Difference between revisions of "CD task4 protocol"
(Created page with "=Modeller= We modified the scripts provided by the tutorial: [https://www.dropbox.com/s/un3vvkpn9ig5uzw/1_align.py.txt 1_align.py] to suit our de…") |
(→Modeller) |
||
(17 intermediate revisions by 2 users not shown) | |||
Line 1: | Line 1: | ||
+ | =Template identification= |
||
+ | |||
+ | [https://www.dropbox.com/s/x1f9707hm0wgh2d/HHPred.out HHPred output] |
||
=Modeller= |
=Modeller= |
||
− | We modified the scripts provided |
+ | We modified the scripts provided in the [[Using_Modeller_for_TASK_4 | tutorial]] to suit our demands. |
+ | |||
+ | ==Target== |
||
+ | |||
+ | The sequence of out target Aspartoacylase saved in .pir format: |
||
+ | |||
+ | >P1;p45381 |
||
+ | sequence:p45381:::::::0.00: 0.00 |
||
+ | MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKK |
||
+ | CTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTS |
||
+ | NMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVG |
||
+ | PQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIA |
||
+ | AIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTK |
||
+ | LTLNAKSIRCCLH* |
||
+ | |||
+ | ==Alignment== |
||
+ | |||
+ | Example alignment script for creating the pairwise alignment of 2GU2 and Aspa. |
||
+ | |||
+ | from modeller import * |
||
+ | env = environ() |
||
+ | # env.io.atom_files_directory = ["/apps/modeller9.9/bin/examples/commands/", "/path/to/your/files/"] ## o$ |
||
+ | aln = alignment(env) |
||
+ | mdl = model(env, file='2GU2', model_segment=('FIRST:A', 'END:A')) |
||
+ | aln.append_model(mdl, align_codes='2GU2', atom_files='2GU2') |
||
+ | aln.append(file='../p45381.pir', align_codes='p45381') |
||
+ | aln.align2d() |
||
+ | aln.check() |
||
+ | aln.write(file='aspa_2gu2-2d.ali', alignment_format='PIR') |
||
+ | aln.malign() |
||
+ | aln.check() |
||
+ | aln.write(file='aspa_2gu2.ali', alignment_format='PIR') |
||
+ | |||
+ | ==Single template modelling== |
||
+ | |||
+ | Example alignment script for creating a model of Aspartoacylase from a single template 2GU2:A. |
||
+ | |||
+ | from modeller import * |
||
+ | from modeller.automodel import * |
||
+ | log.verbose() |
||
+ | env = environ() |
||
+ | # env.io.atom_files_directory = ["/apps/modeller9.9/bin/examples/commands/", "/path/to/your/files/"] ## only needed in the VirtualBox |
||
+ | a = automodel(env, |
||
+ | alnfile = 'aspa_2gu2-2d.ali', |
||
+ | knowns = '2GU2A', |
||
+ | sequence = 'p45381', |
||
+ | assess_methods=(assess.DOPE, assess.GA341)) |
||
+ | a.starting_model= 1 |
||
+ | a.ending_model = 1 |
||
+ | a.make() |
||
+ | |||
+ | ==Alignments for different templates== |
||
+ | |||
+ | |||
+ | <table> |
||
+ | <tr> |
||
+ | <td>2GU2</td> |
||
+ | <td><figure id="2gu2_align">[[File:modeller_2gu2_align.png]]</figure></td> |
||
+ | </tr> |
||
+ | |||
+ | <tr> |
||
+ | <td>3NFZ</td> |
||
+ | <td><figure id="3nfz_align">[[File:modeller_3nfz_align.png]]</figure></td> |
||
+ | </tr> |
||
+ | |||
+ | </table> |
||
+ | |||
+ | ==Scores== |
||
+ | |||
+ | <b>2GU2</b> |
||
+ | Filename molpdf DOPE score GA341 score |
||
+ | ---------------------------------------------------------------------- |
||
+ | p45381.B99990001.pdb 1640.80847 -36987.52734 1.00000 |
||
+ | |||
+ | = I-Tasser = |
||
+ | |||
+ | == C Score == |
||
+ | C-score is a confidence score for estimating the quality of predicted models by I-TASSER. It is calculated |
||
+ | based on the significance of threading template alignments and the convergence parameters of the structure |
||
+ | assembly simulations. C-score is typically in the range of [-5,2], where a C-score of higher value signifies |
||
+ | a model with a high confidence and vice-versa. |
||
+ | ==Template > 80% Seq Id: 2GU2 (Rattus Norvegicus)== |
||
− | ==Default settings== |
||
+ | For the > 80% sequence identity template, we used default values, simply providing the template identifier 2GU2 and Chain A for modelling. |
Latest revision as of 14:32, 28 August 2012
Contents
Template identification
Modeller
We modified the scripts provided in the tutorial to suit our demands.
Target
The sequence of out target Aspartoacylase saved in .pir format:
>P1;p45381 sequence:p45381:::::::0.00: 0.00 MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKK CTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTS NMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVG PQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIA AIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTK LTLNAKSIRCCLH*
Alignment
Example alignment script for creating the pairwise alignment of 2GU2 and Aspa.
from modeller import * env = environ() # env.io.atom_files_directory = ["/apps/modeller9.9/bin/examples/commands/", "/path/to/your/files/"] ## o$ aln = alignment(env) mdl = model(env, file='2GU2', model_segment=('FIRST:A', 'END:A')) aln.append_model(mdl, align_codes='2GU2', atom_files='2GU2') aln.append(file='../p45381.pir', align_codes='p45381') aln.align2d() aln.check() aln.write(file='aspa_2gu2-2d.ali', alignment_format='PIR') aln.malign() aln.check() aln.write(file='aspa_2gu2.ali', alignment_format='PIR')
Single template modelling
Example alignment script for creating a model of Aspartoacylase from a single template 2GU2:A.
from modeller import * from modeller.automodel import * log.verbose() env = environ() # env.io.atom_files_directory = ["/apps/modeller9.9/bin/examples/commands/", "/path/to/your/files/"] ## only needed in the VirtualBox a = automodel(env, alnfile = 'aspa_2gu2-2d.ali', knowns = '2GU2A', sequence = 'p45381', assess_methods=(assess.DOPE, assess.GA341)) a.starting_model= 1 a.ending_model = 1 a.make()
Alignments for different templates
2GU2 | <figure id="2gu2_align">![]() |
3NFZ | <figure id="3nfz_align">![]() |
Scores
2GU2
Filename molpdf DOPE score GA341 score ---------------------------------------------------------------------- p45381.B99990001.pdb 1640.80847 -36987.52734 1.00000
I-Tasser
C Score
C-score is a confidence score for estimating the quality of predicted models by I-TASSER. It is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5,2], where a C-score of higher value signifies a model with a high confidence and vice-versa.
Template > 80% Seq Id: 2GU2 (Rattus Norvegicus)
For the > 80% sequence identity template, we used default values, simply providing the template identifier 2GU2 and Chain A for modelling.