|H0WH68_OTOGA  HHLQLQNP-ELPCRVILYQRPGEERFSLSSVTKNGISLELGPQPQGVLRADLFSQMRALVAAVLDFIELFNQGTAFPAFE 219
tr|H0UYR8|H0UYR8_CAVPO  HYLQLQNS-EPPSRVLVIEASEDTTFSVDSVAKHGMTVELGPQPQGVLRADLFSRMRSLVASVLDFIELFNQGAAFPAFE 218
tr|G1R3Y2|G1R3Y2_NOMLE  RHLQLQYP-ELSCQVFLYQRSGEESYNLDSVAKNGLGLELGPQPQGVLRADIFSRMRTLVATVLDFIELFNQGTAFPAFE 219
tr|F7A210|F7A210_MACMU  RHLQLQYP-ELSCQVFLCQRSGEESYNLDSVAKNGLALELGPQPQGVLRADIFSRMRTLVATVLDFIELFNQGTAFPAFE 219
tr|G7PP64|G7PP64_MACFA  RHLQLQYP-ELSCQVFLCQRSGEESYNLDSVAKNGLALELGPQPQGVLRADIFSRMRTLVATVLDFIELFNQGTAFPAFE 219
tr|G3I3Y2|G3I3Y2_CRIGR  HYLQLQNP-GLPCRLFQYDISGRETYSVESVSKDGICLELGPQPQGVLRADLFSQMRTLVGSILDFIELFNQGMAFPAFE 219
tr|G1PIL7|G1PIL7_MYOLU  RHLQLQSP-ELPCRVFLYQLPGEETYSVNSVAKSGLGLELGPQPQGVLRADLLVRMRALVAAALDFIQLFNQGTEFPAFE 218
                        ::::       .  :     .        . :.  .   :* : :*: :.::    * :.     *      *  **.  
sp|P45381|ACY2_HUMAN    IEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTT 299
tr|H2QBW4|H2QBW4_PANTR  IEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTT 299
tr|G3QQC1|G3QQC1_GORGO  IEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTT 299
sp|Q5R9E0|ACY2_PONAB    IEVYKIIEKVDYPRDENGEIAAVIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTT 299
tr|G1S5Z4|G1S5Z4_NOMLE  IEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPVFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTT 299
tr|G7PT66|G7PT66_MACFA  IEVYKIIEKVDYPRDENGEIAAVIHPNLQDQDWKPLHPGDPMFLTLDGKTMPLGGDCTVYPVFVNEAAYYEKKEAFAKTT 299
tr|F7DR53|F7DR53_MACMU  IEVYKIIEKVDYPRDENGEIAAVIHPNLQDQDWKPLHPGDPMFLTLDGKTMPLGGDCIVYPVFVNEAAYYEKKEAFAKTT 299
tr|F6WMI4|F6WMI4_HORSE  IEVHKIMEKVDYPRNENGEIAAFIHPNLQDQDWKPLYPGDPVFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTT 299
sp|B1PK17|ACY2_PIG      IEVYKIMEKVDYPRNESGEIAAIIHPKLQDQDWKPLHPGDPVFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTT 299
tr|G3TAV8|G3TAV8_LOXAF  IEVYKIMEKVDYPRNESGEIAAVIHPNLQDQDWKPLHPGDPMFLTLDGKTIALDGDCTVYPVFVNEAAYYEKKEAFAKTT 299
sp|P46446|ACY2_BOVIN    IEVYKIMRKVDYPRNESGEISAIIHPKLQDQDWKPLHPEDPVFLTLDGKTIPLGGDQTVYPVFVNEAAYYEKKEAFAKTT 299
tr|G1SPT6|G1SPT6_RABIT  IEVYKIMEKVDYPRNKSGEIAAVIHPNLQDQDWKPLHPGDPVFLTLDGRLIPLGGDCTVYPVFVNEAAYYEKKEAFAKTT 299
tr|H0WW85|H0WW85_OTOGA  IEVYKIMEKVDYPRNENGEISAVIHPDLQDQDWKPLHPGDPVFLTLDGKTIPLGGDCTVYPVFINEASYYEKKEAFAKTT 299
tr|G1P679|G1P679_MYOLU  IEVYKIMEKVDYPRNENGEIAAIIHPNLQDQDWKPLRPEDPVFLTLDGKTIPLGGDCTVYPTFVNEAAYYEKKEAFAKTT 298
tr|E2R8M6|E2R8M6_CANFA  IEVYKIMEKVDYPRNENGDIAALIHPNLQDQDWKPLHPGDPVFLTLEGKSIPLGGDSTVYPVFVNEAAYYEKKEAFAKTT 299
tr|G5B939|G5B939_HETGA  IEAYKIMEKVDFPRNENGEIAAIIHPNLQDQDWKPLHPGDPVFVTLDGKTILLGGDCTVYPVFVNEVAYYEKKEAFAKTT 294
sp|Q9R1T5|ACY2_RAT      IDVYKIMEKVDYPRNESGDVAAVIHPNLQDQDWKPLHPGDPVFVSLDGKVIPLGGDCTVYPVFVNEAAYYEKKEAFAKTT 298
tr|B2KFD4|B2KFD4_MOUSE  IDVYKIMEKVDYPRNESGDMAAVIHPNLQDQDWKPLHPGDPVFVSLDGKVIPLGGDCTVYPVFVNEAAYYEKKEAFAKTT 298
tr|F6ZFN3|F6ZFN3_ORNAN  IEAYKLIEKVDFPRNKKGEITALIHQSLQDQDWKPLNPGDPVFLTLDGKIIPFDGDCVVYPVFVNEAAYYEKKEAFAKSL 300
tr|H9H8M1|H9H8M1_MONDO  LEAYQVTGKVDYPRKANGEIAAVIHPSLQDRDWQPLKPGEPAFLTLDGTTIPFDGDGPVYPVFVNEAAYYEKGEAFAKTR 289
tr|G3VQ32|G3VQ32_SARHA  IVAYKLIESVHFPRSPDGEFLGIVHPQLQDKDFLPLKPGEPIFQLLSGEEIFYEGDVPIYPAFINEAAYYEKGVAFLKLE 299
sp|Q5M876|ACY3_RAT      MEVYKNLGSVDFPRTTDGHLTGTVHSRLQDHDFEPLRPGEPIFKLFSGEDVLYEGDSVVYPLFVNEAAYYEKRVAFLKSE 299
tr|H0WH68|H0WH68_OTOGA  MKAYSIVGTVDFPRTKDGHLAGTVHPRLQDQDFELLQPGAPIFQMFSGEDVLYEGESTVYPVFINEAAYYEKGIAFFQTK 299
tr|H0UYR8|H0UYR8_CAVPO  MEVYKFLGCMDFPRSEDGDLAGMVHPQLQDQDFEPVQPGAPIFQLFSGEDMLYEGDSTMYPLFINEAAYYEKNIAFMKSK 298
tr|G1R3Y2|G1R3Y2_NOMLE  MEAYRPVGVVDFPRTEAGNLAGTVHPQLQDRDFQPLQPGAPIFQMFSGEDLLYEGESTVYPMFINEAAYYEKGVAFVQTE 299
tr|F7A210|F7A210_MACMU  MEAYRPVGVMDFPRTDAGNLAGTVHPQLQDRDFQPLQPGAPIFQMFSGEDLLYDGESTVYPVFINEAAYYEKGIAFVQTE 299
tr|G7PP64|G7PP64_MACFA  MEAYRPVGVMDFPRTDAGNLAGTVHPQLQDRDFQPLQPGAPIFQMFSGEDLLYDGESTVYPVFINEAAYYEKGIAFVQTE 299
tr|G3I3Y2|G3I3Y2_CRIGR  MDIYRTLGSVDFPRTADGDLTGTVHPQLQDHDFEPLRPGEPIFKLFSGEDVLYEGNSIVYPVFINEAAYYEKNVAFLESE 299
tr|G1PIL7|G1PIL7_MYOLU  LEAYRNVSSVDFPRTETGDLAGTVHPQLQ--------------------------------------------------- 247
                        :  :     :.:**   *.. . :*  **                                                   
sp|P45381|ACY2_HUMAN    KLTL-NAKSI--RCCLH------ 313
tr|H2QBW4|H2QBW4_PANTR  KLTL-NAKSI--RCCLH------ 313
tr|G3QQC1|G3QQC1_GORGO  KLTL-NAKSI--RCSLH------ 313
sp|Q5R9E0|ACY2_PONAB    KLTL-NAKSI--RCSLH------ 313
tr|G1S5Z4|G1S5Z4_NOMLE  KLTL-NAKSI--RCSSH------ 313
tr|G7PT66|G7PT66_MACFA  KLML-NAKSI--RCSVH------ 313
tr|F7DR53|F7DR53_MACMU  KLML-NAKSI--RCSVH------ 313
tr|F6WMI4|F6WMI4_HORSE  KLTL-NAKSI--RSSLH------ 313
sp|B1PK17|ACY2_PIG      KLTL-NAKGI--HSSLH------ 313
tr|G3TAV8|G3TAV8_LOXAF  KLTL-NAKSI--CSSLH------ 313
sp|P46446|ACY2_BOVIN    KLTL-NANSI--RSSLH------ 313
tr|G1SPT6|G1SPT6_RABIT  TLTL-NAKSI--RSSSH------ 313
tr|H0WW85|H0WW85_OTOGA  KLTL-KAKSI--RSSLH------ 313 
tr|G1P679|G1P679_MYOLU  ILTL-KAKSI--RSSLH------ 312
tr|E2R8M6|E2R8M6_CANFA  KLIL-NARSI--RSSLH------ 313
tr|G5B939|G5B939_HETGA  KLTL-NAKSI--RSSFH------ 308
sp|Q9R1T5|ACY2_RAT      KLTL-NAKSI--RSTLH------ 312
tr|B2KFD4|B2KFD4_MOUSE  KLTL-SAKSI--RSTLH------ 312
tr|F6ZFN3|F6ZFN3_ORNAN  KVTL-NAQGI--KSPCK------ 314
tr|H9H8M1|H9H8M1_MONDO  KVTL-TARRL--DAAGA------ 303
tr|G3VQ32|G3VQ32_SARHA  K-RTFSIPPL--ET--PAASTP- 316
sp|Q5M876|ACY3_RAT      KIRI-SVPALPGLT--PSSTQTP 319
tr|H0WH68|H0WH68_OTOGA  KLTF-SVPALPALT--SACTPGP 319
tr|H0UYR8|H0UYR8_CAVPO  KLTV-SIPALPVLT--PNPTPLT 318
tr|G1R3Y2|G1R3Y2_NOMLE  KFTF-TVPAMPALT--PDPSPAS 319
tr|F7A210|F7A210_MACMU  KFTF-TVPAMPVLN--PAPSPAS 319
tr|G7PP64|G7PP64_MACFA  KFTF-TVPAMPVLN--PAPSPAS 319
tr|G3I3Y2|G3I3Y2_CRIGR  RIRV-SVPALPGLT--SSSTLVP 319
tr|G1PIL7|G1PIL7_MYOLU  ----------------------- 247

SIFT mutation table

SIFT_Mutation_table

PSSM

pssm.out