Difference between revisions of "CD task2 protocol"

From Bioinformatikpedia
(Created page with "=Sequence= The native ASPA sequence (UniProt: P45381): >hsa:443 ASPA, ACY2, ASP; aspartoacylase; K01437 aspartoacylase [EC:] (A) MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLEN…")
(25 intermediate revisions by the same user not shown)
Line 10: Line 10:
=GO term enrichment=
<source lang="java">
for(int i = 0; i< seq_id.length; i++ ){
// URL for annotations from QuickGO for one protein
URL u=new URL("http://www.ebi.ac.uk/QuickGO/GAnnotation?protein="+seq_id[i]+"&format=tsv");
// Connect
HttpURLConnection urlConnection = (HttpURLConnection) u.openConnection();
// Get data
BufferedReader rd=new BufferedReader(new InputStreamReader(urlConnection.getInputStream()));
List<String> columns=Arrays.asList(rd.readLine().split("\t"));
int idIndex=columns.indexOf("GO ID");
int nameIndex=columns.indexOf("GO Name");
String line;
if(rd.ready()) count_go_prots++;
Set<String> names = new HashSet<String>();
while ((line=rd.readLine())!=null) {
// Split them into fields
String[] fields=line.split("\t");
if(this.go_ids.containsKey(fields[idIndex])) {
int count = Integer.parseInt(this.go_ids.get(fields[idIndex])[1]);
this.go_ids.put(fields[idIndex], new String[]{fields[nameIndex], String.valueOf(count+1)});
this.go_ids.put(fields[idIndex], new String[]{fields[nameIndex],"1"});
// close input when finished
We ran BlastP on student machines with the big_80 as a reference database.
<source lang="bash">
blastall -p blastp -d /mnt/project/pracstrucfunc12/data/big/big_80 -i P45381_wt.fasta -o blastp_p45381_wt_big80.out
<b>default E-Value 10 - GO Term Enrichment (hit more than once)</b>
#hits GO term
185 metabolic process
184 hydrolase activity, acting on ester bonds
133 hydrolase activity
125 metal ion binding
88 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
60 aspartoacylase activity
44 zinc ion binding
24 arginine metabolic process
24 arginine catabolic process to glutamate
23 succinylglutamate desuccinylase activity
8 cytoplasm
5 arginine catabolic process to succinate
4 apical plasma membrane
4 aminoacylase activity
4 membrane
3 plasma membrane
3 identical protein binding
2 nucleus
2 intracellular
2 exonuclease activity
2 nucleotide binding
2 nucleic acid binding
2 oxidoreductase activity
2 oxidation-reduction process
<b>E-Value 10e-10 - GO Term Enrichment (hit more than once)</b>
#hits GO term
94 hydrolase activity, acting on ester bonds
94 metabolic process
88 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
66 hydrolase activity
62 metal ion binding
58 aspartoacylase activity
19 zinc ion binding
8 cytoplasm
4 apical plasma membrane
4 aminoacylase activity
3 plasma membrane
3 identical protein binding
3 membrane
2 nucleus
PSIBlast was used in the same fashion as BLAST, with the big_80 as the background database.
<b>2 iterations and default E-Value 0.002</b>
<source lang="bash"> time blastpgp -d /mnt/project/pracstrucfunc12/data/big/big_80 -i p45381_wt.fa -o psiblast_it2_h0002_1000.out -j 2 -h 0.002 -v 1000 -b 1000</source>
<b> GO Term Enrichment (all terms represented more than once)</b>
#hits GO terms
564 hydrolase activity, acting on ester bonds
564 metabolic process
443 hydrolase activity
433 metal ion binding
160 zinc ion binding
114 arginine metabolic process
114 arginine catabolic process to glutamate
113 succinylglutamate desuccinylase activity
88 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
60 aspartoacylase activity
28 proteolysis
27 metallocarboxypeptidase activity
21 arginine catabolic process to succinate
12 carboxypeptidase activity
8 cytoplasm
4 apical plasma membrane
4 aminoacylase activity
3 plasma membrane
3 identical protein binding
3 membrane
2 nucleus
2 arginine catabolic process
2 transferase activity
<b>2 iterations, more strict E-value cutoff of 10E-10 </b>
<source lang="bash"> time blastpgp -d /mnt/project/pracstrucfunc12/data/big/big_80 -i P45381_wt.fasta -o psiblast_it2_h10e-10_1000.out -j 2 -h 10e-10 -v 1000 -b 1000</source>
<b>GO Term Enrichment (all terms represented more than once)</b>
#hits GO term
480 hydrolase activity, acting on ester bonds
480 metabolic process
374 hydrolase activity
363 metal ion binding
148 zinc ion binding
108 arginine metabolic process
108 arginine catabolic process to glutamate
107 succinylglutamate desuccinylase activity
88 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
60 aspartoacylase activity
22 proteolysis
21 metallocarboxypeptidase activity
19 arginine catabolic process to succinate
9 carboxypeptidase activity
8 cytoplasm
4 apical plasma membrane
4 aminoacylase activity
3 plasma membrane
3 identical protein binding
3 membrane
2 nucleus
2 transferase activity
<b>10 iterations, default Evalue 0.002 </b>
<source lang="bash"> blastpgp -d /mnt/project/pracstrucfunc12/data/big/big_80 -i P45381_wt.fasta -o psiblast_it10_p45381_wt_big80.out -j 10 </source>
<b>GO Term Enrichment (all terms represented more than once)</b>
#hits GO term
2352 zinc ion binding
2217 proteolysis
2214 metallocarboxypeptidase activity
1438 carboxypeptidase activity
953 metabolic process
940 hydrolase activity, acting on ester bonds
885 hydrolase activity
783 metal ion binding
118 arginine catabolic process to glutamate
118 arginine metabolic process
116 succinylglutamate desuccinylase activity
88 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
85 peptidase activity
60 aspartoacylase activity
55 metallopeptidase activity
33 cell wall macromolecule catabolic process
32 cytoplasm
28 cell adhesion
23 cytosol
22 membrane
22 arginine catabolic process to succinate
20 nucleus
18 cellular_component
17 cellular cell wall organization
16 vacuole
16 tubulin binding
15 extracellular region
13 serine-type carboxypeptidase activity
11 extracellular space
9 protein side chain deglutamylation
9 C-terminal protein deglutamylation
9 plasma membrane
8 protein deglutamylation
8 biological_process
8 transferase activity
7 protein branching point deglutamylation
7 molecular_function
6 cell wall
6 catalytic activity
6 integral to membrane
6 regulation of transcription, DNA-dependent
5 mitochondrion organization
5 mitochondrion
5 ATP binding
4 transcription corepressor activity
4 regulation of root meristem growth
4 aminoacylase activity
4 apical plasma membrane
3 methylation
3 cerebellar Purkinje cell differentiation
3 carbohydrate binding
3 eye photoreceptor cell differentiation
3 methyltransferase activity
3 identical protein binding
3 neuromuscular process
3 olfactory bulb development
3 DNA binding
3 pathogenesis
2 protein binding
2 sequence-specific DNA binding transcription factor activity
2 flagellum
2 intracellular
2 transferase activity, transferring phosphorus-containing groups
2 carbohydrate metabolic process
2 transferase activity, transferring glycosyl groups
2 calcium ion binding
2 regulation of angiotensin levels in blood
2 fungal-type vacuole
2 proteinaceous extracellular matrix
2 cytoplasmic vesicle
2 protein kinase activity
2 response to chemical stimulus
2 inorganic diphosphatase activity
2 oxidation-reduction process
2 purine-nucleoside phosphorylase activity
2 fungal-type cell wall organization
2 arginine catabolic process
2 secretory granule
2 extracellular matrix
2 protein phosphorylation
2 polysaccharide catabolic process
<b>10 iterations, E-value cutoff 10E-10 </b>
<source lang="bash"> blastpgp -d /mnt/project/pracstrucfunc12/data/big/big_80 -i P45381_wt.fasta -o psiblast_it10_h10e10_p45381_wt_big80.out -j 10 -h 10e-10 </source>
<b>GO Term Enrichment (all terms represented more than once)</b>
#hits GO term
965 metabolic process
964 hydrolase activity, acting on ester bonds
790 hydrolase activity
754 metal ion binding
639 zinc ion binding
504 proteolysis
502 metallocarboxypeptidase activity
337 carboxypeptidase activity
118 arginine metabolic process
118 arginine catabolic process to glutamate
116 succinylglutamate desuccinylase activity
88 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
60 aspartoacylase activity
22 arginine catabolic process to succinate
11 peptidase activity
11 cytoplasm
7 nucleus
7 membrane
6 plasma membrane
6 metallopeptidase activity
5 serine-type carboxypeptidase activity
5 biological_process
4 transferase activity
4 regulation of root meristem growth
4 cell wall macromolecule catabolic process
4 apical plasma membrane
4 aminoacylase activity
3 vacuole
3 molecular_function
3 methyltransferase activity
3 methylation
3 integral to membrane
3 identical protein binding
3 cellular_component
3 cellular cell wall organization
2 transferase activity, transferring glycosyl groups
2 purine-nucleoside phosphorylase activity
2 polysaccharide catabolic process
2 fungal-type vacuole
2 fungal-type cell wall organization
2 catalytic activity
2 arginine catabolic process
Run HHBlits on student machines with Uniprot20 database.
*<b> 2 iterations </b>
<source lang="bash"> time hhblits -i p45381_wt.fa -d /mnt/project/pracstrucfunc12/data/hhblits/uniprot20_current -o hhblits_p45381_2it_0.002.out -e 0.002 -z 1000 -v 1000 </source>
*<b> 2 iterations, -e 10e-10 </b>
<source lang="bash"> hhblits -i P45381_wt.fasta -d /mnt/project/pracstrucfunc12/data/hhblits/uniprot20_current -e 10e-10 -o hhblits_p45381_def.out </source>
*<b> 8 iterations, -e 10e-10 </b>
<source lang="bash"> hhblits -i P45381_wt.fasta -d /mnt/project/pracstrucfunc12/data/hhblits/uniprot20_current -n 8 -e 10e-10 -z 1000 -v 1000 -o hhblits_p45381_n10.out </source>
*<b> 8 iterations </b>
<source lang="bash"> hhblits -i P45381_wt.fasta -d /mnt/project/pracstrucfunc12/data/hhblits/uniprot20_current -n 8 -z 1000 -v 1000-o hhblits_p45381_n10.out </source>

Latest revision as of 17:52, 31 August 2012


The native ASPA sequence (UniProt: P45381):

>hsa:443 ASPA, ACY2, ASP; aspartoacylase; K01437 aspartoacylase [EC:] (A)

GO term enrichment

<source lang="java">

for(int i = 0; i< seq_id.length; i++ ){

   // URL for annotations from QuickGO for one protein
   URL u=new URL("http://www.ebi.ac.uk/QuickGO/GAnnotation?protein="+seq_id[i]+"&format=tsv");
   // Connect
   HttpURLConnection urlConnection = (HttpURLConnection) u.openConnection();
   // Get data
   BufferedReader rd=new BufferedReader(new InputStreamReader(urlConnection.getInputStream())); 
   List<String> columns=Arrays.asList(rd.readLine().split("\t"));
   int idIndex=columns.indexOf("GO ID");
   int nameIndex=columns.indexOf("GO Name");
   String line;
   if(rd.ready()) count_go_prots++;
   Set<String> names = new HashSet<String>();
   while ((line=rd.readLine())!=null) {

// Split them into fields String[] fields=line.split("\t"); if(!names.contains(fields[nameIndex])){ names.add(fields[nameIndex]); if(this.go_ids.containsKey(fields[idIndex])) { int count = Integer.parseInt(this.go_ids.get(fields[idIndex])[1]); this.go_ids.put(fields[idIndex], new String[]{fields[nameIndex], String.valueOf(count+1)}); } else{ this.go_ids.put(fields[idIndex], new String[]{fields[nameIndex],"1"}); }

   // close input when finished

} </source>


We ran BlastP on student machines with the big_80 as a reference database.

<source lang="bash"> blastall -p blastp -d /mnt/project/pracstrucfunc12/data/big/big_80 -i P45381_wt.fasta -o blastp_p45381_wt_big80.out </source>

default E-Value 10 - GO Term Enrichment (hit more than once)

#hits   GO term
185	 metabolic process
184	 hydrolase activity, acting on ester bonds
133	 hydrolase activity
125	 metal ion binding
88	 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
60	 aspartoacylase activity
44	 zinc ion binding
24	 arginine metabolic process
24	 arginine catabolic process to glutamate
23	 succinylglutamate desuccinylase activity
8	 cytoplasm
5	 arginine catabolic process to succinate
4	 apical plasma membrane
4	 aminoacylase activity
4	 membrane
3	 plasma membrane
3	 identical protein binding
2	 nucleus
2	 intracellular
2	 exonuclease activity
2	 nucleotide binding
2	 nucleic acid binding
2	 oxidoreductase activity
2	 oxidation-reduction process

E-Value 10e-10 - GO Term Enrichment (hit more than once)

#hits   GO term
94	 hydrolase activity, acting on ester bonds
94	 metabolic process
88	 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
66	 hydrolase activity
62	 metal ion binding
58	 aspartoacylase activity
19	 zinc ion binding
8	 cytoplasm
4	 apical plasma membrane
4	 aminoacylase activity
3	 plasma membrane
3	 identical protein binding
3	 membrane
2	 nucleus


PSIBlast was used in the same fashion as BLAST, with the big_80 as the background database.

2 iterations and default E-Value 0.002 <source lang="bash"> time blastpgp -d /mnt/project/pracstrucfunc12/data/big/big_80 -i p45381_wt.fa -o psiblast_it2_h0002_1000.out -j 2 -h 0.002 -v 1000 -b 1000</source>

GO Term Enrichment (all terms represented more than once)

#hits GO terms
564	 hydrolase activity, acting on ester bonds
564	 metabolic process
443	 hydrolase activity
433	 metal ion binding
160	 zinc ion binding
114	 arginine metabolic process
114	 arginine catabolic process to glutamate
113	 succinylglutamate desuccinylase activity
88	 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
60	 aspartoacylase activity
28	 proteolysis
27	 metallocarboxypeptidase activity
21	 arginine catabolic process to succinate
12	 carboxypeptidase activity
8	 cytoplasm
4	 apical plasma membrane
4	 aminoacylase activity
3	 plasma membrane
3	 identical protein binding
3	 membrane
2	 nucleus
2	 arginine catabolic process
2	 transferase activity

2 iterations, more strict E-value cutoff of 10E-10 <source lang="bash"> time blastpgp -d /mnt/project/pracstrucfunc12/data/big/big_80 -i P45381_wt.fasta -o psiblast_it2_h10e-10_1000.out -j 2 -h 10e-10 -v 1000 -b 1000</source>

GO Term Enrichment (all terms represented more than once)

#hits  GO term
480	 hydrolase activity, acting on ester bonds
480	 metabolic process
374	 hydrolase activity
363	 metal ion binding
148	 zinc ion binding
108	 arginine metabolic process
108	 arginine catabolic process to glutamate
107	 succinylglutamate desuccinylase activity
88	 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
60	 aspartoacylase activity
22	 proteolysis
21	 metallocarboxypeptidase activity
19	 arginine catabolic process to succinate
9	 carboxypeptidase activity
8	 cytoplasm
4	 apical plasma membrane
4	 aminoacylase activity
3	 plasma membrane
3	 identical protein binding
3	 membrane
2	 nucleus
2	 transferase activity

10 iterations, default Evalue 0.002 <source lang="bash"> blastpgp -d /mnt/project/pracstrucfunc12/data/big/big_80 -i P45381_wt.fasta -o psiblast_it10_p45381_wt_big80.out -j 10 </source>

GO Term Enrichment (all terms represented more than once)

#hits   GO term
2352	 zinc ion binding
2217	 proteolysis
2214	 metallocarboxypeptidase activity
1438	 carboxypeptidase activity
953	 metabolic process
940	 hydrolase activity, acting on ester bonds
885	 hydrolase activity
783	 metal ion binding
118	 arginine catabolic process to glutamate
118	 arginine metabolic process
116	 succinylglutamate desuccinylase activity
88	 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
85	 peptidase activity
60	 aspartoacylase activity
55	 metallopeptidase activity
33	 cell wall macromolecule catabolic process
32	 cytoplasm
28	 cell adhesion
23	 cytosol
22	 membrane
22	 arginine catabolic process to succinate
20	 nucleus
18	 cellular_component
17	 cellular cell wall organization
16	 vacuole
16	 tubulin binding
15	 extracellular region
13	 serine-type carboxypeptidase activity
11	 extracellular space
9	 protein side chain deglutamylation
9	 C-terminal protein deglutamylation
9	 plasma membrane
8	 protein deglutamylation
8	 biological_process
8	 transferase activity
7	 protein branching point deglutamylation
7	 molecular_function
6	 cell wall
6	 catalytic activity
6	 integral to membrane
6	 regulation of transcription, DNA-dependent
5	 mitochondrion organization
5	 mitochondrion
5	 ATP binding
4	 transcription corepressor activity
4	 regulation of root meristem growth
4	 aminoacylase activity
4	 apical plasma membrane
3	 methylation
3	 cerebellar Purkinje cell differentiation
3	 carbohydrate binding
3	 eye photoreceptor cell differentiation
3	 methyltransferase activity
3	 identical protein binding
3	 neuromuscular process
3	 olfactory bulb development
3	 DNA binding
3	 pathogenesis
2	 protein binding
2	 sequence-specific DNA binding transcription factor activity
2	 flagellum
2	 intracellular
2	 transferase activity, transferring phosphorus-containing groups
2	 carbohydrate metabolic process
2	 transferase activity, transferring glycosyl groups
2	 calcium ion binding
2	 regulation of angiotensin levels in blood
2	 fungal-type vacuole
2	 proteinaceous extracellular matrix
2	 cytoplasmic vesicle
2	 protein kinase activity
2	 response to chemical stimulus
2	 inorganic diphosphatase activity
2	 oxidation-reduction process
2	 purine-nucleoside phosphorylase activity
2	 fungal-type cell wall organization
2	 arginine catabolic process
2	 secretory granule
2	 extracellular matrix
2	 protein phosphorylation
2	 polysaccharide catabolic process

10 iterations, E-value cutoff 10E-10 <source lang="bash"> blastpgp -d /mnt/project/pracstrucfunc12/data/big/big_80 -i P45381_wt.fasta -o psiblast_it10_h10e10_p45381_wt_big80.out -j 10 -h 10e-10 </source>

GO Term Enrichment (all terms represented more than once)

#hits   GO term
965	 metabolic process 
964	 hydrolase activity, acting on ester bonds 
790	 hydrolase activity 
754	 metal ion binding 
639	 zinc ion binding 
504	 proteolysis 
502	 metallocarboxypeptidase activity 
337	 carboxypeptidase activity 
118	 arginine metabolic process 
118	 arginine catabolic process to glutamate 
116	 succinylglutamate desuccinylase activity 
88	 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides 
60	 aspartoacylase activity 
22	 arginine catabolic process to succinate 
11	 peptidase activity 
11	 cytoplasm 
7	 nucleus 
7	 membrane 
6	 plasma membrane 
6	 metallopeptidase activity 
5	 serine-type carboxypeptidase activity 
5	 biological_process 
4	 transferase activity 
4	 regulation of root meristem growth 
4	 cell wall macromolecule catabolic process 
4	 apical plasma membrane 
4	 aminoacylase activity 
3	 vacuole 
3	 molecular_function 
3	 methyltransferase activity 
3	 methylation 
3	 integral to membrane 
3	 identical protein binding 
3	 cellular_component 
3	 cellular cell wall organization 
2	 transferase activity, transferring glycosyl groups 
2	 purine-nucleoside phosphorylase activity 
2	 polysaccharide catabolic process 
2	 fungal-type vacuole 
2	 fungal-type cell wall organization 
2	 catalytic activity 
2	 arginine catabolic process


Run HHBlits on student machines with Uniprot20 database.

  • 2 iterations
 <source lang="bash"> time hhblits -i p45381_wt.fa -d /mnt/project/pracstrucfunc12/data/hhblits/uniprot20_current -o hhblits_p45381_2it_0.002.out -e 0.002 -z 1000 -v 1000 </source>

  • 2 iterations, -e 10e-10
 <source lang="bash">  hhblits -i P45381_wt.fasta -d /mnt/project/pracstrucfunc12/data/hhblits/uniprot20_current -e 10e-10 -o hhblits_p45381_def.out </source>
  • 8 iterations, -e 10e-10

<source lang="bash"> hhblits -i P45381_wt.fasta -d /mnt/project/pracstrucfunc12/data/hhblits/uniprot20_current -n 8 -e 10e-10 -z 1000 -v 1000 -o hhblits_p45381_n10.out </source>

  • 8 iterations

<source lang="bash"> hhblits -i P45381_wt.fasta -d /mnt/project/pracstrucfunc12/data/hhblits/uniprot20_current -n 8 -z 1000 -v 1000-o hhblits_p45381_n10.out </source>