Difference between revisions of "CD task6 protocol"

From Bioinformatikpedia
(Multiple Sequence Alignment)
(Multiple Sequence Alignment)
Line 93: Line 93:
 
==Multiple Sequence Alignment==
 
==Multiple Sequence Alignment==
   
We searched UniProt_mammals with a simple Blast Search and extracted non repeating sequences by hand. Then we used T-Coffee Expresso for the generation of the MSA.
+
We searched UniProt_mammals with a simple Blast Search and extracted non redundant sequences by hand. Thus we found 29 homologues. Then we used T-Coffee Expresso for the generation of the MSA.
   
 
sp|P45381|ACY2_HUMAN MTSCHIA-----EE----------H-IQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRY 64
 
sp|P45381|ACY2_HUMAN MTSCHIA-----EE----------H-IQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRY 64

Revision as of 23:03, 19 June 2012

Blosum62

#  Matrix made by matblas from blosum62.iij
#  * column uses minimum score
#  BLOSUM Clustered Scoring Matrix in 1/2 Bit Units
#  Blocks Database = /data/blocks_5.0/blocks.dat
#  Cluster Percentage: >= 62
#  Entropy =   0.6979, Expected =  -0.5209
   A  R  N  D  C  Q  E  G  H  I  L  K  M  F  P  S  T  W  Y  V  B  Z  X  *
A  4 -1 -2 -2  0 -1 -1  0 -2 -1 -1 -1 -1 -2 -1  1  0 -3 -2  0 -2 -1  0 -4 
R -1  5  0 -2 -3  1  0 -2  0 -3 -2  2 -1 -3 -2 -1 -1 -3 -2 -3 -1  0 -1 -4 
N -2  0  6  1 -3  0  0  0  1 -3 -3  0 -2 -3 -2  1  0 -4 -2 -3  3  0 -1 -4 
D -2 -2  1  6 -3  0  2 -1 -1 -3 -4 -1 -3 -3 -1  0 -1 -4 -3 -3  4  1 -1 -4 
C  0 -3 -3 -3  9 -3 -4 -3 -3 -1 -1 -3 -1 -2 -3 -1 -1 -2 -2 -1 -3 -3 -2 -4 
Q -1  1  0  0 -3  5  2 -2  0 -3 -2  1  0 -3 -1  0 -1 -2 -1 -2  0  3 -1 -4 
E -1  0  0  2 -4  2  5 -2  0 -3 -3  1 -2 -3 -1  0 -1 -3 -2 -2  1  4 -1 -4 
G  0 -2  0 -1 -3 -2 -2  6 -2 -4 -4 -2 -3 -3 -2  0 -2 -2 -3 -3 -1 -2 -1 -4 
H -2  0  1 -1 -3  0  0 -2  8 -3 -3 -1 -2 -1 -2 -1 -2 -2  2 -3  0  0 -1 -4 
I -1 -3 -3 -3 -1 -3 -3 -4 -3  4  2 -3  1  0 -3 -2 -1 -3 -1  3 -3 -3 -1 -4 
L -1 -2 -3 -4 -1 -2 -3 -4 -3  2  4 -2  2  0 -3 -2 -1 -2 -1  1 -4 -3 -1 -4 
K -1  2  0 -1 -3  1  1 -2 -1 -3 -2  5 -1 -3 -1  0 -1 -3 -2 -2  0  1 -1 -4 
M -1 -1 -2 -3 -1  0 -2 -3 -2  1  2 -1  5  0 -2 -1 -1 -1 -1  1 -3 -1 -1 -4 
F -2 -3 -3 -3 -2 -3 -3 -3 -1  0  0 -3  0  6 -4 -2 -2  1  3 -1 -3 -3 -1 -4 
P -1 -2 -2 -1 -3 -1 -1 -2 -2 -3 -3 -1 -2 -4  7 -1 -1 -4 -3 -2 -2 -1 -2 -4 
S  1 -1  1  0 -1  0  0  0 -1 -2 -2  0 -1 -2 -1  4  1 -3 -2 -2  0  0  0 -4 
T  0 -1  0 -1 -1 -1 -1 -2 -2 -1 -1 -1 -1 -2 -1  1  5 -2 -2  0 -1 -1  0 -4 
W -3 -3 -4 -4 -2 -2 -3 -2 -2 -3 -2 -3 -1  1 -4 -3 -2 11  2 -3 -4 -3 -2 -4 
Y -2 -2 -2 -3 -2 -1 -2 -3  2 -1 -1 -2 -1  3 -3 -2 -2  2  7 -1 -3 -2 -1 -4 
V  0 -3 -3 -3 -1 -2 -2 -3 -3  3  1 -2  1 -1 -2 -2  0 -3 -1  4 -3 -2 -1 -4 
B -2 -1  3  4 -3  0  1 -1  0 -3 -4  0 -3 -3 -2  0 -1 -4 -3 -3  4  1 -1 -4 
Z -1  0  0  1 -3  3  4 -2  0 -3 -3  1 -1 -3 -1  0 -1 -3 -2 -2  1  4 -1 -4 
X  0 -1 -1 -1 -2 -1 -1 -1 -1 -1 -1 -1 -1 -1 -2  0  0 -2 -1 -1 -1 -1 -1 -4 
* -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4  1

PAM1

1 PAM evolutionary distance

         Ala  Arg  Asn  Asp  Cys  Gln  Glu  Gly  His  Ile  Leu  Lys  Met  Phe  Pro  Ser  Thr  Trp  Tyr  Val
           A    R    N    D    C    Q    E    G    H    I    L    K    M    F    P    S    T    W    Y    V
Ala A  9867     2    9   10    3    8   17   21    2    6    4    2    6    2   22   35   32    0    2   18
Arg R     1  9913    1    0    1   10    0    0   10    3    1   19    4    1    4    6    1    8    0    1
Asn N     4     1 9822   36    0    4    6    6   21    3    1   13    0    1    2   20    9    1    4    1
Asp D     6     0   42 9859    0    6   53    6    4    1    0    3    0    0    1    5    3    0    0    1
Cys C     1     1    0    0 9973    0    0    0    1    1    0    0    0    0    1    5    1    0    3    2
Gln Q     3     9    4    5    0 9876   27    1   23    1    3    6    4    0    6    2    2    0    0    1
Glu E    10     0    7   56    0   35 9865    4    2    3    1    4    1    0    3    4    2    0    1    2
Gly G    21     1   12   11    1    3    7 9935    1    0    1    2    1    1    3   21    3    0    0    5
His H     1     8   18    3    1   20    1    0 9912    0    1    1    0    2    3    1    1    1    4    1
Ile I     2     2    3    1    2    1    2    0    0 9872    9    2   12    7    0    1    7    0    1   33
Leu L     3     1    3    0    0    6    1    1    4   22 9947    2   45   13    3    1    3    4    2   15
Lys K     2    37   25    6    0   12    7    2    2    4    1 9926   20    0    3    8   11    0    1    1
Met M     1     1    0    0    0    2    0    0    0    5    8    4 9874    1    0    1    2    0    0    4
Phe F     1     1    1    0    0    0    0    1    2    8    6    0    4 9946    0    2    1    3   28    0
Pro P    13     5    2    1    1    8    3    2    5    1    2    2    1    1 9926   12    4    0    0    2
Ser S    28    11   34    7   11    4    6   16    2    2    1    7    4    3   17 9840   38    5    2    2
Thr T    22     2   13    4    1    3    2    2    1   11    2    8    6    1    5   32 9871    0    2    9
Trp W     0     2    0    0    0    0    0    0    0    0    0    0    0    1    0    1    0 9976    1    0
Tyr Y     1     0    3    0    3    0    1    0    4    1    1    0    0   21    0    1    1    2 9945    1
Val V    13     2    1    1    3    2    2    3    3   57   11    1   17    1    3    2   10    0    2 9901

PAM250

250 PAM evolutionary distance

                     ORIGINAL AMINO ACID

        Ala  Arg  Asn  Asp  Cys  Gln  Glu  Gly  His  Ile  Leu  Lys  Met  Phe  Pro  Ser  Thr  Trp  Tyr  Val
         A    R    N    D    C    Q    E    G    H    I    L    K    M    F    P    S    T    W    Y    V
Ala A    13    6    9    9    5    8    9   12    6    8    6    7    7    4   11   11   11    2    4    9
Arg R     3   17    4    3    2    5    3    2    6    3    2    9    4    1    4    4    3    7    2    2
Asn N     4    4    6    7    2    5    6    4    6    3    2    5    3    2    4    5    4    2    3    3
Asp D     5    4    8   11    1    7   10    5    6    3    2    5    3    1    4    5    5    1    2    3
Cys C     2    1    1    1   52    1    1    2    2    2    1    1    1    1    2    3    2    1    4    2
Gln Q     3    5    5    6    1   10    7    3    7    2    3    5    3    1    4    3    3    1    2    3
Glu E     5    4    7   11    1    9   12    5    6    3    2    5    3    1    4    5    5    1    2    3
Gly G    12    5   10   10    4    7    9   27    5    5    4    6    5    3    8   11    9    2    3    7
His H     2    5    5    4    2    7    4    2   15    2    2    3    2    2    3    3    2    2    3    2
Ile I     3    2    2    2    2    2    2    2    2   10    6    2    6    5    2    3    4    1    3    9
Leu L     6    4    4    3    2    6    4    3    5   15   34    4   20   13    5    4    6    6    7   13
Lys K     6   18   10    8    2   10    8    5    8    5    4   24    9    2    6    8    8    4    3    5
Met M     1    1    1    1    0    1    1    1    1    2    3    2    6    2    1    1    1    1    1    2
Phe F     2    1    2    1    1    1    1    1    3    5    6    1    4   32    1    2    2    4   20    3
Pro P     7    5    5    4    3    5    4    5    5    3    3    4    3    2   20    6    5    1    2    4
Ser S     9    6    8    7    7    6    7    9    6    5    4    7    5    3    9   10    9    4    4    6
Thr T     8    5    6    6    4    5    5    6    4    6    4    6    5    3    6    8   11    2    3    6
Trp W     0    2    0    0    0    0    0    0    1    0    1    0    0    1    0    1    0   55    1    0
Tyr Y     1    1    2    1    3    1    1    1    3    2    2    1    2   15    1    2    2    3   31    2
Val V     7    4    4    4    4    4    4    4    5    4   15   10    4   10    5    5    5   72    4   17

Create position specific substitution matrix

blastpgp -d /mnt/project/pracstrucfunc12/data/big/big_80 -i p45381_wt.fa -o psiblast_it2_p45381_wt_big80.out -j 5 -Q pssm.out

Multiple Sequence Alignment

We searched UniProt_mammals with a simple Blast Search and extracted non redundant sequences by hand. Thus we found 29 homologues. Then we used T-Coffee Expresso for the generation of the MSA.

sp|P45381|ACY2_HUMAN    MTSCHIA-----EE----------H-IQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRY 64
tr|H2QBW4|H2QBW4_PANTR  MTSCHIA-----EE----------H-IQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRY 64
tr|G3QQC1|G3QQC1_GORGO  MTSCHIA-----EE----------H-IQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRY 64
sp|Q5R9E0|ACY2_PONAB    MTSCHIA-----EE----------P-IQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRY 64
tr|G1S5Z4|G1S5Z4_NOMLE  MTSCHIA-----EE----------H-IQKVAIFGGTHGNELTGVFLVKYWLENGAEIQRTGLEVKPFITNPRAVKKCTRY 64
tr|G7PT66|G7PT66_MACFA  MTSCHIA-----EE----------P-IKKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRY 64
tr|F7DR53|F7DR53_MACMU  MTSCHIA-----EE----------P-IKKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRY 64
tr|F6WMI4|F6WMI4_HORSE  ------M-----TS-CH----NAEDPIKKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVTPFITNPRAVKKCTRY 64
sp|B1PK17|ACY2_PIG      -MTSCQV-----AE----------DPIKKVAIFGGTHGNELTGVFLVKHWLENNTEIQRTGLEVKPFITNPRAVEKCTRY 64
tr|G3TAV8|G3TAV8_LOXAF  MTSCHVA-----EE----------P-IKKVAIFGGTHGNELTGVFLVKHWLEDGAEIQRAGLEVKPFITNPRAVKKCSRY 64
sp|P46446|ACY2_BOVIN    ------M-----TS-----CHVAEDPIKKVAIFGGTHGNELTGVFLVKHWLENSTEIQRTGLEVKPFITNPRAVKKCTRY 64
tr|G1SPT6|G1SPT6_RABIT  ------------MSSCH---VAEAP-IKKIAIFGGTHGNELTGVFLVKHWLQNGAEIQRTGLEVRPFITNPRAVEKCTRY 64
tr|H0WW85|H0WW85_OTOGA  MTSCHIA-----EE----------P-IKKVAIFGGTHGNELTGVFLVKHWLQNGAEIQRTGLEIKPLITNPKAVKKCTRY 64
tr|G1P679|G1P679_MYOLU  -------------MTYH----VVEDPIKKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRY 63
tr|E2R8M6|E2R8M6_CANFA  -------------M--TSYHVTEDP-IKKVAIFGGTHGNELTGVFLVKHWLENDTEIQRTGLEVKPFITNPRAVKKCTRY 64
tr|G5B939|G5B939_HETGA  ------M-----TE----------KPIKKIAIFGGTHGNELTGVFLVKHWLQDGAEIQRTGLEVKPFISNPRAVKKCLRY 59
sp|Q9R1T5|ACY2_RAT      -MTSCVA-----EE----------P-IKKIAIFGGTHGNELTGVFLVTHWLKNGAEVHRAGLEVKPFITNPRAVEKCTRY 63
tr|B2KFD4|B2KFD4_MOUSE  -MTSCVA-----KE----------P-IKKIAIFGGTHGNELTGVFLVTHWLRNGTEVHRAGLDVKPFITNPRAVEKCTRY 63
tr|F6ZFN3|F6ZFN3_ORNAN  MTSGQVV-----CE--T--------PVRRIAIFGGTHGNELSGVFLVKHWQENGTEIQRTGLEVNPFITNPRAVEKCTRY 65
tr|H9H8M1|H9H8M1_MONDO  MAAPRGA-----RT--P---------LTRVAIFGGTHGNELSGVLLARHWQEDGAEVQRPGLRVTPFISNPRAVHRGVRY 64
tr|G3VQ32|G3VQ32_SARHA  ----MCS-----TAS------MGHR-LNRVAVMGGTHGNELSGVYLVKHWLQDPSELQRRTFTVTPFLANPKATKRCMRY 64
sp|Q5M876|ACY3_RAT      MCSLPGS-----RKP------L-----LRVAVTGGTHGNEMCGVYLARYWLQNPGELQRPSFSAMPVLANPAATAACRRY 64
tr|H0WH68|H0WH68_OTOGA  ----MCS-RPVPREP------L-----HRVAVTGGTHGNEMSGICLVRHWLQAPGELQRPSFSAVPVLANLAAIAACRRY 64
tr|H0UYR8|H0UYR8_CAVPO  ----MCS-LPVPQEP------L-----RRVAVTGGTHGNEMSGVYLVRQWLRTPVDLQRPSFSAVPVLANPAATAVCRRY 64
tr|G1R3Y2|G1R3Y2_NOMLE  ----MCS-LPVPREP------L-----RRVAVTGGTHGNEMSGIYLARHWLRAPAELQRPSFSAVPVLANPAATAGCRRY 64
tr|F7A210|F7A210_MACMU  ----MCS-LPVPREP------L-----RRVAVTGGTHGNEMSGVYLARHWLQAPAELQRLSFSAVPVLANPAATAACRRY 64
tr|G7PP64|G7PP64_MACFA  ----MCS-LPVPREP------L-----RRVAVTGGTHGNEMSGVYLARHWLQAPAELERLSFSAVPVLANPAATAACRRY 64
tr|G3I3Y2|G3I3Y2_CRIGR  -----MSSLPVPREP------L-----RRVAVTGGTHGNEMCGIHLIRHWLQAPGELQRPSFSAMPVLANPAATAACRRY 64
tr|G1PIL7|G1PIL7_MYOLU  ----MCS-RPAPREP------L-----RRVAVIGGTHGNEMSGVHLARHWLRALGELQRPSFSAVPVLANPAATAACRRY 64
                                                    ::*: *******: *: *   * .   ::.*  :   *.::*  *     ** 

sp|P45381|ACY2_HUMAN    IDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILED--SRNN--FLIQMF 140
tr|H2QBW4|H2QBW4_PANTR  IDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILED--SRNN--FLIQMF 140
tr|G3QQC1|G3QQC1_GORGO  IDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILED--SRNN--FLIQMF 140
sp|Q5R9E0|ACY2_PONAB    IDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILED--SRNN--FLIQMF 140
tr|G1S5Z4|G1S5Z4_NOMLE  IDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILED--SRNN--FLIQMF 140
tr|G7PT66|G7PT66_MACFA  IDCDLNRIFDLENLGKKMSEDLPYEVRRAQEIYHLFGPKDGEDSYDIIFDLHNTTSNMGCTLILED--SRNN--FLIQMF 140
tr|F7DR53|F7DR53_MACMU  IDCDLNRIFDLENLGKKMSEDLPYEVRRAQEIYHLFGPKDGEDSYDIIFDLHNTTSNMGCTLILED--SRNN--FLIQMF 140
tr|F6WMI4|F6WMI4_HORSE  IDCDLNRVFDLENLGKKMSEDLPYEVRRAQEINHLFGPKNSEDSYDIIFDLHNTTSNMGCTLILED--SRND--FLIQMF 140
sp|B1PK17|ACY2_PIG      IDCDLNRVFDPENLGKRMSEDLPYEVRRAQEISRLFGPKDSEDSYDIIFDLHNTTSNMGCTLILED--SRND--FLIQMF 140
tr|G3TAV8|G3TAV8_LOXAF  IDCDLNRVFDLENLGKNRSEDLPYEVIRAQEINHLFGPKESEDSYDIIFDLHNTTSNMGCTLILED--SKND--FLIQMF 140
sp|P46446|ACY2_BOVIN    IDCDLNRVFDPENLGKKKSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILED--SRND--FLIQMF 140
tr|G1SPT6|G1SPT6_RABIT  IDCDLNRIFDLENLSKEVSEDLPYEVRRAQEINRLFGPKDSEDSYDIIFDLHNTTSNMGCTLILED--SRND--FLIQMF 140
tr|H0WW85|H0WW85_OTOGA  IDCDLNRVFDSENLGKEISEDLPYEVRRAQEINLLFGPKHSEDSYDIIFDLHNTTSNMGCTLILED--SRNN--LLIQMF 140
tr|G1P679|G1P679_MYOLU  IDCDLNRVFDHGNLGKKLSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILED--SRND--FLIQMF 139
tr|E2R8M6|E2R8M6_CANFA  IDCDLNRVFDPENLGKKVSKDLPYEVRRAQEINHLFGPKDNEDSYDIIFDLHNTTSNMGCTLILED--SRND--LLIQMF 140
tr|G5B939|G5B939_HETGA  IDCDLNRVFDLENLGKKMSEDLPYEVRRAQEINHLFGQKNSEDSYDIIFDLHNTTSNMGCTLILED--SKND--FLIQMF 135
sp|Q9R1T5|ACY2_RAT      IDCDLNRVFDLENLSKEMSEDLPYEVRRAQEINHLFGPKNSDDAYDVVFDLHNTTSNMGCTLILED--SRND--FLIQMF 139
tr|B2KFD4|B2KFD4_MOUSE  IDCDLNRVFDLENLSKEMSEDLPYEVRRAQEINHLFGPKNSDDAYDIVFDLHNTTSNMGCTLILED--SRND--FLIQMF 139
tr|F6ZFN3|F6ZFN3_ORNAN  IDCDLNRVFDLENLCKKETENLPYEIRRAQEINHLFGPKGSEDAYDLIFDLHNTTSNTGCTIILEN--SKND--FIIQMV 141
tr|H9H8M1|H9H8M1_MONDO  VDRDLNRVFDPAHLGPEPPEDQPYEVEQAREIHRLFG------AYDVILDLHNTTSNMGCTLILES--SRDD--VLIQMF 134
tr|G3VQ32|G3VQ32_SARHA  ISQDLNRSFTKAFLLSKGTKDDLYEVSRAQEINQLFGPRGSADAFDFIFDLHNTTSNMAACLISDSEKN-V---FTMHMC 140
sp|Q5M876|ACY3_RAT      IDRDLNRTFTLTFLGSTATPDDPYEVKRAQELNQLLGPKGTCQAFDFILDLHNTTANTGACLISEV-SQ-NP--FNLHLC 140
tr|H0WH68|H0WH68_OTOGA  VGCDLNRTFISTFLTAKASPDDPYEVTRARELNQLLGPKASSQAFDFVLDLHNTTANVGTCLIIDT--N-QD-VFAMHLC 140
tr|H0UYR8|H0UYR8_CAVPO  IGRDLNRTFTSTFLTSKATPDELYEVTRARELNHLLGPKNSSQAFDFILDLHNTTANMGTCFIL----N-VTDTFAMHLC 139
tr|G1R3Y2|G1R3Y2_NOMLE  VDHDLNRTFTSSFLNSRPTPDDPYEVTRARELNQLLGPKASGRAFDFVLDLHNTTANVGTCLIAKS--S-HE-VFAMHLC 140
tr|F7A210|F7A210_MACMU  VDHDLNRAFTSSFLNSRPTPDDPYEVTRARELNQLLGPKASGRAFDFVLDLHNTTANMGTCLIAKS--S-HE-VFAMHLC 140
tr|G7PP64|G7PP64_MACFA  VDHDLNRAFTSSFLNSRPTPDDPYEVTRARELNQLLGPKASGRAFDFVLDLHNTTANMGTCLIAKS--S-HE-VFAMHLC 140
tr|G3I3Y2|G3I3Y2_CRIGR  MDRDLNRTFTFTFLSSTATPNDPYEVTRAQELNQLLGPKGTDQAFDFILDLHNTTANTGVCLISE--AS-HS-PFNLHLC 140
tr|G1PIL7|G1PIL7_MYOLU  VDCDLNRAFTGAFLTARAHPDDPYEVTRARELNQLLGPKASGQAFDFVLDLHNTTASMGTCLIESS-HN-V---FAMHLC 139
                        :. **** *    *      :  **: :*:*:  *:*      ::*.::******:. .  :*     .     . ::: 
sp|P45381|ACY2_HUMAN    HYIKTSLA-PLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCA 219
tr|H2QBW4|H2QBW4_PANTR  HYIKTSLA-PLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCA 219
tr|G3QQC1|G3QQC1_GORGO  HYIKTSLA-PLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCA 219
sp|Q5R9E0|ACY2_PONAB    HYIKTSLA-PLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCA 219
tr|G1S5Z4|G1S5Z4_NOMLE  HYIKTSLA-PLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCA 219
tr|G7PT66|G7PT66_MACFA  HYIKTSLA-PLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCA 219
tr|F7DR53|F7DR53_MACMU  HYIKTSLA-PLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCA 219
tr|F6WMI4|F6WMI4_HORSE  HYIKTSLA-PLPCYVYLIEHPSLKYATTRSVAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHNFNEGKEFPPCA 219
sp|B1PK17|ACY2_PIG      HYIKTSLA-PLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHNFNEGKEFPPCA 219
tr|G3TAV8|G3TAV8_LOXAF  HYIKTSLA-PSPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPSCA 219
sp|P46446|ACY2_BOVIN    HYIKTSLA-PLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIQHALDFIHNFNEGKEFPPCA 219
tr|G1SPT6|G1SPT6_RABIT  HYIKTSLA-PLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKIIKHALDFVHHFNKGKEFPPCA 219
tr|H0WW85|H0WW85_OTOGA  HYIKTSLA-PLPCYVYLIEHPTFKYATTRSVAKYPVGIEVGPQPHGVLRADILNQMRKMIKHALDFIHDFNEGKEFPPCA 219
tr|G1P679|G1P679_MYOLU  HYIKTSLA-PLPCYIYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKYALDFIHNFNEGKEFPPCA 218
tr|E2R8M6|E2R8M6_CANFA  HYIKNSLA-PLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKYALDFIHNFNEGKEFPPCA 219
tr|G5B939|G5B939_HETGA  HYIKTSLA-PLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHQFNQGKEFPPCA 214
sp|Q9R1T5|ACY2_RAT      HYIKTCMA-PLPCSVYLIEHPSLKYATTRSIAKYPVGIEVGPQPHGVLRADILDQMRRMLKHALDFIQRFNEGKEFPPCA 218
tr|B2KFD4|B2KFD4_MOUSE  HYIKTCMA-PLPCSVYLIEHPSLKYATTRSIAKYPVGIEVGPQPHGVLRADILDQMRKMIKHALDFIQHFNEGKEFPPCS 218
tr|F6ZFN3|F6ZFN3_ORNAN  HYIQNSLA-PLPCYVYLIEHPTLKYSTTRSIAKYPVGIEVGPQPQGVLRADILDQMRKIIKHALDFVQHFNEGREFPPCT 220
tr|H9H8M1|H9H8M1_MONDO  RYIQVPPGRPAPPYVDSSQEPPLQEADLPPWASLPFGRGVGVDFQGLAKVEVKTWARVFFRVSCLF-----PGREFPACS 209
tr|G3VQ32|G3VQ32_SARHA  HYIQVKHT-QTPCPIYLYGLPGQENYSLMSVAKNSLGLELGPQPHGVLRADVSAHMRALLACGLDFIDLFNQGTSFPAFD 219
sp|Q5M876|ACY3_RAT      HYLQLQNP-GLPCRLFQFEPPGTESYSMDSVSKNGISLELGPQPQGVLRAELFSQMRAMVASILDFIELFNQGMEFPAFE 219
tr|H0WH68|H0WH68_OTOGA  HHLQLQNP-ELPCRVILYQRPGEERFSLSSVTKNGISLELGPQPQGVLRADLFSQMRALVAAVLDFIELFNQGTAFPAFE 219
tr|H0UYR8|H0UYR8_CAVPO  HYLQLQNS-EPPSRVLVIEASEDTTFSVDSVAKHGMTVELGPQPQGVLRADLFSRMRSLVASVLDFIELFNQGAAFPAFE 218
tr|G1R3Y2|G1R3Y2_NOMLE  RHLQLQYP-ELSCQVFLYQRSGEESYNLDSVAKNGLGLELGPQPQGVLRADIFSRMRTLVATVLDFIELFNQGTAFPAFE 219
tr|F7A210|F7A210_MACMU  RHLQLQYP-ELSCQVFLCQRSGEESYNLDSVAKNGLALELGPQPQGVLRADIFSRMRTLVATVLDFIELFNQGTAFPAFE 219
tr|G7PP64|G7PP64_MACFA  RHLQLQYP-ELSCQVFLCQRSGEESYNLDSVAKNGLALELGPQPQGVLRADIFSRMRTLVATVLDFIELFNQGTAFPAFE 219
tr|G3I3Y2|G3I3Y2_CRIGR  HYLQLQNP-GLPCRLFQYDISGRETYSVESVSKDGICLELGPQPQGVLRADLFSQMRTLVGSILDFIELFNQGMAFPAFE 219
tr|G1PIL7|G1PIL7_MYOLU  RHLQLQSP-ELPCRVFLYQLPGEETYSVNSVAKSGLGLELGPQPQGVLRADLLVRMRALVAAALDFIQLFNQGTEFPAFE 218
                        ::::       .  :     .        . :.  .   :* : :*: :.::    * :.     *      *  **.  
sp|P45381|ACY2_HUMAN    IEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTT 299
tr|H2QBW4|H2QBW4_PANTR  IEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTT 299
tr|G3QQC1|G3QQC1_GORGO  IEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTT 299
sp|Q5R9E0|ACY2_PONAB    IEVYKIIEKVDYPRDENGEIAAVIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTT 299
tr|G1S5Z4|G1S5Z4_NOMLE  IEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPVFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTT 299
tr|G7PT66|G7PT66_MACFA  IEVYKIIEKVDYPRDENGEIAAVIHPNLQDQDWKPLHPGDPMFLTLDGKTMPLGGDCTVYPVFVNEAAYYEKKEAFAKTT 299
tr|F7DR53|F7DR53_MACMU  IEVYKIIEKVDYPRDENGEIAAVIHPNLQDQDWKPLHPGDPMFLTLDGKTMPLGGDCIVYPVFVNEAAYYEKKEAFAKTT 299
tr|F6WMI4|F6WMI4_HORSE  IEVHKIMEKVDYPRNENGEIAAFIHPNLQDQDWKPLYPGDPVFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTT 299
sp|B1PK17|ACY2_PIG      IEVYKIMEKVDYPRNESGEIAAIIHPKLQDQDWKPLHPGDPVFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTT 299
tr|G3TAV8|G3TAV8_LOXAF  IEVYKIMEKVDYPRNESGEIAAVIHPNLQDQDWKPLHPGDPMFLTLDGKTIALDGDCTVYPVFVNEAAYYEKKEAFAKTT 299
sp|P46446|ACY2_BOVIN    IEVYKIMRKVDYPRNESGEISAIIHPKLQDQDWKPLHPEDPVFLTLDGKTIPLGGDQTVYPVFVNEAAYYEKKEAFAKTT 299
tr|G1SPT6|G1SPT6_RABIT  IEVYKIMEKVDYPRNKSGEIAAVIHPNLQDQDWKPLHPGDPVFLTLDGRLIPLGGDCTVYPVFVNEAAYYEKKEAFAKTT 299
tr|H0WW85|H0WW85_OTOGA  IEVYKIMEKVDYPRNENGEISAVIHPDLQDQDWKPLHPGDPVFLTLDGKTIPLGGDCTVYPVFINEASYYEKKEAFAKTT 299
tr|G1P679|G1P679_MYOLU  IEVYKIMEKVDYPRNENGEIAAIIHPNLQDQDWKPLRPEDPVFLTLDGKTIPLGGDCTVYPTFVNEAAYYEKKEAFAKTT 298
tr|E2R8M6|E2R8M6_CANFA  IEVYKIMEKVDYPRNENGDIAALIHPNLQDQDWKPLHPGDPVFLTLEGKSIPLGGDSTVYPVFVNEAAYYEKKEAFAKTT 299
tr|G5B939|G5B939_HETGA  IEAYKIMEKVDFPRNENGEIAAIIHPNLQDQDWKPLHPGDPVFVTLDGKTILLGGDCTVYPVFVNEVAYYEKKEAFAKTT 294
sp|Q9R1T5|ACY2_RAT      IDVYKIMEKVDYPRNESGDVAAVIHPNLQDQDWKPLHPGDPVFVSLDGKVIPLGGDCTVYPVFVNEAAYYEKKEAFAKTT 298
tr|B2KFD4|B2KFD4_MOUSE  IDVYKIMEKVDYPRNESGDMAAVIHPNLQDQDWKPLHPGDPVFVSLDGKVIPLGGDCTVYPVFVNEAAYYEKKEAFAKTT 298
tr|F6ZFN3|F6ZFN3_ORNAN  IEAYKLIEKVDFPRNKKGEITALIHQSLQDQDWKPLNPGDPVFLTLDGKIIPFDGDCVVYPVFVNEAAYYEKKEAFAKSL 300
tr|H9H8M1|H9H8M1_MONDO  LEAYQVTGKVDYPRKANGEIAAVIHPSLQDRDWQPLKPGEPAFLTLDGTTIPFDGDGPVYPVFVNEAAYYEKGEAFAKTR 289
tr|G3VQ32|G3VQ32_SARHA  IVAYKLIESVHFPRSPDGEFLGIVHPQLQDKDFLPLKPGEPIFQLLSGEEIFYEGDVPIYPAFINEAAYYEKGVAFLKLE 299
sp|Q5M876|ACY3_RAT      MEVYKNLGSVDFPRTTDGHLTGTVHSRLQDHDFEPLRPGEPIFKLFSGEDVLYEGDSVVYPLFVNEAAYYEKRVAFLKSE 299
tr|H0WH68|H0WH68_OTOGA  MKAYSIVGTVDFPRTKDGHLAGTVHPRLQDQDFELLQPGAPIFQMFSGEDVLYEGESTVYPVFINEAAYYEKGIAFFQTK 299
tr|H0UYR8|H0UYR8_CAVPO  MEVYKFLGCMDFPRSEDGDLAGMVHPQLQDQDFEPVQPGAPIFQLFSGEDMLYEGDSTMYPLFINEAAYYEKNIAFMKSK 298
tr|G1R3Y2|G1R3Y2_NOMLE  MEAYRPVGVVDFPRTEAGNLAGTVHPQLQDRDFQPLQPGAPIFQMFSGEDLLYEGESTVYPMFINEAAYYEKGVAFVQTE 299
tr|F7A210|F7A210_MACMU  MEAYRPVGVMDFPRTDAGNLAGTVHPQLQDRDFQPLQPGAPIFQMFSGEDLLYDGESTVYPVFINEAAYYEKGIAFVQTE 299
tr|G7PP64|G7PP64_MACFA  MEAYRPVGVMDFPRTDAGNLAGTVHPQLQDRDFQPLQPGAPIFQMFSGEDLLYDGESTVYPVFINEAAYYEKGIAFVQTE 299
tr|G3I3Y2|G3I3Y2_CRIGR  MDIYRTLGSVDFPRTADGDLTGTVHPQLQDHDFEPLRPGEPIFKLFSGEDVLYEGNSIVYPVFINEAAYYEKNVAFLESE 299
tr|G1PIL7|G1PIL7_MYOLU  LEAYRNVSSVDFPRTETGDLAGTVHPQLQ--------------------------------------------------- 247
                        :  :     :.:**   *.. . :*  **                                                   
sp|P45381|ACY2_HUMAN    KLTL-NAKSI--RCCLH------ 313
tr|H2QBW4|H2QBW4_PANTR  KLTL-NAKSI--RCCLH------ 313
tr|G3QQC1|G3QQC1_GORGO  KLTL-NAKSI--RCSLH------ 313
sp|Q5R9E0|ACY2_PONAB    KLTL-NAKSI--RCSLH------ 313
tr|G1S5Z4|G1S5Z4_NOMLE  KLTL-NAKSI--RCSSH------ 313
tr|G7PT66|G7PT66_MACFA  KLML-NAKSI--RCSVH------ 313
tr|F7DR53|F7DR53_MACMU  KLML-NAKSI--RCSVH------ 313
tr|F6WMI4|F6WMI4_HORSE  KLTL-NAKSI--RSSLH------ 313
sp|B1PK17|ACY2_PIG      KLTL-NAKGI--HSSLH------ 313
tr|G3TAV8|G3TAV8_LOXAF  KLTL-NAKSI--CSSLH------ 313
sp|P46446|ACY2_BOVIN    KLTL-NANSI--RSSLH------ 313
tr|G1SPT6|G1SPT6_RABIT  TLTL-NAKSI--RSSSH------ 313
tr|H0WW85|H0WW85_OTOGA  KLTL-KAKSI--RSSLH------ 313 
tr|G1P679|G1P679_MYOLU  ILTL-KAKSI--RSSLH------ 312
tr|E2R8M6|E2R8M6_CANFA  KLIL-NARSI--RSSLH------ 313
tr|G5B939|G5B939_HETGA  KLTL-NAKSI--RSSFH------ 308
sp|Q9R1T5|ACY2_RAT      KLTL-NAKSI--RSTLH------ 312
tr|B2KFD4|B2KFD4_MOUSE  KLTL-SAKSI--RSTLH------ 312
tr|F6ZFN3|F6ZFN3_ORNAN  KVTL-NAQGI--KSPCK------ 314
tr|H9H8M1|H9H8M1_MONDO  KVTL-TARRL--DAAGA------ 303
tr|G3VQ32|G3VQ32_SARHA  K-RTFSIPPL--ET--PAASTP- 316
sp|Q5M876|ACY3_RAT      KIRI-SVPALPGLT--PSSTQTP 319
tr|H0WH68|H0WH68_OTOGA  KLTF-SVPALPALT--SACTPGP 319
tr|H0UYR8|H0UYR8_CAVPO  KLTV-SIPALPVLT--PNPTPLT 318
tr|G1R3Y2|G1R3Y2_NOMLE  KFTF-TVPAMPALT--PDPSPAS 319
tr|F7A210|F7A210_MACMU  KFTF-TVPAMPVLN--PAPSPAS 319
tr|G7PP64|G7PP64_MACFA  KFTF-TVPAMPVLN--PAPSPAS 319
tr|G3I3Y2|G3I3Y2_CRIGR  RIRV-SVPALPGLT--SSSTLVP 319
tr|G1PIL7|G1PIL7_MYOLU  ----------------------- 247

SIFT mutation table

SIFT_Mutation_table

PSSM

pssm.out