Sequence-based predictions

From Bioinformatikpedia
Revision as of 19:10, 10 June 2011 by Landerer (talk | contribs) (META-Disorder)

Secondary structure prediction

PSIPRED

Secondary Structure predicted by PSIPRED

PSI-PRED use the PSI-BLAST output as input for a neuronal network which has a single hidden layer and a feed-forward back-propagation architecture to predict the secondary structure. PSI-PRED predicts a alpha/beta structure. The transmembrane region is predicted as a beta region.

PSIPRED HFORMAT (PSIPRED V3.0)
Conf: 999851589999999877513567886245556456636899750389988756755687
Pred: CCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEEEEEEEECCCCCCCEEEEEEEECCEEEEE
  AA: MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVF
             10        20        30        40        50        60
Conf: 318998225536664688990669998865311211002358577441156788603899
Pred: ECCCCCCEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCCCCEEEE
  AA: YDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQV
             70        80        90       100       110       120
Conf: 987799319835459889765910588728988756689786135787788899999876
Pred: EEEEEEECCCEEEEEEEEEECCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
  AA: ILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNR
            130       140       150       160       170       180
Conf: 310271499889888616322000378810000468999601699981450765189996
Pred: HHHCCCHHHHHHHHHHCCCCCCCCCCCCCEEEECCCCCCCEEEEEEEEEECCCCEEEEEE
  AA: AYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWL
            190       200       210       220       230       240
Conf: 288106667520025355899875899999965999872169986699998826885259
Pred: ECCEECCCCCCCCCCCEECCCCCEEEEEEEEECCCCCCCEEEEEECCCCCCCEEEEEECC
  AA: KDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPS
            250       260       270       280       290       300
Conf: 999711124320001367777622367764115889887620212359
Pred: CCCCCEEEEEEEEEEEEEEEEEEEEEEEEEECCCCCCCCCCEEECCCC
  AA: PSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE
            310       320       330       340

Jpred3

Jpred uses the Jnet algorithm which provides "a three-state (a-helix, ß-strand and coil) prediction of secondary structure at an accuracy of 81.5%" <ref>http://nar.oxfordjournals.org/content/36/suppl_2/W197.abstract</ref>.

Jpred found in it's first blast search a lot of homologous hits with an e-value range from e-163 to 4e-44. There are some self hits included. We continued to the prediction which is:

Seq: MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDD
 SS: ------HHHHHHHHHHHHH---------EEEEEEEEE-------EEEEEEEEE--

Seq: QLFVFYDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHN
 SS: EEEEEE-----EEEE----------HHHHHHHHHHHHHHHHHHHHHHHHHH----

Seq: HSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPT
 SS: -----EEEEEEEEEE------EEEEEEE-----EEEEEE----EEE-------HH

Seq: KLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSV
 SS: HHHHH--HHHHHHHHHH------HHHHHHHHHH-H-------EEEEE--------

Seq: TTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPG
 SS: -EEEEEEE------EEEEEEE----------EE----------EEEEEEEEE---

Seq: EEQRYTCQVEHPGLDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIILR
 SS: ---EEEEEEEE------EEEEE---------HHHHHHHHHHHHHHHHHHHHHHHH
Seq: KRQGSRGAMGHYVLAERE
 SS: HH----------------

Comparison with DSSP

Because, the PDB sequence is not complete, the dssp assignment is also incomplete. The interessting parts - the signal peptide and the cytoplasmic part - which are predicted as disordered are not covered by DSSP. PSIPRED and JPred predicted the transmembrane region well and also made no assignment to the - as disordered predicted - N- and C-terminus.

UniProt: ---------------------------EEEEEEEEEEE----EEE--EEEEEE--EEEEE
   DSSP:                          --EEEEEEEEEEB-SS-SSB--EEEEEETTEEEEE
PSIPRED: CCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEEEEEEEECCCCCCCEEEEEEEECCEEEEE
  JPred: ------HHHHHHHHHHHHH---------EEEEEEEEE-------EEEEEEEEE--EEEEE
     AA: MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVF
DSSPSeq:                          RSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVF
                10        20        30        40        50        60
UniProt: EEEEE--EEE--------TTTHHHHHHHHHHHHHHHHHHHHHHHHHHTTT-EEE--EEEE
   DSSP: EESSS--EEE-STTS-SSTTTTHHHHHHHHHHHHHHHHHHHHHHHHHTTT-SSS--EEEE
PSIPRED: ECCCCCCEEECCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCCCCEEEE
  JPred: E-----EEEE----------HHHHHHHHHHHHHHHHHHHHHHHHHH---------EEEEE
     AA: YDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQV
DSSPSEQ: YDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQV
                70        80        90       100       110       120
UniProt: EEEEEE-----EEEEEEEEE--EEEEEEEHHH-EEEEEE---HHHHHHHH---HHHHHHH
   DSSP: EEEEEE-TTS-EEEEEEEEETTEEEEEEEGGGTEEEESSGGGHHHHHHHHSSTHHHHHHH
PSIPRED: EEEEEEECCCEEEEEEEEEECCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
  JPred: EEEEE------EEEEEEE-----EEEEEE----EEE-------HHHHHHH--HHHHHHHH
     AA: ILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNR
DSSPSEQ: ILGaEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNR
               130       140       150       160       170       180
UniProt: HHHH-HHHHHHHHHHHHHTTT-------EEEEEEEE----EEEEEEEEEEEEE--EEEEE
   DSSP: HHHHTHHHHHHHHHHHHHTTTSS--B--EEEEEEEE-SS-EEEEEEEEEEBSS--EEEEE
PSIPRED: HHHCCCHHHHHHHHHHCCCCCCCCCCCCCEEEECCCCCCCEEEEEEEEEECCCCEEEEEE
  JPred: HH------HHHHHHHHHH-H-------EEEEE---------EEEEEEE------EEEEEE
     AA: AYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWL
DSSPSEQ: AYLERDaPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRbRALNYYPQNITMKWL
               190       200       210       220       230       240
UniProt: E------HHH----EEEE-----EEEEEEEEE---HHHHEEEEEE---EEE-EEEE----
   DSSP: ETTEE--GGGS---EEEE-TTS-EEEEEEEEE-TTGGGGEEEEEE-TTSSS-EEEE-
PSIPRED: ECCEECCCCCCCCCCCEECCCCCEEEEEEEEECCCCCCCEEEEEECCCCCCCEEEEEECC
  JPred: E----------EE----------EEEEEEEEE------EEEEEEEE------EEEEE---
     AA: KDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPS
DSSPSEQ: KDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTbQVEHPGLDQPLIVIW
               250       260       270       280       290       300
UniProt: ------------------------------------------------
   DSSP:
PSIPRED: CCCCCEEEEEEEEEEEEEEEEEEEEEEEEEECCCCCCCCCCEEECCCC
  JPred: ------HHHHHHHHHHHHHHHHHHHHHHHHHH----------------
     AA: PSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE
DSSPSEQ: 
               310       320       330       340

Prediction of disordered regions

DISOPRED

DISOPRED prediction profile for the HFE protein

For the prediction, we used the DISOPRED-Server at http://bioinf.cs.ucl.ac.uk/disopred/
Disopred predictes two disordered residues at the signal peptide and a disordered region at the end of the sequence which is located inside the cell.

AA:Target sequence
Pred:Residue disorder prediction(.)= ordered residue(*)=Disordered residue
conf:997600000000000000000000000000000000000000000000000000000000
pred:**..........................................................
  AA:MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVF
             10        20	  30 	    40	      50	60
conf:000120011000000000000000000000000000000000000000000000000000
pred:............................................................
  AA:YDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQV
             70        80	  90	   100	     110       120
conf:000000000000000000000000000000000000000000000000000000000000
pred:............................................................
  AA:ILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNR
            130       140       150       160       170       180
conf:000000000000000000000002456777878777766530000000000000000000
pred:..............................*.*...........................
  AA:AYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWL
            190       200       210       220       230       240
conf:000035555545543000000000000000000000000000000000000001354667
pred:............................................................
  AA:KDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPS
            250       260       270       280       290       300
conf:777766643300000000000000047889999999999999898999
pred:...........................*********************
  AA:PSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE
            310       320       330       340
DISOPRED predictions for a false positive rate threshold of: 2%

POODLE

POODLE stands for Prediction Of Order and Disorder by machine LEarning.

POODLE provides three different predictions

  • POODLE-S: short disorder regions prediction
  • POODLE-L: long disorder regions prediction (longer 40 residues)
  • unfolded protein prediction


All POODLE variants predict a disordered region at the end of the protein which contains a transmembrane region (pos: 307-330), this shows an evidance for a disordered region at the C-Terminus. But also, all variants predict a short disordered region at the beginning of the sequence which is a part of the signal peptid (pos: 1-22).

POODLE-I

POODLE-I (series only) predicted 4 disordered regions within the protein sequence.

Distribution of disordered region over the AS-Sequence predicted by POODLE-I
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVF
**************----------------------------------------------
YDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQV
-------**********---******------*---------------------------
ILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNR
------------------------------------------------------------
AYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWL
---------------------***************------------------------
KDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPS
----*********----------------------------------------*******
PSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE
************************************************

POODLE-S

POODLE-S (using missing residues) predicts 6 short disordered regions within the protein sequence.

Distribution of disordered region over the AS-Sequence predicted by POODLE-S(Missing residues)
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVF
-**************---------------------------------------------
YDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQV
-------**********---******----------------------------------
ILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNR
------------------------------------------------------------
AYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWL
---------------------***************------------------------
KDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPS
----*********----------------------------------------*******
PSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE
*--------------------------------********-------

POODLE-S (using High B-Factor residues) predicts 2 short disordered regions within the protein sequence.

Distribution of disordered region over the AS-Sequence predicted by POODLE-S(High B-Factor residues)
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVF
-*-***------------------------------------------------------
YDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQV
------------------------------------------------------------
ILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNR
------------------------------------------------******------
AYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWL
------------------------------------------------------------
KDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPS
------------------------------------------------------------
PSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE
------------------------------------------------

POODLE-L

POODLE-L predicts a disordered region from 296 to the end.

Distribution of disordered region over the AS-Sequence predicted by POODLE-L
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVF 
------------------------------------------------------------
YDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQV 
------------------------------------------------------------
ILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNR 
------------------------------------------------------------
AYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWL 
------------------------------------------------------------
KDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPS 
------------------------------------------------------******
PSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE
************************************************

IUPRED

The short term prediction predicts 5 short regions. There are also disordered residues at the beginning and in the signal peptide.

IUPRED prediction of short regions
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVF 
***---------------------------------------------------------
YDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQV 
------------------------------------------------------------
ILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNR 
------------------------------------------------------------
AYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWL 
------------------------------------------------------------
KDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPS 
---------********----------***--------*-****----------------
PSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE
---------------------------------------------***


The long term prediction predicted 7 disordered residues, but just one short region.

IUPRED prediction of long regions
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVF 
------------------------------------------------------------
YDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQV 
------------------------------------------------------------
ILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNR 
------------------------------------------------------------
AYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWL 
------------------------------------------------------------
KDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPS 
---------******-------------------------*-------------------
PSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE
------------------------------------------------
IUPRED prediction of structured regions



The prediction of sturcured regions predicts one globular domain from 1-348. This means, that the whole protein is structured. This is a contradiction to the prediction of POODLE, but because of the weak evidence given by the other IUPRED-methods not a real contradiction to the other results of IUPRED.

META-Disorder

For this task, we used the Server at https://www.predictprotein.org.

predicted secondary structure composision

sec str type H E L
% in protein 27.30 28.74 43.97

Prediction of disordered residiues

Number Residue NORSnet NORS2st PROFbval bval2st Ucon Ucon2st MD_raw   MD_rel  MD2st 
   1	M	0.18	-	0.99	D	0.37	-	0.515	0	-
   2	G	0.12	-	0.80	D	0.33	-	0.485	1	-
   3	P	0.05	-	0.69	D	0.20	-	0.414	3	-
   4	R	0.07	-	0.65	D	0.15	-	0.374	4	-
   5	A	0.05	-	0.33	-	0.14	-	0.323	6	-
   6	R	0.05	-	0.30	-	0.13	-	0.283	7	-
   7	P	0.11	-	0.26	-	0.13	-	0.270	8	-
   8	A	0.12	-	0.23	-	0.14	-	0.253	8	-
   9	L	0.10	-	0.18	-	0.18	-	0.253	8	-
  10	L	0.11	-	0.16	-	0.16	-	0.263	8	-
  11	L	0.09	-	0.15	-	0.16	-	0.273	8	-
  12	L	0.08	-	0.15	-	0.17	-	0.283	7	-
  13	M	0.07	-	0.16	-	0.20	-	0.293	7	-
  14	L	0.06	-	0.17	-	0.20	-	0.270	8	-
  15	L	0.06	-	0.20	-	0.15	-	0.273	8	-
  16	Q	0.06	-	0.23	-	0.13	-	0.253	8	-
  17	T	0.06	-	0.28	-	0.13	-	0.253	8	-
  18	A	0.08	-	0.34	-	0.13	-	0.253	8	-
  19	V	0.10	-	0.28	-	0.13	-	0.250	9	-
  20	L	0.12	-	0.33	-	0.15	-	0.242	9	-
  21	Q	0.11	-	0.30	-	0.14	-	0.242	9	-
  22	G	0.13	-	0.42	-	0.14	-	0.242	9	-
  23	R	0.15	-	0.39	-	0.15	-	0.242	9	-
  24	L	0.15	-	0.41	-	0.14	-	0.242	9	-
  25	L	0.12	-	0.41	-	0.16	-	0.242	9	-
  26	R	0.12	-	0.42	-	0.13	-	0.242	9	-
  27	S	0.12	-	0.43	-	0.13	-	0.242	9	-
  28	H	0.12	-	0.33	-	0.14	-	0.232	9	-
  29	S	0.09	-	0.39	-	0.13	-	0.232	9	-
  30	L	0.13	-	0.29	-	0.13	-	0.240	9	-
  31	H	0.14	-	0.27	-	0.13	-	0.240	9	-
  32	Y	0.19	-	0.17	-	0.13	-	0.232	9	-
  33	L	0.21	-	0.16	-	0.13	-	0.240	9	-
  34	F	0.14	-	0.20	-	0.13	-	0.240	9	-
  35	M	0.13	-	0.20	-	0.16	-	0.242	9	-
  36	G	0.12	-	0.23	-	0.14	-	0.250	9	-
  37	A	0.10	-	0.39	-	0.16	-	0.242	9	-
  38	S	0.12	-	0.46	-	0.16	-	0.253	8	-
  39	E	0.21	-	0.44	-	0.23	-	0.260	8	-
  40	Q	0.22	-	0.56	D	0.21	-	0.263	8	-
  41	D	0.24	-	0.55	D	0.16	-	0.263	8	-
  42	L	0.18	-	0.58	D	0.19	-	0.253	8	-
  43	G	0.15	-	0.57	D	0.18	-	0.263	8	-
  44	L	0.13	-	0.51	D	0.13	-	0.242	9	-
  45	S	0.12	-	0.42	-	0.13	-	0.242	9	-
  46	L	0.13	-	0.47	D	0.13	-	0.240	9	-
  47	F	0.16	-	0.39	-	0.13	-	0.240	9	-
  48	E	0.14	-	0.28	-	0.13	-	0.232	9	-
  49	A	0.10	-	0.23	-	0.15	-	0.242	9	-
  50	L	0.09	-	0.21	-	0.15	-	0.242	9	-
  51	G	0.11	-	0.24	-	0.15	-	0.253	8	-
  52	Y	0.08	-	0.28	-	0.15	-	0.253	8	-
  53	V	0.06	-	0.45	-	0.13	-	0.242	9	-
  54	D	0.05	-	0.47	D	0.13	-	0.263	8	-
  55	D	0.06	-	0.43	-	0.13	-	0.253	8	-
  56	Q	0.07	-	0.49	D	0.13	-	0.250	9	-
  57	L	0.06	-	0.43	-	0.14	-	0.242	9	-
  58	F	0.11	-	0.29	-	0.17	-	0.242	9	-
  59	V	0.15	-	0.28	-	0.16	-	0.242	9	-
  60	F	0.19	-	0.30	-	0.15	-	0.242	9	-
  61	Y	0.29	-	0.28	-	0.14	-	0.242	9	-
  62	D	0.29	-	0.41	-	0.15	-	0.253	8	-
  63	H	0.23	-	0.55	D	0.23	-	0.263	8	-
  64	E	0.25	-	0.65	D	0.31	-	0.313	6	-
  65	S	0.25	-	0.68	D	0.47	-	0.313	6	-
  66	R	0.25	-	0.69	D	0.63	D	0.313	6	-
  67	R	0.25	-	0.66	D	0.57	-	0.283	7	-
  68	V	0.35	-	0.67	D	0.46	-	0.283	7	-
  69	E	0.46	-	0.64	D	0.31	-	0.283	7	-
  70	P	0.45	-	0.52	D	0.31	-	0.290	7	-
  71	R	0.41	-	0.47	D	0.32	-	0.293	7	-
  72	T	0.45	-	0.59	D	0.32	-	0.333	6	-
  73	P	0.45	-	0.60	D	0.31	-	0.323	6	-
  74	W	0.32	-	0.47	D	0.27	-	0.313	6	-
  75	V	0.29	-	0.55	D	0.27	-	0.323	6	-
  76	S	0.26	-	0.60	D	0.30	-	0.323	6	-
  77	S	0.23	-	0.71	D	0.23	-	0.354	5	-
  78	R	0.17	-	0.69	D	0.17	-	0.323	6	-
  79	I	0.18	-	0.76	D	0.17	-	0.313	6	-
  80	S	0.18	-	0.72	D	0.22	-	0.310	6	-
  81	S	0.19	-	0.69	D	0.17	-	0.293	7	-
  82	Q	0.24	-	0.68	D	0.17	-	0.283	7	-
  83	M	0.27	-	0.59	D	0.18	-	0.273	8	-
  84	W	0.22	-	0.54	D	0.24	-	0.263	8	-
  85	L	0.18	-	0.57	D	0.18	-	0.260	8	-
  86	Q	0.16	-	0.52	D	0.20	-	0.263	8	-
  87	L	0.13	-	0.50	D	0.18	-	0.253	8	-
  88	S	0.14	-	0.52	D	0.18	-	0.283	7	-
  89	Q	0.14	-	0.59	D	0.27	-	0.293	7	-
  90	S	0.16	-	0.56	D	0.33	-	0.303	7	-
  91	L	0.17	-	0.56	D	0.24	-	0.303	7	-
  92	K	0.14	-	0.55	D	0.23	-	0.293	7	-
  93	G	0.13	-	0.55	D	0.22	-	0.283	7	-
  94	W	0.11	-	0.52	D	0.17	-	0.283	7	-
  95	D	0.10	-	0.54	D	0.19	-	0.283	7	-
  96	H	0.09	-	0.54	D	0.19	-	0.280	7	-
  97	M	0.11	-	0.47	D	0.14	-	0.283	7	-
  98	F	0.12	-	0.44	-	0.14	-	0.283	7	-
  99	T	0.09	-	0.45	-	0.14	-	0.283	7	-
 100	V	0.10	-	0.47	D	0.13	-	0.283	7	-
 101	D	0.12	-	0.41	-	0.14	-	0.273	8	-
 102	F	0.11	-	0.40	-	0.15	-	0.293	7	-
 103	W	0.10	-	0.51	D	0.18	-	0.293	7	-
 104	T	0.13	-	0.46	-	0.18	-	0.293	7	-
 105	I	0.19	-	0.39	-	0.20	-	0.293	7	-
 106	M	0.17	-	0.47	D	0.18	-	0.303	7	-
 107	E	0.21	-	0.51	D	0.32	-	0.323	6	-
 108	N	0.18	-	0.47	D	0.52	-	0.360	5	-
 109	H	0.15	-	0.52	D	0.55	-	0.354	5	-
 110	N	0.15	-	0.56	D	0.63	D	0.323	6	-
 111	H	0.15	-	0.62	D	0.76	D	0.333	6	-
 112	S	0.16	-	0.66	D	0.54	-	0.313	6	-
 113	K	0.17	-	0.67	D	0.57	-	0.303	7	-
 114	E	0.15	-	0.53	D	0.55	-	0.303	7	-
 115	S	0.12	-	0.49	D	0.42	-	0.273	8	-
 116	H	0.14	-	0.34	-	0.36	-	0.263	8	-
 117	T	0.11	-	0.34	-	0.33	-	0.260	8	-
 118	L	0.10	-	0.26	-	0.20	-	0.253	8	-
 119	Q	0.09	-	0.28	-	0.20	-	0.253	8	-
 120	V	0.17	-	0.34	-	0.16	-	0.260	8	-
 121	I	0.20	-	0.33	-	0.19	-	0.263	8	-
 122	L	0.16	-	0.28	-	0.21	-	0.273	8	-
 123	G	0.15	-	0.34	-	0.32	-	0.283	7	-
 124	C	0.14	-	0.32	-	0.30	-	0.293	7	-
 125	E	0.16	-	0.47	D	0.38	-	0.313	6	-
 126	M	0.15	-	0.49	D	0.48	-	0.333	6	-
 127	Q	0.14	-	0.66	D	0.69	D	0.343	5	-
 128	E	0.14	-	0.73	D	0.69	D	0.343	5	-
 129	D	0.16	-	0.69	D	0.67	D	0.343	5	-
 130	N	0.16	-	0.66	D	0.44	-	0.323	6	-
 131	S	0.13	-	0.66	D	0.69	D	0.310	6	-
 132	T	0.13	-	0.59	D	0.49	-	0.283	7	-
 133	E	0.16	-	0.54	D	0.40	-	0.273	8	-
 134	G	0.25	-	0.42	-	0.25	-	0.280	7	-
 135	Y	0.21	-	0.36	-	0.28	-	0.263	8	-
 136	W	0.17	-	0.39	-	0.26	-	0.260	8	-
 137	K	0.14	-	0.36	-	0.28	-	0.273	8	-
 138	Y	0.12	-	0.35	-	0.27	-	0.283	7	-
 139	G	0.10	-	0.41	-	0.26	-	0.283	7	-
 140	Y	0.08	-	0.43	-	0.27	-	0.283	7	-
 141	D	0.09	-	0.61	D	0.43	-	0.290	7	-
 142	G	0.09	-	0.57	D	0.24	-	0.280	7	-
 143	Q	0.09	-	0.47	D	0.25	-	0.283	7	-
 144	D	0.09	-	0.53	D	0.28	-	0.280	7	-
 145	H	0.11	-	0.41	-	0.44	-	0.273	8	-
 146	L	0.12	-	0.35	-	0.38	-	0.263	8	-
 147	E	0.14	-	0.38	-	0.30	-	0.263	8	-
 148	F	0.12	-	0.39	-	0.32	-	0.260	8	-
 149	C	0.13	-	0.48	D	0.20	-	0.280	7	-
 150	P	0.11	-	0.67	D	0.23	-	0.293	7	-
 151	D	0.15	-	0.65	D	0.29	-	0.343	5	-
 152	T	0.18	-	0.64	D	0.24	-	0.364	5	-
 153	L	0.15	-	0.57	D	0.39	-	0.343	5	-
 154	D	0.11	-	0.55	D	0.55	-	0.340	5	-
 155	W	0.18	-	0.41	-	0.53	-	0.313	6	-
 156	R	0.20	-	0.41	-	0.45	-	0.300	7	-
 157	A	0.16	-	0.41	-	0.33	-	0.313	6	-
 158	A	0.18	-	0.49	D	0.48	-	0.333	6	-
 159	E	0.16	-	0.55	D	0.41	-	0.404	3	-
 160	P	0.14	-	0.56	D	0.70	D	0.424	3	-
 161	R	0.11	-	0.56	D	0.55	-	0.414	3	-
 162	A	0.14	-	0.51	D	0.65	D	0.374	4	-
 163	W	0.15	-	0.55	D	0.50	-	0.354	5	-
 164	P	0.24	-	0.57	D	0.50	-	0.354	5	-
 165	T	0.25	-	0.56	D	0.48	-	0.330	6	-
 166	K	0.23	-	0.61	D	0.43	-	0.343	5	-
 167	L	0.15	-	0.60	D	0.57	-	0.333	6	-
 168	E	0.13	-	0.59	D	0.59	D	0.333	6	-
 169	W	0.14	-	0.58	D	0.56	-	0.330	6	-
 170	E	0.10	-	0.69	D	0.55	-	0.333	6	-
 171	R	0.10	-	0.69	D	0.43	-	0.333	6	-
 172	H	0.10	-	0.62	D	0.60	D	0.354	5	-
 173	K	0.10	-	0.67	D	0.54	-	0.354	5	-
 174	I	0.09	-	0.60	D	0.70	D	0.354	5	-
 175	R	0.09	-	0.53	D	0.61	D	0.310	6	-
 176	A	0.11	-	0.52	D	0.45	-	0.293	7	-
 177	R	0.11	-	0.53	D	0.36	-	0.293	7	-
 178	Q	0.12	-	0.49	D	0.32	-	0.283	7	-
 179	N	0.12	-	0.47	D	0.44	-	0.293	7	-
 180	R	0.09	-	0.47	D	0.50	-	0.313	6	-
 181	A	0.10	-	0.45	-	0.39	-	0.300	7	-
 182	Y	0.10	-	0.45	-	0.41	-	0.293	7	-
 183	L	0.09	-	0.40	-	0.37	-	0.283	7	-
 184	E	0.06	-	0.49	D	0.40	-	0.303	7	-
 185	R	0.07	-	0.48	D	0.29	-	0.313	6	-
 186	D	0.07	-	0.46	-	0.33	-	0.313	6	-
 187	C	0.07	-	0.39	-	0.49	-	0.313	6	-
 188	P	0.08	-	0.45	-	0.49	-	0.323	6	-
 189	A	0.10	-	0.51	D	0.31	-	0.333	6	-
 190	Q	0.10	-	0.35	-	0.35	-	0.293	7	-
 191	L	0.10	-	0.34	-	0.23	-	0.293	7	-
 192	Q	0.10	-	0.53	D	0.29	-	0.333	6	-
 193	Q	0.12	-	0.47	D	0.28	-	0.323	6	-
 194	L	0.12	-	0.45	-	0.27	-	0.313	6	-
 195	L	0.12	-	0.55	D	0.21	-	0.323	6	-
 196	E	0.13	-	0.64	D	0.21	-	0.330	6	-
 197	L	0.16	-	0.58	D	0.23	-	0.343	5	-
 198	G	0.22	-	0.59	D	0.23	-	0.343	5	-
 199	R	0.24	-	0.62	D	0.33	-	0.354	5	-
 200	G	0.27	-	0.64	D	0.36	-	0.374	4	-
 201	V	0.33	-	0.61	D	0.33	-	0.354	5	-
 202	L	0.31	-	0.61	D	0.47	-	0.343	5	-
 203	D	0.32	-	0.68	D	0.37	-	0.343	5	-
 204	Q	0.41	-	0.69	D	0.29	-	0.384	4	-
 205	Q	0.39	-	0.70	D	0.40	-	0.404	3	-
 206	V	0.34	-	0.66	D	0.39	-	0.404	3	-
 207	P	0.29	-	0.64	D	0.53	-	0.414	3	-
 208	P	0.28	-	0.60	D	0.43	-	0.394	4	-
 209	L	0.34	-	0.58	D	0.36	-	0.364	5	-
 210	V	0.40	-	0.51	D	0.27	-	0.343	5	-
 211	K	0.45	-	0.48	D	0.33	-	0.343	5	-
 212	V	0.45	-	0.53	D	0.33	-	0.333	6	-
 213	T	0.46	-	0.55	D	0.34	-	0.354	5	-
 214	H	0.43	-	0.57	D	0.37	-	0.374	4	-
 215	H	0.32	-	0.63	D	0.46	-	0.364	5	-
 216	V	0.25	-	0.69	D	0.34	-	0.333	6	-
 217	T	0.32	-	0.69	D	0.31	-	0.347	5	-
 218	S	0.21	-	0.74	D	0.33	-	0.343	5	-
 219	S	0.16	-	0.70	D	0.27	-	0.333	6	-
 220	V	0.14	-	0.68	D	0.30	-	0.293	7	-
 221	T	0.16	-	0.54	D	0.36	-	0.273	8	-
 222	T	0.16	-	0.38	-	0.26	-	0.253	8	-
 223	L	0.19	-	0.20	-	0.25	-	0.242	9	-
 224	R	0.18	-	0.17	-	0.18	-	0.242	9	-
 225	C	0.21	-	0.18	-	0.17	-	0.250	9	-
 226	R	0.23	-	0.18	-	0.18	-	0.253	8	-
 227	A	0.15	-	0.17	-	0.19	-	0.253	8	-
 228	L	0.08	-	0.23	-	0.25	-	0.263	8	-
 229	N	0.08	-	0.32	-	0.19	-	0.263	8	-
 230	Y	0.09	-	0.35	-	0.24	-	0.263	8	-
 231	Y	0.07	-	0.38	-	0.18	-	0.253	8	-
 232	P	0.06	-	0.47	D	0.23	-	0.260	8	-
 233	Q	0.05	-	0.57	D	0.23	-	0.260	8	-
 234	N	0.05	-	0.56	D	0.17	-	0.260	8	-
 235	I	0.08	-	0.41	-	0.28	-	0.263	8	-
 236	T	0.10	-	0.39	-	0.45	-	0.280	7	-
 237	M	0.10	-	0.28	-	0.55	-	0.273	8	-
 238	K	0.12	-	0.29	-	0.55	-	0.283	7	-
 239	W	0.18	-	0.31	-	0.56	-	0.293	7	-
 240	L	0.16	-	0.46	-	0.56	-	0.330	6	-
 241	K	0.09	-	0.56	D	0.65	D	0.364	5	-
 242	D	0.13	-	0.70	D	0.76	D	0.444	2	-
 243	K	0.13	-	0.69	D	0.76	D	0.480	1	-
 244	Q	0.13	-	0.66	D	0.93	D	0.531	0	D
 245	P	0.17	-	0.73	D	0.92	D	0.520	0	D
 246	M	0.28	-	0.65	D	0.90	D	0.525	0	D
 247	D	0.31	-	0.68	D	0.87	D	0.515	0	-
 248	A	0.36	-	0.70	D	0.87	D	0.520	0	D
 249	K	0.40	-	0.69	D	0.89	D	0.485	1	-
 250	E	0.41	-	0.67	D	0.79	D	0.490	1	-
 251	F	0.32	-	0.65	D	0.76	D	0.469	1	-
 252	E	0.41	-	0.66	D	0.69	D	0.465	1	-
 253	P	0.55	D	0.57	D	0.74	D	0.515	0	-
 254	K	0.47	-	0.54	D	0.56	-	0.455	2	-
 255	D	0.39	-	0.59	D	0.56	-	0.384	4	-
 256	V	0.36	-	0.59	D	0.70	D	0.394	4	-
 257	L	0.29	-	0.51	D	0.59	D	0.343	5	-
 258	P	0.31	-	0.56	D	0.42	-	0.343	5	-
 259	N	0.27	-	0.60	D	0.34	-	0.337	6	-
 260	G	0.23	-	0.65	D	0.26	-	0.354	5	-
 261	D	0.16	-	0.56	D	0.23	-	0.343	5	-
 262	G	0.12	-	0.56	D	0.23	-	0.313	6	-
 263	T	0.08	-	0.45	-	0.22	-	0.293	7	-
 264	Y	0.08	-	0.41	-	0.16	-	0.273	8	-
 265	Q	0.06	-	0.40	-	0.16	-	0.263	8	-
 266	G	0.10	-	0.36	-	0.13	-	0.253	8	-
 267	W	0.11	-	0.29	-	0.13	-	0.253	8	-
 268	I	0.09	-	0.28	-	0.14	-	0.253	8	-
 269	T	0.12	-	0.29	-	0.15	-	0.270	8	-
 270	L	0.14	-	0.28	-	0.16	-	0.270	8	-
 271	A	0.15	-	0.40	-	0.19	-	0.283	7	-
 272	V	0.10	-	0.43	-	0.29	-	0.283	7	-
 273	P	0.09	-	0.51	D	0.43	-	0.273	8	-
 274	P	0.11	-	0.65	D	0.31	-	0.273	8	-
 275	G	0.11	-	0.80	D	0.45	-	0.290	7	-
 276	E	0.10	-	0.79	D	0.35	-	0.273	8	-
 277	E	0.08	-	0.78	D	0.50	-	0.293	7	-
 278	Q	0.07	-	0.69	D	0.36	-	0.273	8	-
 279	R	0.10	-	0.57	D	0.42	-	0.273	8	-
 280	Y	0.20	-	0.35	-	0.42	-	0.250	9	-
 281	T	0.18	-	0.30	-	0.36	-	0.242	9	-
 282	C	0.16	-	0.20	-	0.28	-	0.242	9	-
 283	Q	0.21	-	0.26	-	0.19	-	0.250	9	-
 284	V	0.24	-	0.28	-	0.21	-	0.253	8	-
 285	E	0.16	-	0.36	-	0.31	-	0.263	8	-
 286	H	0.13	-	0.36	-	0.33	-	0.283	7	-
 287	P	0.15	-	0.61	D	0.32	-	0.293	7	-
 288	G	0.16	-	0.56	D	0.22	-	0.293	7	-
 289	L	0.19	-	0.62	D	0.22	-	0.280	7	-
 290	D	0.16	-	0.70	D	0.15	-	0.280	7	-
 291	Q	0.19	-	0.66	D	0.14	-	0.263	8	-
 292	P	0.25	-	0.68	D	0.14	-	0.273	8	-
 293	L	0.34	-	0.49	D	0.15	-	0.253	8	-
 294	I	0.36	-	0.44	-	0.20	-	0.250	9	-
 295	V	0.38	-	0.41	-	0.18	-	0.263	8	-
 296	I	0.39	-	0.44	-	0.18	-	0.283	7	-
 297	W	0.39	-	0.47	D	0.17	-	0.280	7	-
 298	E	0.33	-	0.55	D	0.21	-	0.293	7	-
 299	P	0.17	-	0.65	D	0.20	-	0.337	6	-
 300	S	0.17	-	0.69	D	0.20	-	0.354	5	-
 301	P	0.16	-	0.71	D	0.20	-	0.354	5	-
 302	S	0.11	-	0.71	D	0.26	-	0.343	5	-
 303	G	0.12	-	0.68	D	0.17	-	0.303	7	-
 304	T	0.18	-	0.60	D	0.14	-	0.293	7	-
 305	L	0.20	-	0.53	D	0.14	-	0.263	8	-
 306	V	0.16	-	0.40	-	0.13	-	0.260	8	-
 307	I	0.12	-	0.29	-	0.13	-	0.242	9	-
 308	G	0.11	-	0.28	-	0.13	-	0.242	9	-
 309	V	0.09	-	0.20	-	0.14	-	0.240	9	-
 310	I	0.06	-	0.15	-	0.14	-	0.240	9	-
 311	S	0.05	-	0.14	-	0.14	-	0.242	9	-
 312	G	0.03	-	0.16	-	0.14	-	0.242	9	-
 313	I	0.03	-	0.17	-	0.16	-	0.242	9	-
 314	A	0.03	-	0.15	-	0.17	-	0.240	9	-
 315	V	0.03	-	0.16	-	0.18	-	0.240	9	-
 316	F	0.03	-	0.14	-	0.26	-	0.240	9	-
 317	V	0.03	-	0.14	-	0.26	-	0.232	9	-
 318	V	0.04	-	0.14	-	0.26	-	0.232	9	-
 319	I	0.04	-	0.14	-	0.37	-	0.242	9	-
 320	L	0.04	-	0.15	-	0.42	-	0.240	9	-
 321	F	0.03	-	0.12	-	0.40	-	0.242	9	-
 322	I	0.03	-	0.15	-	0.43	-	0.242	9	-
 323	G	0.03	-	0.15	-	0.48	-	0.242	9	-
 324	I	0.03	-	0.17	-	0.33	-	0.232	9	-
 325	L	0.03	-	0.16	-	0.18	-	0.232	9	-
 326	F	0.04	-	0.18	-	0.14	-	0.232	9	-
 327	I	0.05	-	0.23	-	0.13	-	0.232	9	-
 328	I	0.06	-	0.28	-	0.13	-	0.232	9	-
 329	L	0.06	-	0.33	-	0.14	-	0.240	9	-
 330	R	0.07	-	0.40	-	0.17	-	0.250	9	-
 331	K	0.07	-	0.47	D	0.23	-	0.273	8	-
 332	R	0.09	-	0.56	D	0.29	-	0.313	6	-
 333	Q	0.16	-	0.64	D	0.29	-	0.364	5	-
 334	G	0.23	-	0.70	D	0.40	-	0.434	2	-
 335	S	0.25	-	0.76	D	0.35	-	0.414	3	-
 336	R	0.36	-	0.76	D	0.20	-	0.404	3	-
 337	G	0.43	-	0.77	D	0.15	-	0.414	3	-
 338	A	0.47	-	0.73	D	0.13	-	0.408	3	-
 339	M	0.57	D	0.69	D	0.13	-	0.414	3	-
 340	G	0.59	D	0.56	D	0.13	-	0.404	3	-
 341	H	0.62	D	0.56	D	0.13	-	0.414	3	-
 342	Y	0.39	-	0.47	D	0.14	-	0.439	2	-
 343	V	0.34	-	0.47	D	0.15	-	0.469	1	-
 344	L	0.37	-	0.59	D	0.18	-	0.515	0	-
 345	A	0.35	-	0.74	D	0.17	-	0.515	0	-
 346	E	0.31	-	0.89	D	0.17	-	0.520	0	D
 347	R	0.35	-	0.91	D	0.23	-	0.525	0	D
 348	E	0.34	-	0.92	D	0.38	-	0.520	0	D


Key for output


Number - residue number Residue - amino-acid type NORSnet - raw score by NORSnet (prediction of unstructured loops) NORS2st - two-state prediction by NORSnet; D=disordered PROFbval - raw score by PROFbval (prediction of residue flexibility from sequence) Bval2st - two-state prediction by PROFbval Ucon - raw score by Ucon (prediction of protein disorder using predicted internal contacts) Ucon2st - two-state prediction by Ucon MD - raw score by MD (prediction of protein disorder using orthogonal sources) MD_rel - reliability of the prediction by MD; values range from 0-9. 9=strong prediction MD2st - two-state prediction by MD

Prediction of transmembrane alpha-helices and signal peptides

TMHMM

Phobius and PolyPhobius

For Phobius and PolyPhobius, we used http://phobius.sbc.su.se/ with standard settings.

Phobius

predicted regions by Phobius

Phobius predicts very accurate as seen below. The transmembrane region is predicted just 1-2 residues upstream from the annotated region. The same holds for the topological domains before and after the transmembrane region. Also the signal peptid is correctly predicted.

PREDICTED                                                     ANNOTATION
ID   sp|Q30201|HFE_HUMAN
FT   SIGNAL        1     21                             |  1-20
FT   REGION        1      7       N-REGION.              
FT   REGION        8     16       H-REGION.
FT   REGION       17     21       C-REGION.
FT   TOPO_DOM     22    304       NON CYTOPLASMIC.      |  23-306
FT   TRANSMEM    305    329                             |  307-330
FT   TOPO_DOM    330    348       CYTOPLASMIC.          |  331-348

PolyPhobius

predicted regions by PolyPhobius

PolyPhobius also predicts very accurate but in our case not as accurate as Phobius.

PREDICTED                                                     ANNOTATION
ID   sp|Q30201|HFE_HUMAN
FT   SIGNAL        1     23                             |  1-20
FT   REGION        1      5       N-REGION.              
FT   REGION        6     19       H-REGION.
FT   REGION       20     23       C-REGION.
FT   TOPO_DOM     24    304       NON CYTOPLASMIC.      |  23-306
FT   TRANSMEM    305    329                             |  307-330
FT   TOPO_DOM    330    348       CYTOPLASMIC.          |  331-348

OCTOPUS and SPOCTOPUS

Both, OCTOPUS and SPOCTOPUS predict the signal peptide and the transmembrane region correctly.

predicted regions by OCTOPUS
predicted regions by SPOCTOPUS

SignalP

TargetP

TargetP does not predict the signal peptide of the HFE-protein.

### targetp v1.1 prediction results ##################################
Number of query sequences:  1
Cleavage site predictions not included.
Using NON-PLANT networks.

Name                  Len            mTP     SP  other  Loc  RC
----------------------------------------------------------------------
sp_Q30201_HFE_HUMAN   348          0.433  0.912  0.004   S    3
----------------------------------------------------------------------
cutoff                             0.000  0.000  0.000

Prediction of GO terms

general

HFE is annotated with 27 different GO Terms which are <ref>http://www.ebi.ac.uk/QuickGO/GProtein?ac=Q30201</ref>:

GOID GO Term Aspect
GO:0002474 antigen processing and presentation of peptide antigen via MHC class I Process
GO:0005515 protein binding Function
GO:0005737 cytoplasm Component
GO:0005769 early endosome Component
GO:0005886 plasma membrane Component
GO:0005887 integral to plasma membrane Component
GO:0006461 protein complex assembly Process
GO:0006810 transport Process
GO:0006811 ion transport Process
GO:0006826 iron ion transport Process
GO:0006879 cellular iron ion homeostasis Process
GO:0006898 receptor-mediated endocytosis Process
GO:0006955 immune response Process
GO:0007565 female pregnancy Process
GO:0010106 cellular response to iron ion starvation Process
GO:0016020 membrane Component
GO:0016021 integral to membrane Component
GO:0019882 antigen processing and presentation Process
GO:0031410 cytoplasmic vesicle Component
GO:0042446 hormone biosynthetic process Process
GO:0042612 MHC class I protein complex Component
GO:0045177 apical part of cell Component
GO:0045178 basal part of cell Component
GO:0048471 perinuclear region of cytoplasm Component
GO:0055037 recycling endosome Component
GO:0055072 iron ion homeostasis Process
GO:0060586 multicellular organismal iron ion homeostasis Process

GOPET

Gopet predicted 2 GO-Terms which have no overlap to the annotation.

GOID Aspect Confidence GO Term
GO:0004872 Molecular Function 91% receptor activity
GO:0030106 Molecular Function 88% MHC class I receptor activity

Pfam

ProtFun 2.2

ProtFun is an ab initio prediction server.

 Functional category                  Prob     Odds
 Amino_acid_biosynthesis              0.011    0.484
 Biosynthesis_of_cofactors            0.105    1.452
 Cell_envelope                     => 0.633   10.377
 Cellular_processes                   0.095    1.297
 Central_intermediary_metabolism      0.231    3.663
 Energy_metabolism                    0.059    0.659
 Fatty_acid_metabolism                0.016    1.265
 Purines_and_pyrimidines              0.583    2.400
 Regulatory_functions                 0.013    0.079
 Replication_and_transcription        0.019    0.073
 Translation                          0.079    1.801
 Transport_and_binding                0.732    1.785

 Enzyme/nonenzyme                     Prob     Odds
 Enzyme                               0.208    0.727
 Nonenzyme                         => 0.792    1.110

 Enzyme class                         Prob     Odds
 Oxidoreductase (EC 1.-.-.-)          0.084    0.404
 Transferase    (EC 2.-.-.-)          0.062    0.179
 Hydrolase      (EC 3.-.-.-)          0.135    0.425
 Lyase          (EC 4.-.-.-)          0.049    1.054
 Isomerase      (EC 5.-.-.-)          0.010    0.321
 Ligase         (EC 6.-.-.-)          0.042    0.827

 Gene Ontology category               Prob     Odds
 Signal_transducer                    0.201    0.939
 Receptor                             0.353    2.076
 Hormone                              0.002    0.365
 Structural_protein                   0.005    0.190
 Transporter                          0.024    0.219
 Ion_channel                          0.008    0.147
 Voltage-gated_ion_channel            0.002    0.085
 Cation_channel                       0.010    0.221
 Transcription                        0.036    0.283
 Transcription_regulation             0.018    0.147
 Stress_response                      0.274    3.108
 Immune_response                   => 0.381    4.486
 Growth_factor                        0.013    0.943
 Metal_ion_transport                  0.009    0.02

Reference

<references />